Small Pack Antibodies Sigma-Aldrich
- Сортировать:
- Вид таблицей
-
Anti- Actinin antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200813-25UL SAB4200813-100UL General descriptionMonoclonal Anti- α Actinin (mouse IgM isotype) is derived from the hybridoma BM-72.5 produced by the fusion of mouse myeloma cells and splenocytes from mice immunized with a cytoskeletal fraction of bovine mammary gland epithelium (BMGE) cultured cells. α-Actinin is an actin binding protein present in both muscle and non-muscle cells. It has a molecular weight of 100,000 daltons and forms dimers in solution. In normal skeletal muscle, α-actinin is associated with the z-discs that define muscle sarcomeres. In smooth muscle, α-actinin has been detected in dense bodies and plaques characteristic of the tissue.
Specificity
Monoclonal Anti-α-Actinin specifically recognizes α-Actinin from human1, mouse2, rat3, chicken4, monkey, canine and bovine origin.ImmunogenCytoskeletal fraction of bovine mammary gland epithelium (BMGE) cultured cells.ApplicationAnti-α Actinin antibody may be used in various immunochemical techniques including Immunoblot (~100 kDa), Immunohistochemistry and Immunofluorescence. Monoclonal Anti-α-Actinin may be used for immunofluorescent localization of α-actinin in cultured cells and tissues, for immunofluorescent labeling of skeletal muscle (normal and pathological) in order to detect its organizational state, studies of membrane anchorage sites and immunochemical identification of α-actinin by immunoblotting analysis.
Biochem/physiol Actions
α-actinin has extensive proteins association with actin containing stress fibers, in particular with their membrane bound termini.
α-actinin modulates muscle contraction and has a role in cytoskeletal organisation. α-actinin acts as an actin crosslinker and scaffold. Mutations in this gene has been linked to heterogeneous hypertrophic cardiomyopathy and juvenile onset atrial fibrillation.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone BM-75.2, monoclonal mol wt ~100 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 0.5-1 µg/mL using human HeLa cells extract.","immunofluorescence: 5-10 µg/mL using human foreskin fibroblast Hs68 cells. isotype IgM UniProt accession no. P12814, shipped in dry ice storage temp. 20°C Gene Information human ... ACTN1(87)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti- CD161 (NK1.1) (mouse), APC, clone PK136 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1487 MABF1488 General descriptionThe PK136 antibody is specific for mouse NK1.1, a type II transmembrane lectin-like receptor and member of the killer cell lectin-like receptor (KLR) family. NK1.1 is prominently expressed on natural killer (NK) cells, and is correlated with NK cytotoxic effects toward virus-infected cells and tumor cells. NK1.1 is expressed on subsets of NKT cells in certain mouse strains (C57BL/6, FVB/N, and NZB), yet absent from others (AKR, BALB/c, CBA/J, C3H, DBA/1, DBA/2, NOD, SJL, and 129). Putative subsets of NK cells and their expression of NK1.1 antigen are of continuing interest, including NK1.1+/CD117+ (c-Kit) cells reported to be immunosuppressive for CD8+ T cells in a mechanism involving PD-1 and PD-L1 (Ehlers et al. 2012. Endocrinology. 10: 1247).The PK136 antibody may be used for detection of NK1.1 expression on mouse strains including CE, B6, NZB, C58, Ma/My, ST, SJL, and FVB. The antibody is reported to react with an epitope common to NKR-P1B and NKR-P1C alloantigenic forms of NK1.1 (Carlyle et al. 2006. J. Immunol. 176: 7511-7524).ImmunogenImmunogen information for this antibody is proprietary information.ApplicationThis mouse monoclonal Anti- CD161 (NK1.1) Antibody (mouse), APC, clone PK136, Cat. No. MABF1488 is validated for use in Flow Cytometry, for the detection of CD161 (NK1.1).
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.125 µg from a representative lot detected CD161 (NK1.1) in one million C57Bl/6 splenocytes stained with FITC Anti-mouse CD3e.
Physical form
Purified by size-exclusion chromatography
Purified Mouse monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone PK136, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2a conjugate Allophycocyanin conjugate UniProt accession no. P27812,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti- CD161 (NK1.1) (mouse), PE, clone PK136 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1492 MABF1491 General descriptionThe PK136 antibody is specific for mouse NK1.1, a type II transmembrane lectin-like receptor and member of the killer cell lectin-like receptor (KLR) family. NK1.1 is prominently expressed on natural killer (NK) cells, and is correlated with NK cytotoxic effects toward virus-infected cells and tumor cells. NK1.1 is expressed on subsets of NKT cells in certain mouse strains (C57BL/6, FVB/N, and NZB), yet absent from others (AKR, BALB/c, CBA/J, C3H, DBA/1, DBA/2, NOD, SJL, and 129). Putative subsets of NK cells and their expression of NK1.1 antigen are of continuing interest, including NK1.1+/CD117+ (c-Kit) cells reported to be immunosuppressive for CD8+ T cells in a mechanism involving PD-1 and PD-L1 (Ehlers et al. 2012. Endocrinology. 10: 1247).The PK136 antibody may be used for detection of NK1.1 expression on mouse strains including CE, B6, NZB, C58, Ma/My, ST, SJL, and FVB. The antibody is reported to react with an epitope common to NKR-P1B and NKR-P1C alloantigenic forms of NK1.1 (Carlyle et al. 2006. J. Immunol. 176: 7511-7524).ImmunogenImmunogen information for this antibody is proprietary information.ApplicationResearch Sub Category
Immunoglobulins & Immunology
This mouse monoclonal Anti- CD161 (NK1.1) Antibody (mouse), PE, clone PK136, Cat. No. MABF1491 is validated for use in Flow Cytometry, for the detection of CD161 (NK1.1).
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg from a representative lot detected CD161 (NK1.1) in one million C57Bl/6 splenocytes stained with APC Anti-mouse CD3e.
Physical form
Purified by size-exclusion chromatography
Purified Mouse monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone PK136, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2a conjugate PE UniProt accession no. P27816, Gene Information human ... MAP4(4134)
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti- CD161 (NK1.1) (mouse), PerCP-Cy5.5, clone PK136 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1494 MABF1493 General descriptionThe PK136 antibody is specific for mouse NK1.1, a type II transmembrane lectin-like receptor and member of the killer cell lectin-like receptor (KLR) family. NK1.1 is prominently expressed on natural killer (NK) cells, and is correlated with NK cytotoxic effects toward virus-infected cells and tumor cells. NK1.1 is expressed on subsets of NKT cells in certain mouse strains (C57BL/6, FVB/N, and NZB), yet absent from others (AKR, BALB/c, CBA/J, C3H, DBA/1, DBA/2, NOD, SJL, and 129). Putative subsets of NK cells and their expression of NK1.1 antigen are of continuing interest, including NK1.1+/CD117+ (c-Kit) cells reported to be immunosuppressive for CD8+ T cells in a mechanism involving PD-1 and PD-L1 (Ehlers et al. 2012. Endocrinology. 10: 1247).The PK136 antibody may be used for detection of NK1.1 expression on mouse strains including CE, B6, NZB, C58, Ma/My, ST, SJL, and FVB. The antibody is reported to react with an epitope common to NKR-P1B and NKR-P1C alloantigenic forms of NK1.1 (Carlyle et al. 2006. J. Immunol. 176: 7511-7524).ImmunogenImmunogen information for this antibody is proprietary information.ApplicationResearch Sub Category
Immunoglobulins & Immunology
This Anti- CD161 (NK1.1) (mouse), PerCP-Cy5.5, clone PK136 Antibody is validated for use in Flow Cytometry for the detection of CD161.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected CD161 (NK1.1) in one million C57Bl/6 splenocytes were stained with FITC Anti-mouse CD3e.
Physical form
Purified by size-exclusion chromatography
Purified Mouse monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone PK136, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2a conjugate PerCP-Cy5.5 UniProt accession no. P27812,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti- III tubulin Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер AB15708-25UG AB15708
Specificity
Beta III Tubulin. By Western blot the antibody recognizes a band at ~50 kDa on mouse brain lysate. No reactivity with 3T3 cell lysate by Western blot.
It is expected that the antibody will react with most mammalian species.ImmunogenSynthetic peptide from human beta III tubulin.ApplicationAnti-β III tubulin Antibody is an antibody against β III tubulin for use in WB.
Research Category
Neuroscience
Research Sub Category
Neuronal & Glial Markers
Neurofilament & Neuron Metabolism
Western blot: 0.05-0.1 µg/mL on mouse brain lysate.
Optimal working dilutions must be determined by end user.
Quality
Tested
Physical form
Liquid in PBS with 0.1% sodium azide.
Format: Purified
ImmunoAffinity Purified
Storage and Stability
Maintain at 2-8°C in undiluted aliquots for up to 6 months after date of receipt.Other Notesfeature_concentration_valuePlease refer to lot specific datasheet.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) western blot: suitable NCBI accession no. NM_006086.2, UniProt accession no. Q13509, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti- Neurofilament 200-FITC antibody, Mouse monoclonal
Кат. номер SAB4200811-25UL SAB4200811-100UL General descriptionNeurofilaments are type of intermediate filaments (IFs) that serve as major elements of the cytoskeleton supporting the axon cytoplasm of neuronal cells. IFs are components of most eukaryotic cells and significantly differ from other cytoskeletal elements of the cell, namely microtubules and microfilaments.
Specificity
Monoclonal Anti-Neurofilament 200, also known as Neurofilament-H or Heavy subunit, specifically recognizes the phosphorylated H tail of Neurofilament 200 and shows no reactivity on enzymatically dephosphorylated neurofilaments.2 The antibody shows reactivity with neurofilaments in the central and peripheral nervous systems from human1, pig1, mouse3, rat4, chicken3, guinea pig3, feline3 and bovine3 origin.ImmunogenNeurofilaments purified from pig spinal cordApplicationThe antibody may be used in various immunochemical techniques including Immunohistochemistry and Immunoblotting (~200 kDa).1-7
Biochem/physiol Actions
Neurofilaments undergo post-translational modifications including different levels of phosphorylation, which has been suggested to modulate their function by influencing the interaction between neurofilament and cytoplasmic organelles. Neurofilaments are built from three intertwined protofibrils of apparent molecular weights [68 (L), 160 (M) and 200 (H) kDa] which are themselves composed of two tetrameric protofilament complexes of monomeric proteins. Neurofilament 200 also known as Neurofilament heavy polypeptide (H-subunit), NF-H, NEFH or 200 kDa neurofilament protein, has an important function in mature axons that is not subserved by the two smaller neurofilament proteins.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours. Protect from prolonged exposure to light.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone NE14, monoclonal form buffered aqueous solution mol wt 200 kDa species reactivity guinea pig, rat, bovine, mouse, feline, chicken, human, pig packaging antibody small pack of 25 μL concentration ~1 mg/mL application(s) immunohistochemistry: 1:200-1:400 (4-8 ug/mL) using enzyme treated formalin-fixed, paraffin-embedded rat Cerebellum sections conjugate FITC conjugate shipped in dry ice storage temp. −20°C Gene Information human ... NEFH(4744)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Actin antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер A8481-200UL A8481-25UL General descriptionγ-Actin is mainly present in sarcolemma and to a lesser extent in reticular lattice of normal muscles. Increased levels of γ-actin have been linked to dystrophin loss and subsequent cell signaling and gene expression defects.
Monoclonal Anti--Actin (mouse IgG1 isotype) is derived from the hybridoma 2-2.1.14.17 produced by the fusion of mouse myeloma cells (NS1) and splenocytes from BALB/c mice. Actin is one of the most conserved eukaryotic proteins, it is expressed in mammals and birds as at least six isoforms. Actin isoforms show more than 90% overall sequence homology, but only 50-60% homology in their 18 NH2-terminal residues. Actin constitutes for around 15% of the total protein. It exists in globular and filamentous forms.
Specificity
Monoclonal Anti-γ-Actin recognizes human, bovine, canine, mouse, hamster and chicken γ-actin.ApplicationAnti--Actin antibody, Mouse monoclonal has been used in :- immunofluorescence
- enzyme linked immunosorbent assay (ELISA)
- western blotting
- immunohistochemistry
Protein lysates from human Jurkat T-leukemic cells were subjected to western blot and probed using monoclonal mouse anti-actin (AC-40) to ensure equal loading.
Mouse monoclonal Anti-γ-Actin antibody has been used for immunofluorescence assays. The antibody can also be used for ELISA, IHC and western blot assays.
Biochem/physiol Actions
The two major cytoskeletal proteins implicated in cell motility are actin and myosin. Actin is significantly involved in the microfilament system. It participates in muscle contraction and gene regulation. Actin and myosin are constituents of many cell types and are involved in a myriad of cellular process including locomotion, secretion, cytoplasmic streaming, phagocytosis and cytokinesis. Increased levels of γ-actin have been linked to dystrophin loss and subsequent cell signaling and gene expression defects.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.Other NotesDisclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone 2-2.1.14.17, monoclonal form buffered aqueous solution mol wt antigen ~43 kDa species reactivity bovine, human, canine, mouse, hamster, chicken packaging antibody small pack of 25 µL concentration ~2 mg/mL application(s) immunohistochemistry: suitable","indirect ELISA: suitable","western blot: 0.25-0.5 µg/mL using total cell extract of 3T3 cells isotype IgG1 conjugate unconjugated UniProt accession no. P63261, shipped in dry ice storage temp. 20°C Gene Information bovine ... ACTG1(404122)
canine ... LOC475123(475123)
chicken ... RCJMB04_1h13(415296)
human ... ACTG1(71)
mouse ... Actg1(11465)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Amyloid (1-42) Rabbit pAb
Кат. номер PC150-25UG PC150-25UGCN General descriptionRabbit polyclonal antibody adsorbed against A1-40 and A1-43, followed by immunoaffinity purification. Recognizes specifically -amyloid peptide (1-42).
Recognizes specifically -amyloid peptide (1-42). Does not cross-react with -amyloid peptide (1-40) or -amyloid peptide (1-43).- Antibody Target Gene Symbol: APP
- Target Synonym: AAA, AD1, Adap, AL024401, Amyloid precursor, Amyloidogenic glycoprotein, APP isoform 1, APPI, appican, CTFgamma, CVAP, E030013M08RIK, Nexin II, P3, PN2, PreA4, PROTEASE NEXIN2
- Entrez Gene Name: amyloid beta (A4) precursor protein
- Hu Entrez ID: 351 (Related Antibodies: 171610, PC729,PC152, PC151, PC149, NE1012,171609, 171608, 171607, 171606, 171605, 171604, 171603, 171598, 171537)
- Mu Entrez ID: 11820
- Rat Entrez ID: 54226
This Anti-β-Amyloid (1-42) Rabbit pAb is validated for use in Dot Blot, ELISA, Radioimmunoassay for the detection of β-Amyloid (1-42).ImmunogenHuman
a synthetic peptide corresponding to amino acids from a C-terminal fragment of human β-amyloid peptide (1-42)
Packaging
25 μg in Plastic ampoule
Please refer to vial label for lot-specific concentration.ApplicationDot Blot (0.1-0.5 µg/ml)
ELISA (0.1-0.5 µg/ml)
Radioimmunoassay (0.5 µg/ml)
Warning
Toxicity: Standard Handling (A)
Physical form
In phosphate buffer, pH 7.4.
Reconstitution
Following initial thaw, aliquot and freeze (-20°C).Other NotesSavage, M.J., et al. 1998. J. Neurosci.15, 1743.
Borchelt, D.R., et al. 1997. Neuron19, 939.
Citron, M., et al. 1997. Nature Med.3, 67.
Hardy, J. 1997. Trends in Neurosci.20, 154.
Solomon, B., et al. 1997. Proc. Natl. Acad. Sci. USA94, 4109.
Duff, K., et al. 1996. Nature383, 710.
Iwatsubo, T., et al. 1994. Neuron13, 45.
Suzuki, N., et al. 1994. Science264, 133.
This antibody is specific for β-amyloid peptide [1-42] and shows no reactivity to β-amyloid peptide [1-40] or β-amyloid peptide [1-43]. This antibody is recommended for use in the quantitative determination of β-amyloid peptide [1-42]. The sensitivity level for sandwich ELISA is 15-25 pg. Antibody should be titrated for optimal results in individual systems.Legal InformationCALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыstorage conditions -20C biological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form liquid does not contain preservative species reactivity human packaging antibody small pack of 25 µg Торговая марка Calbiochem® storage condition OK to freeze, avoid repeated freeze/thaw cycles isotype IgG shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Amyloid (13-28) antibody, Mouse monoclonal
MDL number: MFCD07370937 NACRES: NA.41
Кат. номер A8978-200UL A8978-25UL General descriptionAmyloids are insoluble protein aggregates consisting of misfolded proteins and peptides. Amyloid deposition are associated with multiple neurodegenerative disorders.
The -amyloid precursor protein (APP) is cleaved sequentially by the proteolytic enzymes -secretase (BACE1) and -secretase to produce -amyloid (A) peptides with the A1-42 and the A1-40 forms being the most prevalent. Secreted A peptides are degraded either via a re-uptake mechanism followed by endosomal degradation, or by an extracellular insulin degrading enzyme. Extracellular accumulation of A leads to the formation of aggregates, fibrils and eventually amyloid deposits called neuritic plaques, which is the hallmark of Alzheimers disease (AD).
Monoclonal Anti -Amyloid [13-28] recognizes the -Amyloid peptide. The antibody epitope resides within amino acids 20-23.ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Mouse Monoclonal Anti-β-Amyloid (13-28) antibody can be used for immunoblotting assays at 1:5,000. The antibody can also be used for IHC, immunoprecipitation,fluorescence infrared spectroscopy and enzyme immunoassays (02-0.4μg/ml).
Physical form
Filtered solution in 0.01 M phosphate buffered saline, pH 7.4.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone BAM90.1, monoclonal form buffered aqueous solution species reactivity human packaging antibody small pack of 25 µL concentration ~2 mg/mL application(s) enzyme immunoassay: 0.2-0.4 µg/mL using amyloid -protein","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 conjugate unconjugated UniProt accession no. P05067, shipped in dry ice storage temp. 20°C Gene Information human ... APP(351)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves, RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Amyloid (22-35) antibody produced in rabbit
NACRES: NA.41
Кат. номер A3356-200UL A3356-25UL General descriptionRabbit anti-β-amyloid (22-35) antibody specifically recognizes β-amyloid (22-35), β-amyloid (25-35), β-amyloid (1-40) and β-amyloid (1-42) and does not react with β-amyloid (32-35) and β-amyloid (35-25) by ELISA. The antibody detects β-amyloid (1-40) by immunoblotting (approx. 4kDa). Staining of the β-amyloid (1-40) band in immunoblotting is specifically inhibited by the immunizing peptide.
Cleavage of the amyloid precursor protein (APP) by γ-secretase produces the small fragment amyloid β (Aβ) peptide. Cleavage of APP occurs mostly at residue 40 but to a lesser extent residue 42. The amyloid β peptide contains a ~100 kDa soluble N-terminal fragment, and intracellular C-terminal fragments (CTFs) bearing the complete Aβ domain.
Proteolytic cleavage of the amyloid precursor protein (APP) produces the small fragment amyloid β peptide. Cleavage of APP occurs mostly at residue 40 but to a lesser extent residue 42. Aggregates of amyloid β peptide are found deposited in the brains of Alzheimer′s patients.Immunogensynthetic peptide corresponding to amino acids 22-35 of human β-amyloid (1-40) fragment, conjugated to KLH. This sequence corresponds to amino acids 693-706 of the human amyloid precursor protein APP, and is identical in mouse and rat APP.ApplicationRabbit anti-β-amyloid (22-35) antibody can be used for ELISA at a concentration of 0.2-0.4μg/mL using β-amyloid peptide (22-35). The product can also be used for western blot at 0.25-0.5μg/mL using β-amyloid peptide (1-40).
Anti--Amyloid (22-35) antibody produced in rabbit has been used in:- western blot
- dot-blot assay
- indirect enzyme linked immunosorbent assay (ELISA)
Biochem/physiol Actions
Secreted Aβ lead to synaptic and neuritic compromise and glial activation. Aggregates of amyloid β peptide are found deposited in the brains of Alzheimer′s patients. Aβ(25-35) and Aβ(22-35) fragments are highly toxic segments of β-amyloid peptides that promote inflammatory processes in astrocytes and fibrillary aggregation of Aβ, thus representing a promising therapeutic target for Alzheimer′s.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide and 1% bovine serum albumin.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~4 kDa species reactivity mouse, human, rat packaging antibody small pack of 25 µL application(s) indirect ELISA: 0.2-0.4 µg/mL using -amyloid peptide (22-35)","western blot: 0.25-0.5 µg/mL using -amyloid peptide (1-40) conjugate unconjugated UniProt accession no. P05067, shipped in dry ice storage temp. 20°C Gene Information human ... APP(351)
mouse ... App(11820)
rat ... App(54226)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Catenin Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 6-734 6-734-25UG 6-734-100UG General description-catenin plays a central role in cell adhesion, bridging between cadherins and actin cytoskeleton. These activities are regulated through its differential interaction with several molecular partners, including cell-cell adherens junction (AJ) molecules, components of its degradation complex, and transcription factors.
-Catenin is composed of three domains: a central armadillo repeat domain and two N- and C-terminal tails. -catenin can be phosphorylated by serine-threonine kinase, such as GSK-3. The phosphorylated -catenin affects the protein association of -catenin to E-cadherin and -cateinin that occurs in the cell. This process can be reversed by de-phosphorylation of -catenin.
Specificity
Recognizes β-Catenin, Mr 92 kDa.ImmunogenKLH-conjugated, synthetic peptide (CGG-SYLDSGIHSGATTTAPSLSGK) corresponding to the consensus GSK3 phosphorylation site of human β -Catenin (amino acids 29-49).ApplicationResearch Sub Category
Transcription Factors
Immunoprecipitation:
5 µg of a previous lot immunoprecipitated -Catenin from 500 µg of A431 membrane fraction lysate.
Immunocytochemistry:
1-5 µg/mL of a previous lot showed positive immunostaining for -catenin at cell-cell junctions of A431 cells fixed with 4% paraformaldehyde and permeabilized with 0.25% Triton™ X-100.
Immunocytochemistry Analysis: A 1:100 dilution of this antibody detected beta-Catenin in A431 and HUVEC cell lines.
Use Anti-β-Catenin Antibody (Rabbit Polyclonal Antibody) validated in ICC, IP, WB to detect β-Catenin also known as catenin (cadherin-associated protein) beta 1 (88kD).
Research Category
Epigenetics & Nuclear Function
Quality
Routinely evaluated by western blot on A431 total cell lysate.
Western Blot Analysis:
0.1-1 µg/mL of this lot detected -catenin in an A431 total cell lysate.
Target description
92 kDa
Physical form
Purified rabbit polyclonal IgG in buffer containing 0.1M Tris Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4.
Format: Purified
Protein A chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Handling Recommendations: Prior to removing the cap, centrifuge the vial and gently mix the solution.
Analysis Note
Control
A431 cell lysate
Included Positive Antigen Control: Catalog #12-301, Non stimulated A431 cell lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationTriton is a trademark of The Dow Chemical Company or an affiliated company of Dow
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone polyclonal species reactivity bovine, rat, rabbit, mouse, human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_001091679, UniProt accession no. P35222, shipped in ambient Узнать цену -
Anti--Catenin antibody produced in rabbit
MDL number: MFCD02685970 NACRES: NA.41
Кат. номер C2206-25UL C2206-1ML C2206-.2ML General descriptionCatenin are distinct peripheral cytosolic proteins and are classified into α-, β- and γ-catenin (102 kDa, 94 kDa and 86 kDa respectively. It is found in varying abundance in many developing and adult tissues.
Specificity
The antibody does not cross react with α-catenin or γ-catenin (plakoglobin).Immunogensynthetic peptide corresponding to the C-terminal region (amino acids 768-781) of human/mouse β-catenin, conjugated with gluteraldehyde to KLH.ApplicationAnti--Catenin antibody produced in rabbit has been used in- co-immunoprecipitation
- immunoblotting
- immunofluorescence
- immunoperoxidase assay
Biochem/physiol Actions
Catenins bind, directly or indirectly, to the conserved cytoplasmic tail domain of the cell adhesion cadherins. The protein, -catenin, binds directly to the cytoplasmic tail of E-cadherin. Plakoglobin (probably identical to -catenin) and -catenin are structural and possibly functional mammalian homologues of armadillo (arm), a Drosophila protein involved in signal transduction. It binds to the amino terminus of -catenin and also interacts with the cytosolic protein product of the human tumor suppressor gene Adenomatous polyposis coli (APC). The central core region of -catenin is involved in mediation of the interaction of cadherin-catenin complex with the epidermal growth factor receptor. The protein, -catenin, is the target of two signal transduction pathways mediated by the protooncogenes Src and wingless-related integration site (Wnt-1). p120cas which exhibits structural similarity to -catenin and plakoglobin may represent another catenin associated with cadherin.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form whole antiserum antibody product type primary antibodies clone polyclonal mol wt antigen 88-94 kDa contains 15 mM sodium azide species reactivity several mammalian species packaging antibody small pack of 25 µL application(s) dot blot: suitable using the immunogen and related peptides conjugated to BSA, immunocytochemistry: 1:2,000 using cultured MDBK cells, immunohistochemistry: 1:2,000 using bovine kidney frozen sections, western blot: 1:4,000 using cultured MDBK cells conjugate unconjugated Featured Industry Research Pathology shipped in dry ice storage temp. 20°C Gene Information human ... CTNNB1(1499)
mouse ... Ctnnb1(12387)
rat ... Ctnnb1(84353)
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Synuclein Antibody, clone Syn211
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 36-008-25UL 36-008 36-008-100UL
Specificity
α-SynucleinImmunogenfull-length recombinant human α-SynucleinApplicationDetect α-Synuclein using this Anti-α-Synuclein Antibody, clone Syn211 validated for use in IP, WB, IH.
Research Category
Neuroscience
Research Sub Category
Neurodegenerative Diseases
Quality
Routinely evaluated by immunoblot on Alzheimers diseased human whole brain lysates.
Target description
~14.5kDaLinkageReplaces: 04-1053
Physical form
Ascites
Storage and Stability
2 years at -20°CLegal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form ascites fluid antibody product type primary antibodies clone Syn211, monoclonal species reactivity human packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable NCBI accession no. NM_000345.2,","NM_007308.1, UniProt accession no. P37840, shipped in ambient Gene Information human ... SNCA(6622) Узнать цену -
Anti--Synuclein antibody, Mouse monoclonal
MDL number: MFCD02095740 NACRES: NA.41
Кат. номер S5566-25UL S5566-100UL S5566-200UL General descriptionThe SNCA (synuclein α) gene is mapped to human chromosome 4q22.1. The gene encodes a small synaptic protein called α-synuclein.
The SNCA (synuclein α) gene codes for a 140-amino acid protein α-synuclein, that is mapped to human chromosome 4q21-23.Immunogenrecombinant human α synuclein.ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper),
Immunocytochemistry (1 paper),
Anti-α-Synuclein antibody, Mouse monoclonal has been used in western blotting and ELISA.
Biochem/physiol Actions
Synuclein-α is known to induce oligodendrocyte maturation. Accumulation of α-synuclein in oligodendrocytes results in the loss of myelin and causes neurodegeneration, leading to multiple system atrophy. Mutations in the SNCA gene results in Parkinsons disease.
Accumulation of α-synuclein in oligodendrocytes results in the loss of myelin and causes neurodegeneration, leading to multiple system atrophy. Synuclein-α is known to induce oligodendrocyte maturation. The encoded protein is considered to be an important aggregate of Lewy bodies, contributing to the pathogenesis of Parkinson disease.
Physical form
Solution in 0.01 M phosphate buffered saline pH 7.4, containing 1 % bovine serum albumin and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone Syn211, monoclonal form buffered aqueous solution mol wt antigen 19 kDa species reactivity human, zebra finch should not react with mouse, rat packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 0.25 µg/mL using recombinant human ·-synuclein. isotype IgG1 conjugate unconjugated UniProt accession no. P37840, shipped in dry ice storage temp. 20°C Gene Information human ... SNCA(6622)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Tubulin antibody produced in rabbit
Кат. номер T5192-.2ML T5192-25UL General descriptionγ-Tubulin, mapped on human chromosome 17q21.2, codes for a member of the tubulin family. It is localized to the microtubule organizing centres. γ-Tubulin consists of two isoforms tubulin γ 1 (TUBG1) and tubulinγ 2 (TUBG2) with 97.3% amino acid identity. In addition to these two isoforms, γ-tubulin pseudogene (TUBG1P) is also been identified on human chromosome 17. Human TUBG1 and TUBG2 transcripts are widely expressed in preimplantation embryos and the brain, respectively. γ-tubulin is a component of γ-tubulin ring complex (γ-TuRC), which has roughly the same diameter as a microtubule. γ-Tubulin does not polymerize with α-tubulin/β-tubulin, but instead it is localized to the centrosome and to the cytoplasm.Immunogensynthetic peptide corresponding to the N-terminal region of human -tubulin (amino acids 38-53, with C-terminally added lysine) conjugated to KLH. This sequence is specific for -tubulin and not found in other members of the tubulin family such as , and tubulins. This sequence is identical in mouse and rat -tubulin and highly conserved among species (Drosophila, Aspergillus, and yeast -tubulin).ApplicationAnti--Tubulin antibody produced in rabbit has been used in following studies:- Immunocytochemistry.
- Immunofluorescence.
- Immunoblotting.
- Staining in microscopy.
- Chromatin immunoprecipitation (ChIP).
Biochem/physiol Actions
-Tubulin nucleates microtubule assembly throughout the mammalian cell cycle in vivo. In Aspergillus nidulans, -tubulin facilitates attachment of microtubules to the spindle pole body, nuclear division and microtubule assembly. Ubiquitination of -tubulin by breast cancer 1 protein (BRCA1) is a crucial step in the regulation of centrosome number. Overexpression of -tubulin is observed in lung cancer. Tubulin 2 (TUBG2) plays a vital role in cell growth. Aberration in the -tubulin gene alters microtubule assembly. The expression levels of -tubulin can be considered as an important prognostic indicator for patients with astrocytomas.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% bovine serum albumin, and 15 mM sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 48 kDa species reactivity chicken, human packaging antibody small pack of 25 µL application(s) indirect immunofluorescence: 1:1,000 using methanol/acetone-fixed chicken fibroblasts cells","western blot: 1:1,000 using whole cell extract human epidermal carcinoma A431 cell line conjugate unconjugated UniProt accession no. P23258, storage temp. 20°C Gene Information human ... TUBG1(7283), TUBG2(27175)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti--Tubulin antibody, Mouse monoclonal
MDL number: MFCD00145891 NACRES: NA.41
Кат. номер T8203-100UL T8203-200UL T8203-25UL General descriptionAnti-α-Tubulin antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the hybridoma AA13 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with rat brain tubulin.
Tubulin 1a (TUBA1A) is a member of -tubulin gene family. It is encoded by the gene mapped to human chromosome 12q13.12. Tubulin 1a is a vital structural subunit of microtubules that are temporarily expressed in almost all post-mitotic neurons during neuronal development.
The encoded protein structure contains core of two -sheets enclosed by -helices. TUBA1A is characterized with an amino-terminal domain with the guanine nucleotide-binding region, an intermediate domain associated with interprotofilament lateral contacts and the modulation of tubulin curvature, and a carboxy-terminal domain that contains region involved in interacting with microtubule-associated proteins (MAPs) and molecular motors, such as kinesins and dynein.Immunogenrat brain tubulin.ApplicationAnti-α-Tubulin antibody, Mouse monoclonal has been used in western blotting.
The antibody has been used in various immunochemical techniques including immunoprecipitation, immunocytochemistry, and immunohistochemistry.
Biochem/physiol Actions
Gene mutation of tubulin α-1A (TUBA1A) is observed in perisylvian asymmetrical polymicrogyria, polymicrogyria-like cortical dysplasia, and microlissencephaly in foetal cases. Alteration in the expression of the gene impairs neural migration and causes lissencephaly (LIS).
Tubulin is the major building block of microtubules, which is a structural and mobile element in mitosis, intracellular transport, flagellar movement and the cytoskeleton. Monoclonal antibodies recognizing α-tubulin, together with monoclonal antibodies to other tubulin types (α-tubulin isotypes I, II, and III, tyrosine tubulin and acetylated- α -tubulin) provide a specific and useful tool in studying the intracellular distribution of tubulin, and the static and dynamic aspects of the cytoskeleton. In addition, the various tubulin forms have been implicated in cancerous processes and are thus suggested as potential targets for cancer therapy.
Target description
Tubulin is a cylindrical, filamentous structure is present inalmost all eukaryotic cells.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone AA13, monoclonal form buffered aqueous solution mol wt antigen ~50 kDa species reactivity human, mouse, rat packaging antibody small pack of 25 µL concentration ~2.0 mg/mL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","indirect ELISA: suitable","western blot: 1-2 µg/mL using Neuro-2a cell extract isotype IgG1 conjugate unconjugated UniProt accession no. Q71U36, shipped in dry ice storage temp. 20°C Gene Information human ... TUBA1A(7846)
mouse ... Tuba1a(22142)
rat ... Tuba1a(64158)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-2-Microglobulin antibody produced in rabbit
MDL number: MFCD00162400 NACRES: NA.41
Кат. номер M8523-2ML M8523-25UL General descriptionβ-2-microglobulin is part of the human leukocyte antigen, where it represents the light chain. It is expressed on cell membranes and is made up of 99 amino acids. β-2-microglobulin is part of the immunoglobulin superfamily.
β2-microglobulin (B2M) is a non-glycosylated polypeptide. The protein is characterized with a single polypeptide chain, which is linked noncovalently to major histocompatibility complex (MHC) class I cell surface antigen. The gene coding for B2M is mapped to human chromosome 15q.Immunogen2-microglobulinApplicationAnti-β2-Microglobulin antibody produced in rabbit has been used in immunoblottingand immunofluorescence.
Biochem/physiol Actions
β2-microglobulin (B2M) plays a vital role in cell survival, proliferation and metastasis in various types of cancer. Elevated concentration of β-2-microglobulin (B2M) can be considered as a prognostic marker for hemophagocytic lymphohistiocytosis (HLH). Overexpression of serum B2M is observed in hepatitis C virus (HCV) related chronic liver diseases, therefore it might act as a potential marker for the HCV disease progression towards cirrhosis and carcinoma. Missense mutation in the B2M gene results in familial hypercatabolic hypoproteinemia (FHH).
β-2-microglobulin acts as a tumor marker and has been shown to be associated with dialysis-related amyloidosis.
Quality
The antiserum has been treated to remove lipoprotens.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form whole antiserum antibody product type primary antibodies clone polyclonal contains 15 mM sodium azide species reactivity human packaging antibody small pack of 25 µL application(s) indirect ELISA: 1:5,000 conjugate unconjugated UniProt accession no. P61769, shipped in dry ice storage temp. 20°C Gene Information human ... B2M(567)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Узнать цену -
Anti-2A Peptide
Кат. номер ABS31-I-25UG ABS31-I-100UG General descriptionGenome polyprotein (UniProt: P03305) is encoded by the D1Y31_gp1 gene (Gene ID: 37627025) in Foot-and-mouth disease virus. Following its synthesis, it is cleaved into 15 different chains. P2A chain resides in the amino acids 936-953 in the internal region. 2A peptides and 2A-like peptide sequences (known as cis-acting hydrolase elements or CHYSEL) are a superior alternative to internal ribosomal entry sites (IRES) for coordinating the expression of multiple gene products from a single recombinant construct. The 2A sequences are relatively short peptides of about 16-20 amino acids (depending on the virus of origin). They contain a highly conserved sequence, GDVEXNPGP, at the C-terminus, which is shared by different 2As and is essential for the creation of steric hindrance and ribosome skipping. These peptides allow multiple proteins to be encoded as polyproteins, which then dissociate into component proteins upon translation. The 2A sequence impairs normal peptide bond formation via a mechanism called ribosomal skipping, which results in effective, non-enzymatic generation of distinct peptide products from a single multi-cistronic construct. These peptides are used by several families of viruses, the best-known amongst these are foot-and-mouth disease virus 2A (F2A) and Thosea asigna virus 2A (T2A). This rabbit polyclonal antibody reacts with protein in lysate from HEK293T cells transfected with various 2A-tagged proteins. (Ref.: Liu, Z., et al. (2017). Scientific Reports.7; Article number: 2193).
Specificity
This rabbit polyclonal antibody detects 2A peptide tagged proteins.ImmunogenKLH-conjugated linear peptide corresponding to 18 amino acids (936-953) 2A peptide of Foot-and-mouth disease virus.ApplicationQuality Control Testing
Evaluated by Western Blotting in lysate from HEK293T cells transfected with CD3/g/d/e chains.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected 2A in lysate from HEK293T cells transfected with CD3/g/d/e chains.
Tested Applications
Affinity Binding Assay: A representative lot of this antibody bound 2A peptide with a KD of 1.0 x 10-12 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-2A Peptide, Cat. No. ABS31-I, is a rabbit polyclonal antibody that detects 2A peptide tagged proteins and is tested for use in Affinity Binding Assay and Western Blotting.
Physical form
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form purified antibody antibody product type primary antibodies clone polyclonal mol wt calculated mol wt 258.93 kDa","observed mol wt ~21, 26, and 31 kDa purified by affinity chromatography species reactivity all packaging antibody small pack of 100 µg application(s) affinity binding assay: suitable","western blot: suitable isotype IgG epitope sequence Internal conjugate unconjugated UniProt accession no. P03305, shipped in 2-8°C Gene Information Unknown ... D1Y31_gp1(37627025) Узнать цену -
Anti-2A peptide Antibody, clone 3H4
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2005-25UG MABS2005 General description2A peptides and 2A-like peptide sequences (known as cis-acting hydrolase elements or CHYSEL) are a superior alternative to internal ribosomal entry sites (IRES) for coordinating the expression of multiple gene products from a single recombinant construct. The 2A sequences are relatively short peptides of about 20 amino acids (depending on the virus of origin) containing the consensus motif Asp-Val/Ile-Glu-X-Asn-Pro-Gly-Pro. 2A peptides allow multiple proteins to be encoded as polyproteins, which then dissociate into component proteins upon translation. The 2A sequence impairs normal peptide bond formation via a mechanism called ribosomal skipping, which results in effective, non-enzymatic generation of distinct peptide products from a single multicistronic construct. 2A peptides are used by several families of viruses, the best known foot-and-mouth disease virus of the Picornaviridae family, for producing multiple polypeptides. Anti-2A peptide, clone 3H4 recognizes 2A sequence derived from foot and mouth piconavirus (VKQTLNFDLLKLAGDVESNPG*P) with cleavage site between G and P. (Ref.: Trichas, G, et al. (2008). BMC Biol. 6: 40).
Specificity
Clone 3H4 detects 2A peptide in murine cells.ImmunogenKLH-conjuated linear peptide corresponding to sequence CGDVEENPG (free C-term) derived from Thosea asigna virus.ApplicationResearch Category
Secondary & Control Antibodies
Anti-2A peptide, clone 3H4, Cat. No. MABS2005, is a mouse monoclonal antibody that detects 2A peptide and has been tested in Immunofluorescence, Immunoprecipitation, and Western Blotting.
Western Blotting Analysis: A representative lot detected 2A peptide in HEK293 SpCas9-P2A-Puro and NIH3T3 SpCas9-T2A-Puro cell lysates (Courtesy of Stefan Schuchner, Ph.D. and Egon Ogris, M.D., Medical University of Vienna, Austria).
Immunoprecipitation Analysis: A representative lot detected 2A peptide in HeLa cells expressing SpCas9-P2A or plain HeLa cells, HEK293 cells expressing SpCas9-T2A or plain HEK293 cells (Courtesy of Stefan Schuchner, Ph.D. and Egon Ogris, M.D., Medical University of Vienna, Austria).
Immunofluorescence Analysis: A representative lot detected 2A peptide in HeLa cells transiently transfected with SaCas9-T2A-GFP (Courtesy of Stefan Schuchner, Ph.D. and Egon Ogris, M.D., Medical University of Vienna, Austria).
Quality
Evaluated by Western Blotting in NIH3T3 expressing SpCas9-T2A-Puro cell lysate.
Western Blotting Analysis: 0.5 ug/mL of this antibody detected 2A peptide in 10 µg of NIH3T3 expressing SpCas9-T2A-Puro cell lysate.
Target description
~150 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100, biological source mouse antibody form purified antibody antibody product type primary antibodies clone 3H4, monoclonal species reactivity mouse packaging antibody small pack of 25 μg application(s) immunofluorescence: suitable, immunoprecipitation (IP): suitable, western blot: suitable isotype IgG1κ shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-4EBP2 Antibody, clone 16D9.1
eCl@ss: 32160702
Кат. номер MABS1865-25UG MABS1865-100UG General descriptionEukaryotic translation initiation factor 4E-binding protein 2 (UniProt: Q13542; also known as 4E-BP2, eIF4E-binding protein 2) is encoded by the EIF4EBP2 gene (Gene ID; 1979) in human. 4E-BP2 acts as a repressor of translation initiation involved in synaptic plasticity, learning and memory formation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. 4E-BP2 regulates EIF4E activity by preventing its assembly into the eIF4F complex. 4E-BP2 undergoes phosphorylation at Threonine 37, 46, and 70 and Serine 65 and 83 by mTOR. 4E-BP2 contains a TOR signaling (TOS) motif (aa 116-120) that mediates interaction with RPTOR, leading to promote phosphorylation by mTORC1 complex. Its hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repression of translation. On the other hand, hyperphosphorylated form of 4E-BP2 dissociates from EIF4E, which allows interaction between EIF4G1/EIF4G3 and EIF4E and leads to initiation of translation. 4E-BP2 is first phosphorylated at Threonine 37 and 46 by mTOR that induces folding of region from Proline 18 to Arginine 62 into a four-stranded beta-domain, which sequesters the helical YXXXXLPhi motif into a partly buried beta-strand that blocks accessibility to EIF4E. Protein phosphorylated at Threonine 37 and 46 is, however, unstable. Hence, subsequent phosphorylation at Serine 65 and 83 and Threonine 70 is required to stabilize the fold, which significantly reduces affinity for EIF4E. 4E-BP2 is enriched in brain where it acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation.
Specificity
Clone 16D9.1 specifically detects eIF4E-binding protein 2 in human cells. It targets an epitope within 16 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids from the C-terminal region of human eIF4E-binding protein 2.ApplicationResearch Category
Signaling
Anti-4EBP2, clone 16D9.1, Cat. No. MABS1865, is a mouse monoclonal antobody that detects eIF4E-binding protein 2 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected 4EBP2 in human pancreas and human liver tissue sections.
Quality
Evaluated by Western Blotting in SHSY-5Y cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected 4EBP2 in SHSY-5Y cell lysate.
Target description
~13 kDa observed; 12.94 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 16D9.1, monoclonal species reactivity human species reactivity (predicted by homology) bovine (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_004087, UniProt accession no. Q13542, Gene Information human ... EIF4EBP2(1979)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-60S Ribosomal Protein L26
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1438 ABE1438-25UL General description60S ribosomal protein L26 (UniProt: P61254) is encoded by the RPL26 gene (Gene ID: 6154) in human. 60S ribosomal protein L26 belongs to the ribosomal protein L24P family and is found in all eukaryotes. It is primarily localized in the cytoplasm, but to a lesser extent it is also found in the nucleoplasm and nucleolus. It associates with the large 60S subunit of the ribosome and contains a KOW motif, a conserved RNA-binding motif present in many ribosomal proteins. 60S ribosomal protein L26 is shown to be involved in translation. Knockdown of RPL26 results in a significant decrease in synthesis of 28S rRNA (associated with 60S subunit). Overexpression of RPL26 is shown to enhance the binding of p53 mRNA to the ribosomes and increase p53 translation, which subsequently leads to cell-cycle arrest at G1 phase and can enhance radiation-stimulated apoptosis. Mutations in RPL26 gene are reported to cause congenital non-regenerative hypoplastic anemia that is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy.
Specificity
This polyclonal antibody detects 60S ribosomal protein L26 in human.ImmunogenGST-tagged recombinant fragment corresponding to the first 95 amino acids from human 60S ribosomal protein L26.ApplicationImmunohistochemistry Analysis: A 1:50 dilution from a representative lot detected 60S Ribosomal Protein L26 in human cerebral cortex, human pancreas, and human colon tissues.
Research Category
Epigenetics & Nuclear Function
Anti-60S Ribosomal Protein L26 Antibody, Cat. No. ABE1438, is a highly specific rabbit polyclonal antibody that targets 60S ribosomal protein L26 and has been tested in Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Western Blotting in Hek293 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected 60S Ribosomal Protein L26 in 10 µg of HEK293 cell lysate.
Target description
~17 kDa observed; 17.26 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_000978, UniProt accession no. P61254, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-AATF Antibody, clone 1B2D8 MABC1614-25UG
eCl@ss: 32160702 General descriptionProtein AATF (UniProt: Q9JKX4; also known as Apoptosis-antagonizing transcription factor, Rb-binding protein Che-1, Traube protein) is encoded by the Aatf (also known as Che1, Trb) gene (Gene ID: 56321) in murine species. AATF is a nuclear protein that functions as a general inhibitor of the histone deacetylase HDAC1. It binds to the pocket region of RB1 to displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. AATF is expressed in adrenal gland, Purkinje cells, heart, kidney, liver, lung, muscle, ovary, and testis. It is expressed uniformly throughout the embryo until E10.5. However, from E11.5, the relative expression level increases in the liver, hind brain, spinal cord, dorsal root ganglia, and the posterior commissure. Down-regulation of AATF is involved in colon carcinoma cell proliferation and over-expression of Aatf gene interferes with MAP3K12 induced apoptosis.
Specificity
Clone 1B2D8 is a rat monoclonal antibody that detects AATF in murine and human cells. It targets an epitope within the first 39 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to the first 39 amino acids from murine Apoptosis-antagonizing transcription factor (AATF).ApplicationImmunocytochemistry Analysis: A representative lot detected AATF in Immunocytochemistry applications (Ishigaki, S., et. al. (2010). Cell Death Differ. 17(5):774-86).
Western Blotting Analysis: A representative lot detected AATF in Western Blotting applications (Ishigaki, S., et. al. (2010). Cell Death Differ. 17(5):774-86).
Research Category
Apoptosis & Cancer
Detect AATF using this rat monoclonal Anti-AATF, clone 1B2D8 Antibody, Cat. No. MABC1614-25UG, validated for use in Western Blotting and Immunocytochemistry.
Quality
Evaluated by Western Blotting in HeLa cell lysate. Western Blotting Analysis: 1 µg/mL of this antibody detected AATF in 10 µg of HeLa cell lysate.
Physical form
Format: Purified
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG2a UniProt accession no. Q9JKX4,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ABCA4 Antibody, clone 3F4
eCl@ss: 32160702
Кат. номер MABN2439 MABN2439-25UG General descriptionRetinal-specific ATP-binding cassette transporter (UniProt F1MWM0/P78363; also known as ATP-binding cassette sub-family A member 4, ABC transporter A4, RIM ABC transporter, RIM Protein) is encoded by the ABCA4 gene in bovine species. ABC transporter A4, a ~250 kDa single-chain, is a multi-pass membrane protein of the superfamily of ATP-binding cassette (ABC) transporters that is localized to the disk margins of vertebrate photoreceptor outer segments. It is implicated in the clearance of all-trans retinal derivatives from rod and cone photoreceptor cells following photoexcitation as part of the visual cycle. ABC transporter A4 is composed of two symmetrically organized halves, each comprising six membrane-spanning helices, a large glycosylated exocytoplasmic domain located inside the disk, and a cytoplasmic domain with an ATP-binding cassette. Mutations in ABCA4 are known to cause Stargardt macular degeneration, which is an autosomal recessive form of juvenile macular degeneration associated with a severe loss in vision. (Ref.: Tsybovsky, Y et al. (2010). Adv. Exp. Med. Biol. 703, 105-125).
Specificity
Clone 3F4 detects ABC transporter (ABCA4) in Bovine and Human cells. It targets an epitope within 9 amino acids from the C-terminal end.ImmunogenWhole purified bovine disk rim protein.
Epitope: domain of:ApplicationImmunofluorescence Analysis: A 1:50 dilution from a representative lot detected ABCA4 in mouse retina cells.
Immunofluorescence Analysis: A 1:250 dilution from a representative lot detected ABCA4 in mouse retina cells (Courtesy of Dr. Robert Molday, Ph.D., University of British Columbia, Canada).
Immunoprecipitation Analysis: A representative lot detected ABCA4 in Immunoprecipitation applications (Bungert, S., et. al. (2001). J Biol Chem. 276(26):23539-46).
Western Blotting Analysis: A representative lot detected ABCA4 in Western Blotting applications (Molday, L.L., et. al. (2000). Nat Genet. 25(3):257-8; Illing, M., et. al. (1997). J Biol Chem. 272(15):10303-10; Beharry, S., et. al. (2004). J Biol Chem. 279(52):53972-9).
Immunohistochemistry Analysis: A representative lot detected ABCA4 in Immunohistochemistry applications (Molday, L.L., et. al. (2000). Nat Genet. 25(3):257-8).
Anti-ABCA4, clone 3F4, Cat. No. MABN2439, is a highly specific mouse monoclonal antibody that targets ABCA4 (RIM) and has been tested in Immunohistochemistry, Immunoprecipitation, Immunofluorescence, and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in human retina tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected ABCA4 in 10 µg of human retinal tissue lysate.
Target description
~220 kDa observed; 257.38 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 3F4, monoclonal species reactivity mouse, bovine, human packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 UniProt accession no. F1MWM0,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ABCA4 Antibody, clone 5B4
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABN2440 MABN2440-25UG General descriptionRetinal-specific ATP-binding cassette transporter (UniProt: P78363; also known as ATP-binding cassette sub-family A member 4, ABCA4, RIM ABC transporter, RIM protein, RmP, Stargardt disease protein) is encoded by the ABCA4 (also known as ABCR) gene (Gene ID: 24) in human. ABCA4 is a multi-pass membrane protein that is exclusively expressed in retina and is found in the rims of rod photoreceptor cells. It contains two ABC transporter domains (aa 929-1160 and 1938-2170). In the visual cycle, it act as a retinal extruder or retinal-phosphatidylethanolamine flippase to facilitate the removal of all-trans-retinal from disc membranes following the photobleaching of rhodopsin. Mutations in ABCA4 gene are reported to cause Stargardt disease, which is characterized by decreased central vision, atrophy of the macula and underlying retinal pigment epithelium, and frequent presence of prominent flecks in the posterior pole of the retina. It has also been linked to age-related macular degeneration and retinitis pigmentosa.
Specificity
Clone 5B4 detects Retinal-specific ATP-binding cassette transporter protein in human and bovine. It targets an epitope within 249 amino acids from the N-terminal half.ImmunogenGST-tagged recombinant fragment corresponding to 249 amino acids from the N-terminal half of human Retinal-specific ATP-binding cassette transporter.ApplicationAnti-ABCA4, clone 5B4, Cat. No. MABN2440, is a highly specific mouse monoclonal antibody that targets Retinal-specific ATP-binding cassette transporter and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Neuroscience
Immunocytochemistry Analysis: A representative lot detected ABCA4 in Immunocytochemistry applications (Ahn, J., et. al. (2003). J Biol Chem. 278(41):39600-8).
Western Blotting Analysis: A representative lot detected ABCA4 in Western Blotting applications (Ahn, J., et. al. (2003). J Biol Chem. 278(41):39600-8; Bungert, S., et. al. (2001). J Biol Chem. 276(26):23539-46).
Immunoprecipitation Analysis: A representative lot detected ABCA4 in Immunoprecipitation applications (Ahn, J., et. al. (2003). J Biol Chem. 278(41):39600-8; Bungert, S., et. al. (2001). J Biol Chem. 276(26):23539-46).
Quality
Evaluated by Western Blotting in human retina tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected ABCA4 in 10 µg of human retina tissue lysate.
Target description
250 kDa observed; 255.94 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 5B4, monoclonal species reactivity human, bovine species reactivity (predicted by homology) mouse (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2b NCBI accession no. NP_000341.2, UniProt accession no. P78363, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-ABCG8 Antibody, clone 1B10A5
eCl@ss: 32160702
Кат. номер MABS2054-25UG MABS2054-100UG General descriptionATP-binding cassette sub-family G member 8 (UniProt: Q9DBM0, also known as Sterolin-2, ABCG8) is encoded by the Abcg8 gene (Gene ID: 67470) in murine species. ABCG8 is a multi-pass membrane protein that forms an obligate heterodimer with ABCG5 to mediate Mg2+ and ATP-dependent sterol transport across the cell membrane. It is required for normal sterol homeostasis and plays an essential role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. ABCG8 and ABCG5 are primarily expressed in enterocytes and hepatocytes and their levels are up-regulated upon cholesterol feeding. They are shown to heterodimerize in the endoplasmic reticulum prior to being transported to apical membranes. Their ATPase catalytic domain is located N-terminal to the transmembrane domain. ABCG8 has an ABC transporter domain (aa 48-314) and a ABC transporter type-2 domain (aa 411-665). Two isoforms of ABCG8 have been described that are produced by alternative splicing. Inactivating mutations in either G5 or G8 are reported to cause sitosterolemia, a rare autosomal-recessive disorder characterized by hypercholesterolemia, phytosterolemia, and premature coronary artery disease. (Ref.: Graf, GA., et al. (2003). J. Biol. Chem. 278(48); 48275-48282.
Specificity
Clone 1B10A5 detects ATP-binding cassette sub-family G member 8 (ABCG8). It targets an epitope with in the N-terminal half.ImmunogenRecombinant fragment corresponding to the first 350 amino acids from mouse ATP-binding cassette sub-family G member 8 (ABCG8).ApplicationImmunocytochemistry Analysis: A representative lot detected ABCG8 in Immunocytochemistry applications (Wang, J., et. al. (2008). Biochemistry. 47(18):5194-204).
Immunoprecipitation Analysis: A representative lot detected ABCG8 in Immunoprecipitation applications (Graf, G.A., et. al. (2003). J Biol Chem. 278(48):48275-82).
Western Blotting Analysis: A representative lot detected ABCG8 in Western Blotting applications (Wang, J., et. al. (2008). Biochemistry. 47(18):5194-204; Graf, G.A., et. al. (2003). J Biol Chem. 278(48):48275-82).
Research Category
Signaling
Anti-ABCG8, clone 1B10A5, Cat. No. MABS2054, is a mouse monoclonal antibody that detects ATP-binding cassette sub-family G member 8 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse colon tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected ABCG8 in mouse colon tissue sections.
Target description
75.99 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1B10A5, monoclonal species reactivity mouse, rat, human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_001272934, UniProt accession no. Q9DBM0,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Acetyl CoA Carboxylase 1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS1068 ABS1068-25UL General descriptionAcetyl-CoA carboxylase 1 (UniProt: Q13085; also known as EC: 6.4.1.2, ACC1, ACC-alpha) is encoded by the ACACA (also known as ACAC, ACC1, ACCA) gene (Gene ID: 31) in human. ACC1 is a cytoplasmic protein that is expressed in brain, placental, skeletal muscle, renal, pancreatic and adipose tissues. It is also expressed at low level in pulmonary tissue, but is not detected in the liver. ACC1 can be present as a monomer, homodimer, or homotetramer. It can also form filamentous polymers. Four isoforms of ACC1 have been described that are produced by alternative splicing. It catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids and carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase. The activity of ACC can be controlled at the transcriptional level as well as by small molecule modulators and covalent modification. ACC1 levels are regulated under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Mutations in ACACA gene can result in ACC1 deficiency and lead to error of de novo fatty acid synthesis associated with severe brain damage, persistent myopathy and poor growth.
Specificity
This rabbit polyclonal antibody detects Acetyl-CoA carboxylase 1 in human cells. It targets an epitope within 245 amino acids from the C-terminal region.ImmunogenGST-tagged recombinant fragment corresponding to 245 amino acids from the C-terminal half of human Acetyl-CoA carboxylase 1.
Epitope: C-terminusApplicationResearch Category
Signaling
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Acetyl CoA Carboxylase 1 in human liver and human kidney tissue sections.
Anti-Acetyl CoA Carboxylase 1, Cat. No. ABS1068, is a rabbit polyclonal antibody that detects Acetyl CoA Carboxylase 1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected Acetyl CoA Carboxylase 1 in A431 cell lysate.
Target description
~220 kDa observed; 265.55 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_942133.1, UniProt accession no. Q13085, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Acetyl CoA Carboxylase 1 Antibody, clone 10H2.1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2024-25UG MABS2024-100UG General descriptionAcetyl-CoA carboxylase 1 (UniProt: Q13085; also known as ACC1, ACC-alpha) is encoded by the ACACA (also known as ACAC, ACC1, ACCA) gene (Gene ID: 31) in human. It catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. ACC1 is a multi-subunit, biotin-dependent enzyme that catalyzes carboxylation of acetyl-CoA to produce malonyl-CoA through its two catalytic activities, biotin carboxylase (BC) and carboxyltransferase (CT). The activity of ACC can be controlled at the transcriptional level as well as by small molecule modulators and covalent modification. Two isoforms fof ACC have been reported, alpha and beta that are encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. ACC1 levels are regulated under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. ACC1 activity is inhibited upon phosphorylation, which occurs when glucagon or epinephrine binds to the receptors or when the energy status of the cell is low, leading to the activation of the AMP-activated protein kinase. The presence of fatty acids inhibits the activities of ACC1. ACC is considered as an important target in the design of new anti-obesity drugs.
Specificity
Clone 10H2.1 detects human Acetyl-CoA carboxylase 1. It targets an epitope within 245 amino acids from the C-terminal end.ImmunogenGST-tagged recombinant fragment corresponding to 245 amino acids from the C-terminal region of human Acetyl-CoA carboxylase 1.ApplicationAnti-Acetyl CoA Carboxylase 1, clone 10H2.1, Cat. No. MABS2024, is a mouse monoclonal antibody that detects Acetyl-CoA carboxylase 1 and has been tested for use in Western Blotting and Immunohistochemistry (Paraffin).
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Acetyl CoA Carboxylase 1 in A431 cell lysate.
Target description
~265 kDa observed; 265.55 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 10H2.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_942133, UniProt accession no. Q13085, Узнать цену -
Anti-Acetyl CoA Carboxylase 1 Antibody, clone 7H4.2
eCl@ss: 32160702
Кат. номер MABS830 MABS830-25UG General descriptionAcetyl-CoA carboxylase 1 (UniProt: Q13085; also known as ACC1, ACC-alpha) is encoded by the ACACA (also known as ACAC, ACC1, ACCA) gene (Gene ID: 31) in human. It catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. ACC1 is a multi-subunit, biotin-dependent enzyme that catalyzes carboxylation of acetyl-CoA to produce malonyl-CoA through its two catalytic activities, biotin carboxylase (BC) and carboxyltransferase (CT). The activity of ACC can be controlled at the transcriptional level as well as by small molecule modulators and covalent modification. Two isoforms fof ACC have been reported, alpha and beta that are encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. ACC1 levels are regulated under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. ACC1 activity is inhibited upon phosphorylation, which occurs when glucagon or epinephrine binds to the receptors or when the energy status of the cell is low, leading to the activation of the AMP-activated protein kinase. The presence of fatty acids inhibits the activities of ACC1. ACC is considered as an important target in the design of new anti-obesity drugs.
Specificity
Clone 7H4.2 detects acetyl-CoA carboxylase 1 in human. It targets an epitope within 86 amino acids from the C-terminal end.ImmunogenGST/His-tagged recombinant fragment corresponding to 86 amino acids from the C-terminal end of human Acetyl-CoA carboxylase 1.ApplicationImmunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Acetyl CoA Carboxylase 1 in human tonsil, human testis, and human cervical cancer tissue.
Western Blotting Analysis: 0.5 µg/mL from a representative lot detected Acetyl CoA Carboxylase 1 in 10 µg of NIH/3T3 cell lyate.
Anti-Acetyl CoA Carboxylase 1 Antibody, clone 7H4.2, Cat. No. MABS830, is a mouse monoclonal antibody that targets Acetyl CoA Carboxylase 1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Acetyl CoA Carboxylase 1 in 10 µg of A431 cell lysate.
Target description
~265 kDa observed; 265.55 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 7H4.2, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2b NCBI accession no. NP_942133, UniProt accession no. Q13085, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Acetyl MLL1 (KMT2A) (Lys 1130/1133)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE344-25UG ABE344-100UG General descriptionHistone-lysine N-methyltransferase 2A (UniProt: Q03164; also known as EC: 2.1.1.43, Lysine N-methyltransferase 2A, ALL-1, CXXC-type zinc finger protein 7, Myeloid/lymphoid or mixed-lineage leukemia, Myeloid/lymphoid or mixed-lineage leukemia protein 1, MLL1, Trithorax-like protein, Zinc finger protein HRX) is encoded by the KMT2A (also known as ALL1, CXXC7, HRX, HTRX, MLL, MLL1, TRX1) gene (Gene ID: 4297) in human. It is expressed in heart, lung, and brain and in T- and B-lymphocytes and plays an essential role in early development and hematopoiesis. Proteolytic cleavage of MLL1 by Taspase 1 (TASP1) generates an N-terminal cleavage product of 320 kDa and a C-terminal product of 180 kDa. The catalytic subunit of the MLL1/MLL complex, a multiprotein complex that mediates both methylation of Lysine 4 of histone H3 (H3K4me) complex and acetylation of Lysine 16 of histone H4 (H4K16ac). In the MLL1/MLL complex, it specifically mediates H3K4me, a specific tag for epigenetic transcriptional activation. MLL1 displays weak methyltransferase activity by itself, and requires other component of the MLL1/MLL complex to obtain full methyltransferase activity. It does not exhibit any activity toward histone H3 phosphorylated on Threonine 3, and less activity toward H3 dimethylated on Arginine 8 or Lysine 9. However, it has higher activity toward H3 acetylated on Lysine 9. MLL1 is shown to be required for transcriptional activation of HOXA9 and it promotes PPP1R15A-induced apoptosis. MLL1 is reported to coordinate recruitment of CLOCK BMAL1 activator complexes to chromatin, an event associated with cyclic trimethylation of histone H3 Lysine 4 (H3K4) at circadian promoters. MLL1 is also reported to play a critical role in the control of circadian gene expression and is essential for the transcriptional activation mediated by the CLOCK-ARNTL/BMAL1 heterodimer. (Ref.: Aguilar-Arnal, L., et al. (2015). Nat. Struct. Mol. Biol. 22(4); 312-318).
Specificity
This rabbit polyclonal antibody specifically detects human Histone-lysine N-methyltransferase 2A acetylated on lysine 1130 and 1133.ImmunogenKLH-cpnugated linear peptide corresponding to 12 amino acids surrounding acetylated lysines 1130 and 1133 from the N-terminal half of human Histone-lysine N-methyltransferase 2A.
Epitope: unknownApplicationWestern Blotting Analysis: A representative lot detected Acetyl MLL1 (KMT2A) (Lys 1130/1133) in Western Blotting applications (Aquilar-Arnal, L., et. al. (2015). Nat Struct Mol Biol. 22(4):312-8).
Peptide Inhibition Analysis: A representative lot was used with Acetylated peptide (Ag peptide) and Control peptide for peptide block analysis. (Courtesy of Dr. Lorena Aguilar-Arnal)
Anti-Acetyl MLL1 (KMT2A) (Lys 1130/1133), Cat. No. ABE344, is a highly specific rabbit polyclonal antibody that targets Histone-lysine N-methyltransferase 2A (MLL1) acetylated on Lysine 1130/1133 and has been tested for use in Dot Blot, Peptide Inhibition Assay, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Dot Blot with Acetylated peptide (Ag peptide) and Control peptide.
Dot Blot Analysis: 1 µg/mL of this antibody detected Acetyl MLL1 (KMT2A) peptide acetylated on Lysine 1130/1133, but did not dectect the control peptide.
Target description
431.76 kDa calculated.
Physical form
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.09% sodium azide.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) dot blot: suitable","inhibition assay: suitable (peptide)","western blot: suitable isotype IgG NCBI accession no. NP_005924, UniProt accession no. Q03164, Узнать цену -
Anti-acetyl-Histone H3 (Ac-Lys9) antibody, Mouse monoclonal
MDL number: MFCD02685921 NACRES: NA.41
Кат. номер H0913-25UL H0913-200UL General descriptionMonoclonal Anti-Acetyl-Histone H3 (Ac-Lys9) recognizes human histone H3 when acetylated on Lys9. Staining of the histone H3-Ac-Lys9 band in immunoblotting is specifically inhibited with the acetylated histone H3 immunizing peptide but not with the nonacetylated one.Immunogensynthetic, acetylated histone H3 peptide (amino acids 7-20, Ac-Lys9) corresponding to the N-terminus of human histone H3. The sequence is identical in many species including mouse, rat, bovine, chicken, frog, Drosophila, and C. elegans, and is highly conserved (single amino acid substitution) in Tetrahymena histone H3.ApplicationMonoclonal Anti-acetyl-Histone H3 (Ac-Lys9) antibody may be used in various applications including ELISA, immunoblotting (approx. 17 kDa), and immunocytochemistry.
Packaging
200 μL in glass bottle
Biochem/physiol Actions
Acetyl-Histone H3 hav Acetylation of lysine residues within these N-terminal domains of histones by histone acetyl-transferase (HATs), including Gcn5p, PCAF, p300/CBP and TAFII250 is associated with transcriptional activation. This modification results in remodeling of the nucleosome structure into an open conformation more accessible to transcription complexes. Conversely, histone deacetylation by histone deacetylase (HDACs) is associated with transcription repression reversing the chromatin remodeling process. In most species, histone H3 is primarily acetylated at lysine 9, 14, 18, and 23. Acetylation at lysine 9 appears to have a dominant role in histone deposition and chromatin assembly in some organisms. Acetylation of specific lysines in histone H3 is also associated with processes apart from transcription. During DNA replication, new histones are rapidly synthesized and assembled into replicated DNA. Histones H3 and H4 are brought to replicating chromatin in a pre-acetylated state that turns into a de-acetylated state after replication is completed and the newly assembled chromatin matures.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone AH3-120, monoclonal form buffered aqueous solution mol wt antigen ~17 kDa species reactivity rat, Drosophila, chicken, bovine, mouse, Caenorhabditis elegans, human, frog packaging antibody small pack of 25 µL concentration ~2 mg/mL application(s) immunocytochemistry: suitable","indirect ELISA: suitable","microarray: suitable","western blot: 1-2 µg/mL using whole cell extract of mouse fibroblasts 3T3 cell line treated with sodium butyrate isotype IgG1 conjugate unconjugated UniProt accession no. P68431, shipped in dry ice storage temp. 20°C Gene Information human ... H3F3A(3020), H3F3B(3021), HIST1H3A(8350), HIST1H3B(8358), HIST1H3C(8352), HIST1H3D(8351), HIST1H3E(8353), HIST1H3F(8968), HIST1H3G(8355), HIST1H3H(8357), HIST1H3I(8354), HIST1H3J(8356), HIST2H3A(333932), HIST2H3C(126961), HIST3H3(8290)
mouse ... H3f3a(15078), H3f3b(15081), Hist1h3a(360198), Hist1h3b(319150), Hist1h3c(319148), Hist1h3d(319149), Hist1h3e(319151), Hist1h3f(260423), Hist1h3g(97908), Hist1h3h(319152), Hist1h3i(319153), Hist2h3b(319154), Hist2h3c1(15077), Hist2h3c2(97114)
rat ... H3f3b(117056)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Узнать цену -
Anti-acetyl-p53 Antibody (Lys373, Lys382)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 6-758-25UL 6-758 6-758-100UL General descriptionp53 is a DNA-binding, oligomerization domain and transcription activation domain-containing tumor suppressor that upregulates growth arrest and apoptosis-related genes in response to stress signals, thereby influencing programmed cell death, cell differentiation and cell cycle control mechanisms. p53 localizes to the nucleus yet can be chaperoned to the cytoplasm by the negative regulator MDM2, an E3 ubiquitin ligase that is upregulated in the presence of active p53, where MDM2 polyubiquitinates p53 for proteasome targeting. p53 can assemble into tetramers in the absence of DNA, fluctuates between latent and active (DNA-binding) conformations, and is differentially activated through posttranslational modifications including phosphorylation and acetylation. Mutations in the DNA-binding domain (DBD) (amino acids 110-286) of p53 can compromise energetically favorable association with cis elements and are implicated in several human cancers.
Specificity
Recognizes p53 acetylated in vitro by recombinant p300, and for peptide containing acetyl-lysine 373 but not for the peptide containing acetyl-lysine 320.Immunogenpeptide of human p53 corresponding to amino acids 368-389 with a duplication of amino acids 376 and 377 (HLKSKACKGQSTSTSRHKACKLMFKTC) where ACK denotes acetyl-lysineApplicationResearch Sub Category
Transcription Factors
Research Category
Epigenetics & Nuclear Function
Western Blot (on recombinant protein only)
Detect acetyl-p53 (Lys373) with Anti-acetyl-p53 Antibody (Lys373, Lys382) (Rabbit Polyclonal Antibody), that has been shown to work in WB.
Quality
routinely evaluated by an in vitro acetyl transferase assay on recombinant p300, HAT domain (Catalog #14-418)
Target description
53 kDaLinkageReplaces: 04-1137
Physical form
Rabbit polyclonal antiserum containing 0.05% sodium azide. Frozen solution.
Storage and Stability
Maintain for 2 years at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Breast Cancer, Colon, Skin tissueOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity vertebrates packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) western blot: suitable isotype IgG NCBI accession no. NM_000546, UniProt accession no. P04637, shipped in dry ice Узнать цену -
Anti-Acetylcholinesterase (AChE) antibody produced in rabbit
Кат. номер SAB4200839-25UL SAB4200839-100UL General descriptionAcetylcholinesterase (AChE) is a member of the a/-hydrolase-fold proteins superfamily which is composed of structurally related proteins with a great diversity in their catalytic, recognition, adhesion and chaperone functions. 3D structure studies of a/-hydrolase reviled a variety of folding patterns suggesting associations through oligomerization dependent functions.1 AChE is a tissue specific serine hydrolase expressed in several variants at neuromuscular junctions (NMJs)2, cholinergic brain synapses2-3 or erythrocyte (Red Blood Cells- RBC)4.
Specificity
Anti-Acetylcholinesterase (AChE) antibody specifically recognizes human AChE.Immunogenhuman Acetylcholinesterase, recombinant, expressed in HEK 293 cellsApplicationThe antibody may be used in various immunochemical techniques including Immunoblotting Immunofluorescence and ELISA. Detection of the AChE band by Immunoblotting is specifically inhibited by the immunogen.
Biochem/physiol Actions
In the synaptic cleft, AChE main function is to ensure rapid hydrolysis of acetylcholine (ACh) released from motor nerve ending into choline and acetic acid thus preventing postsynaptic muscle ACh receptors (AChR) hyperactivation and termination of the signal transmission.2-3,5AChE and Butyrylcholinesterase (BChE) inhibitory drugs or peptides are being used in several neurodegenerative diseases including Alzheimers disease and pathological muscle weakness such as Myasthenia Gravis. These AChE inhibitors increase synaptic ACh levels and hence improve the cholinergic function in the brain.2-3,5-6 Erythrocytes AChE (AChE-H) is a membrane encored AChE splicing variant found in RBC, it belongs to the glycosylphosphatidylinositol (GPI) protein family and carries the Yta blood group antigen. Erythrocytes AChE can be found in plasma circulating vesicles originated from aged erythrocytes, and therefore is considered as a biomarker for RBC membrane integrity. Furthermore, Erythrocytes AChE activity is also a marker for inflammation and other diseases including essential hypertension, glaucoma, ALS, neurotoxicity, and Hirschsprungs disease.4,7-8
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution species reactivity human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 1:1000-1:2000 using whole extracts of Jurkat cells.","immunofluorescence: 1:1000-1:20000 using Human A431 UniProt accession no. P22303, shipped in dry ice storage temp. 20°C Gene Information human ... ACHE(43)
Safety InformationFlash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ACOX3 antibody produced in rabbit
Human Protein Atlas Number: HPA035840 Human Protein Atlas characterization data
Кат. номер HPA035840-100UL HPA035840-25UL Immunogenacyl-CoA oxidase 3, pristanoyl recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79699,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL immunogen sequence YRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL conjugate unconjugated UniProt accession no. O15254, shipped in wet ice storage temp. 20°C Gene Information human ... ACOX3(8310)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Actin (-Sarcomeric) antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200689-100UL SAB4200689-25UL General descriptionMonoclonal Anti-Actin (-Sarcomeric) (mouse IgM isotype) is derived from the hybridoma 5C5 produced by the fusion of mouse myeloma cells and splenocytes from mice immunized with purified rabbit striated muscle. Actin is the major cytoskeletal protein in eukaryotic cells.Immunogenpurified rabbit striated muscleApplicationAnti-Actin (-Sarcomeric) antibody, Mouse monoclonal has been used in:- indirect immunofluorescence staining
- immunohistochemistry
- enzyme-linked immunosorbent assay (ELISA)
- immunoblotting
- immunofluorescence
Biochem/physiol Actions
Actin plays essential roles in a number of cellular processes including cell migration, cytokinesis, vesicle transport and contractile force generation.
Physical form
The product is supplied as a culture supernatant solution containing 15 mM sodium azide as a preservative. The product contains bovine serum albumin and a human-derived protein.Legal InformationExtrAvidin is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5C5, monoclonal form buffered aqueous solution mol wt antigen ~42 kDa species reactivity planaria(flatworm), rat, guinea pig, mouse, rabbit, chicken, bovine, Xenopus, human, fish packaging antibody small pack of 25 µL application(s) ELISA: suitable, immunoblotting: 1:500-1:1000 using rat heart tissue extracts, immunofluorescence: 1:500-1000 using human HeLa cells., immunohistochemistry: 1:500 using formalin-fixed, paraffin-embedded human tongue sections and Biotin/ExtrAvidin®-Peroxidase staining system. isotype IgM shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Actin (20-33) antibody produced in rabbit
MDL number: MFCD01092261 NACRES: NA.46
Кат. номер A5060-200UL A5060-.5ML A5060-25UL General descriptionA mature actin filament consists of a right-handed double helix made of two F-actin protofilaments.
The antibody shows a broad reactivity among actin isoforms and across a range of organisms. It specifically stains typical stress fibers in cultured cells using an indirect immunofluorescent labeling technique and can be used as a probe of the N-terminal region of actin.
Actin is a highly conserved protein that is a major component of both the cytoskeletal and contractile structures in all cell types. It varies in amount, being related to the type of differentiation and to the functional state of cells and tissues. Actin can be found in two different forms of aggregation, the globular or the fibrillar state, and at least six distinct isoforms occur in vertebrates. The actins exhibit over 90% sequence homology, but each isoform has a unique NH2-terminal sequence. The isoforms are comprised of three α actins (skeletal, cardiac, smooth), one β actin (β-non-muscle) and two γ actins (γ smooth muscle and γ non-muscle).
Specificity
Anti-Actin recognizes an epitope located on the N-terminal region of actin. The antibody specifically labels actin in a wide variety of tissues and species using immunoblotting (band at 42kDa). It specifically stains typical stress fibers in cultured cells using indirect immunofluorescent staining and immunohistochemistry.ImmunogenN-terminal actin peptide attached to a multiple antigen peptide (MAP) backbone.ApplicationRabbit Anti-Actin (20-33) antibody has been used for immunoblotting assays. The product can also be used for immunohistochemistry, indirect immunofluorescence and microarray analyses.
Homogenates from limb tissue of E13.5 mouse embryos were analyzed by western blot using rabbit anti-actin as a primary antibody at a dilution of 1:8000.
Biochem/physiol Actions
Actin maintains the cell shape and participates in cytokinesis. Actin provides cellular strength and promotes active movement of the cell. Actin protein is essential for the formation of mature platelets. Upregulation of ACTA1 (actin, α 1) gene is observed in orthotopic liver transplantation without any earlier evidence of autoimmune liver disease.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide as preservative.
Storage and Stability
For continuous use, store at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing, or storage in "frost-free" freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use.Other NotesDisclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 42 kDa species reactivity invertebrates, wide range (animal) packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using chicken or rat tissue sections, indirect immunofluorescence: 1:200 using cultured human fibroblasts, microarray: suitable, western blot: 1:250 using using rat brain or chicken muscle extracts conjugate unconjugated shipped in dry ice storage temp. 20°C Gene Information human ... ACTA1(58)
mouse ... Acta1(11459)
rat ... Acta1(29437)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Узнать цену -
Anti-Actin antibody , Mouse monoclonal
NACRES: NA.41
Кат. номер A3853-200UL A3853-100UL A3853-25UL General descriptionActin is a highly conserved protein that is a major component of both the cytoskeletal and contractile structures in all cell types. It varies in amount, being related to the type of differentiation and to the functional state of cells and tissues. Actin can be found in two different forms of aggregation, the globular or the fibrillar state, and at least six distinct isoforms occur in vertebrates. The actins exhibit over 90% sequence homology, but each isoform has a unique NH2-terminal sequence. The isoforms are comprised of three actins (skeletal, cardiac, smooth), one actin (-non-muscle) and two actins ( smooth muscle and non-muscle). The human -actin gene is mapped to human chromosome 17.
The antibody recognizes an epitope located on the C-terminal end of actin conserved in all actin isoforms. It specifically labels actin in a wide variety of tissues and species. The epitope recognized by the antibody is resistant to formalin-fixation and paraffin-embedding. Zinc-formalin, B5, ethanol, methacarn, Brunnels or Bouins solutions may also be used as fixatives.
Monoclonal Anti-Actin (mouse IgG2a isotype) is derived from the AC-40 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. A synthetic actin C-terminal peptide, attached to Multiple Antigen Peptide (MAP) backbone was used as the immunogen. The isotype is determined using Mouse Monoclonal Antibody Isotyping Reagents, Catalog No. ISO2
The antibody recognizes an epitope located on the C-terminal end of actin conserved in all actin isoforms. It specifically labels actin in a wide variety of tissues and species. The epitope recognized by the antibody is resistant to formalin-fixation and paraffin-embedding. Zinc-formalin, B5, ethanol, methacarn, Brunnel′s or Bouin′s solutions may also be used as fixatives.
Specificity
Cross-reaction of monoclonal Anti-Actin antibody has been observed with human, bovine, sheep, goat, pig, rabbit, dog, mouse, rat, guinea pig, hamster, chicken, carp, viper, frog and snail. The antibody may be used in staining of methanol-fixed, frozen sections.Immunogensynthetic actin C-terminal peptide, attached to a Multiple Antigen Peptide (MAP) backbone.ApplicationMonoclonal anti-actin antibody was used for western blot analysis of Cos-7 cell lysates to ensure equal protein loading.
Western blot analysis of MDCK cell lysates were performed using monoclonal anti-actin antibody as a primary antibody.
Mouse monoclonal anti-actin antibody can be used for western blot assays. Furthermore, the product can also be used for immunocytochemistry (10-20µg/mL, using chicken or human fibroblasts by methanol/acetone fixation), microarray, immunohistochemistry and indirect ELISA.
Monoclonal Anti-Actin antibody produced in mouse has been used in the detection of actin in human bronchial epithelial cells using immunohistochemical assays. It has also been used in immunofluorescence detection in cardiomyocytes.
Packaging
200 μL in glass insert
Biochem/physiol Actions
Actin and myosin are constituents of many cell types and are involved in cellular process including locomotion, secretion, cytoplasmic streaming, phagocytosis, and cytokinesis. The N-terminal region of actin appears to be a major antigenic region, and may be involved in the interaction of actin with other proteins such as myosin. Among the six isoforms of actin, four of them represent the differentiation markers of muscle tissues and two are found practically in all cells. There are three -actins (skeletal, cardiac, and smooth muscle), one -actin (-nonmuscle), and two -actins (-smooth muscle and -nonmuscle). Actin isoforms show >90% overall sequence homology, but only 50–60% homology in their NH2-terminal residues.
The actin in cells of various species and tissues are very similar in their immunological and physical properties characterized by electrophoresis and amino acid sequence analysis. They mediate cytoskeletal remodeling during T cell activation. Mutation in the -actin and -actin gene is associated with a developmental disorder called Baraitser-Winter syndrome. Mutation in the -actin leads to hearing loss.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. Storage in “frost-free” freezers is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.Other NotesDisclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone AC-40, monoclonal form buffered aqueous solution packaging antibody small pack of 25 μL application(s) immunocytochemistry: 10-20 μg/mL using chicken or human fibroblasts by methanol/acetone fixation, immunohistochemistry: suitable, indirect ELISA: suitable, microarray: suitable, western blot: 0.5 μg/mL using chicken or human fibroblasts conjugate unconjugated shipped in dry ice storage temp. −20°C
Safety InformationPersonal Protective Equipment Eyeshields, Gloves, multi-purpose combination respirator cartridge (US) RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Actin, -Smooth Muscle antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер A5228-25UL A5228-200UL A5228-100UL General descriptionThe antibody (also known as anti-α-Sm-1) is specific for the single isoform of α-smooth muscle actin. It reacts specifically with α-smooth muscle actin in immunoblotting assays and labels smooth muscle cells in frozen or formalin-fixed, paraffin-embedded tissue sections.
Actin is a highly conserved protein that is a major component of both the cytoskeletal and contractile structures in all cell types. It varies in amount, being related to the type of differentiation and to the functional state of cells and tissues. Actin can be found in two different forms of aggregation, the globular or the fibrillar state, and at least six distinct isoforms occur in vertebrates. The actins exhibit over 90% sequence homology, but each isoform has a unique NH2-terminal sequence. The isoforms are comprised of three alpha actins (skeletal, cardiac, smooth), one beta actin (beta-non-muscle) and two gamma actins (gamma smooth muscle and gamma non-muscle).
Anti-Actin, α-Smooth Muscle antibody, Mouse monoclonal (mouse IgG2a isotype) is derived from the 1A4 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from mice immunized with the NH2 terminal synthetic decapeptide of a smooth muscle actin, coupled to keyhole limpet hemocyanin (KLH).ImmunogenN-terminal synthetic decapeptide of α-smooth muscle actin.ApplicationAnti-Actin, α-Smooth Muscle antibody, Mouse monoclonal has been used in immunofluorescence staining, immunohistochemistry, immunoblotting, immunocytochemistry and enzyme linked immunosorbent assay (ELISA).
Paraffin embedded sections of rat testis tissue grafts were immunohistochemically stained with mouse monoclonal anti-smooth muscle actin.
IHC analysis of x-gal stained muouse cardiac tissue was performed using the primary antibody, mouse monoclonal anti-smooth muscle actin to identify myofibroblasts.
Immunocytochemistry was performed on smooth muscle cells from bovine aortas using the monoclonal anti-ACTA2 antibody. Cells were first grown on glass cover slips and fixed in 50% acetone/EtOH for 10 minutes at 4 degrees.
Packaging
200 μL in glass bottle
Biochem/physiol Actions
Actin and myosin are constituents of many cells types and are involved in a myriad of cellular processes including locomotion, cytokinesis, secretion, cytoplasmic streaming and phagocytosis. It has been shown that the relative proportion of actin isoforms are different in smooth muscles of different organs and change within the same population of smooth muscle cells during development, pathological situations and different culture conditions. The actin in cells of various species and tissue origin are very similar in their immunological and physical properties.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.Other NotesDisclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1A4, monoclonal form PBS solution mol wt antigen ~42 kDa species reactivity human, frog, sheep, chicken, goat, bovine, rat, guinea pig, mouse, canine, rabbit, snake packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable using smooth muscle cells","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using smooth muscle cells","indirect ELISA: suitable","indirect immunofluorescence: 5-10 µg/mL using blood vessels in formalin-fixed, paraffin-embedded human tonsil or appendix tissue sections","microarray: suitable","western blot: suitable using smooth muscle cells isotype IgG2a conjugate unconjugated Featured Industry Research Pathology UniProt accession no. P62736, shipped in dry ice storage temp. 20°C Gene Information human ... ACTA2(59)
mouse ... Acta2(11475)
rat ... Acta2(81633)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Actin, N-terminal antibody produced in rabbit
MDL number: MFCD00145889 NACRES: NA.41
Кат. номер A2103-200UL A2103-25UL General descriptionActin is a cytoskeletal protein that regulates cell motility, secretion, phagocytosis and cytokinesis. The NH2-terminal of actin may function as an antigen. This terminal may also modulate actin interactions and may associate with proteins such as myosin.
Actin is one of the most conserved eukaryotic proteins, which is expressed in mammals and birds as at least six major different isoforms. Four of them represent the differentiation markers of muscle tissues and two are found practically in all non-muscle cells. Actin isoforms show >90% overall sequence homology, but only 50-60% homology in their 18 N-terminal residues. Actin is present in cells both as a globular monomer (G-actin) and as a polymer in filamentous actin (F-actin) that participates in the formation of a variety of stable and labile structures. The presence of actin in cell nuclei and cell membranes has been reported.Immunogensynthetic actin N-terminal nonapeptide conjugated to KLH.ApplicationProtein lysates generated from embryonic mouse limb tissue was analyzed by western blot using actin as the loading control. Actin was detected using rabbit anti-actin at 1:8000. Actin detected by a rabbit anti-actin antibody was used as a loading control for MCF7 cell lysates . Actin was detected at 42 kDa.
Anti-Actin, N-terminal antibody produced in rabbit has been used in- immunoblotting
- quantitative chromatin immunoprecipitation (qChIP)
Rabbit anti-actin, N-terminal antibody can be used for western blotting assays. The antibody can also be used for immunocytochemistry at 1-2μg/mL using cultured chicken fibroblasts. Furthermore, the antibody is suitable for use in immunohistochemistry at a concentration of 2-4μg/mL using sections of human appendix, mouse heart, and frog skeletal muscle.
Biochem/physiol Actions
Actin and myosin are constituents of many cell types and are involved in a myriad of cellular processes including maintenance of cell shape, locomotion, secretion, cytoplasmic streaming, phagocytosis, and cytokinesis. The N-terminal domain of actin appears to be a major antigenic region of the molecule. Different isoforms can coexist in the same cell but are differentially regulated, and in most cases cannot substitute for each other functionally.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% BSA and 15 mM sodium azide.Other NotesDisclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 42 kDa species reactivity mouse, frog, rat, human, chicken packaging antibody small pack of 25 µL concentration ~0.5 mg/mL application(s) immunocytochemistry: 1-2 µg/mL using cultured chicken fibroblasts","immunohistochemistry (formalin-fixed, paraffin-embedded sections): 2-4 µg/mL using sections of human appendix, mouse heart, and frog skeletal muscle","indirect immunofluorescence: suitable","western blot: 0.5-1 µg/mL using whole extract of the human epitheloid carcinoma HeLa cell line.","western blot: 2-4 ng/mL using whole extract of rat skeletal muscle conjugate unconjugated UniProt accession no. P63261, shipped in wet ice storage temp. 20°C Gene Information human ... ACTA1(58), ACTA2(59), ACTB(60), ACTC1(70), ACTG1(71), ACTG2(72)
mouse ... Acta1(11459), Acta2(11475), Actb(11461), Actc1(11464), Actg1(11465), Actg2(11468)
rat ... Acta1(29437), Acta2(81633), Actb(81822), Actc1(29275), Actg1(287876), Actg2(25365)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 2 Узнать цену -
Anti-Active--Catenin (Anti-ABC) Antibody, clone 8E7
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-665 5-665-25UG General descriptionCatenins are proteins found in complexes with cadherin cell adhesion molecules of animal cells. The first two catenins that were identified became known as -catenin and -catenin. -catenin can bind to -catenin and can also bind actin. -catenin binds the cytoplasmic domain of some cadherins.
When -catenin was sequenced it was found to be a member of the armadillo family of proteins. These proteins have multiple copies of the so-called armadillo repeat domain which is specialized for protein-protein binding. An increase in -catenin production has been noted in those people who have Basal Cell Carcinoma and leads to the increase in proliferation of related tumors. When -catenin is not associated with cadherins and -catenin, it can interact with other proteins such as Catenin Beta Interacting Protein 1 (ICAT) and adenomatosis polyposis coli (APC).
Recent evidence suggests that -catenin plays an important role in various aspects of liver biology including liver development (both embryonic and postnatal), liver regeneration following partial hepatectomy. HGF-induced hepatpomegaly, liver zonation, and pathogenesis of liver cancer.
Specificity
Recognizes active form of β-catenin, dephosphorylated on Ser37 or Thr41.
The antibody eptiope is 100% conserved in zebrafish.ImmunogenEpitope: The epitope corresponds to amino acid residues 36-44 (HSGATTTAP) of human β-catenin.
Fusion protein corresponding to residues 1-100 of human β-catenin with a c-terminal histidine tagApplicationResearch Sub Category
Transcription Factors
Anti-Active-β-Catenin (anti-ABC) Antibody, clone 8E7 is a well characterized Mouse Monoclonal Antibody. This highly published mAb also known as Anti-Catenin beta-1 readily detects beta-Catenin & has been validated in FC, ICC, IHC, IHC(P) & WB.
Immunocytochemistry: This antibody was used in immunocytochemistry and showed positive staining on the membrane and cytosol.
This antibody has also been reported by an independent laboratory to show positive immunostaining for beta-catenin in LiCl-treated 293T cells fixed with methanol (Staal, Frank J. T., 2002).
Flow Cytometry: This antibody was used in flow cytometry at an optimal 1 µg/mL concentration.
Immunohistochemistry: This antibody was used in immunohistochemistry on a colorectal carcinoma tissue array at a 1:300 dilution.
This antibody has also been reported by an independent laboratory to detect beta-catenin in mouse embryo sections (Van Noort, M., 2002).
Research Category
Epigenetics & Nuclear Function
Quality
Routinely evaluated by immunoblot on RIPA lysates from A431 cells.
Western Blot Analysis: 0.2-2 µg/mL of this antibody detected -catenin in RIPA lysates from A431 cells.
Target description
92 kDa
Physical form
Protein G Purified
Format: Purified
Purified mouse monoclonal IgG1k in buffer containing 0.1 M Tris-Glycine, pH 7.4, 15 mM NaCl and 0.05% sodium azide
Storage and Stability
Maintain for 1 year at 2-8°C from date of shipment.
Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution.
Analysis Note
Control
Positive Control Included: Non-Stim A431 Cell Lysate (12-301). Other controls: HeLa whole cell lysate or MCF7 whole cell lysateLegal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 8E7, monoclonal species reactivity mouse, rat, human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001895, UniProt accession no. P35222, shipped in ambient Узнать цену -
Anti-AcV5 antibody, Mouse monoclonal
MDL number: MFCD08705571 NACRES: NA.41
Кат. номер A2980-100UL A2980-200UL A2980-25UL General descriptionAnti-AcV5 antibody, Mouse monoclonal, (mouse IgG2b isotype) is derived from the hybridoma ACV5 produced by the fusion of mouse myeloma cells and splenocytes from C57Bl/6 X Balb/c mice immunized with AcNPV extracellular nonoccluded virus (NOV). GP64 (AcV5) is an envelope glycoprotein found in the baculovirus Autographa californica multiple nucleopolyhedrovirus. GP64 gene open reading frame encodes a protein of 509 amino acids with a molecular weight of 58 kDa. The protein contains N-linked glycosylation sites and hydrophobic N- and C-termini, characteristic of signal and membrane anchor motifs found in envelope glycoproteins. The GP64 protein is present early (6 hr) post infection and accumulates in the infected cell moving to the periphery later.
gp64 (AcV5) is an envelope glycoprotein found in the baculovirus Autographa californica multiple nucleopolyhedrovirus. It is involved in involved in viral entry into cells by receptor-mediated endocytosis. Elevated expression of gp64 has been shown to enhance gene transfer in a variety of cell types.ImmunogenAcNPV extracellular nonocculeded virus (NOV).ApplicationProteins tagged with this AcV5 peptide are functional in both dicot and monocot plants and show no cross reactivity across many plant species. Epitope tagged fusion proteins are widely used in protein analysis of biological samples (e.g. plant cell extracts). Antibodies specific for the tag are a valuable means for the detection of the protein. Anti-AcV5 antibody, Mouse monoclonal, clone ACV5 may be used in immunoblotting, immunoprecipitation, dot blot, and immunocytochemistry.
Anti-AcV5 antibody, Mouse monoclonal has been used in:- immunoblotting
- immunoprecipitation
- dot blot
- immunocytochemistry
Biochem/physiol Actions
GP64 (AcV5) is involved in viral entry into cells by receptor-mediated endocytosis. Elevated expression of gp64 has been shown to enhance gene transfer in a variety of cell types. AcV5 is a monoclonal antibody that recognizes a nine amino acid residue tag (SWKDASGWS) of baculovirus Autographa californica GP64 envelope fusion protein (efp).
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone ACV5, monoclonal form buffered aqueous solution mol wt antigen ~58 kDa packaging antibody small pack of 25 μL concentration ~1 mg/mL application(s) dot blot: suitable, immunocytochemistry: suitable, immunoprecipitation (IP): suitable, western blot: 0.5-1 μg/mL using extracts of Sf9 cells infected with baculovirus isotype IgG2b conjugate unconjugated shipped in dry ice storage temp. −20°C
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ADAM 12 Antibody, clone 6E6
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT1331-100UG MABT1331-25UG General descriptionDisintegrin and metalloproteinase domain-containing protein 12 (UniProt: O43184, also known as ADAM 12, Meltrin-alpha) is encoded by the ADAM12 (also known as MLTN, UNQ346/PRO545) gene (Gene ID: 8038) in human. ADAM (A disintegrin and metalloprotease) family consists of multidomain cell-surface proteins that are synthesized in their proform. Four isoforms of ADAM12 have been described that are produced by alternative splicing. Isoform 1 is a single-pass transmembrane protein and isoforms 2,3, and 4 are secreted proteins. ADM12 is synthesized with a signal peptide (aa 1-28) and a propeptide (aa 29-207), which are subsequently cleaved off in the mature form. Isoform 1 shown to be expressed in placenta and in skeletal, cardiac, and smooth muscle. Isoform 2 is reported to be expressed only in placenta or in embryo and fetus. ADAM12 contains a cysteine rich domain (aa 514-649) that support cell adhesion through syndecans and triggers signaling events that lead to beta-1 integrin-dependent cell spreading. However, in carcinoma cells the binding of this domain to syndecans does not allow the integrin-mediated cell spreading. The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. Dissociation of the cysteine from the zinc ion activates the enzyme. Upregulation of ADAM12 has been reported in malignant tumors. In human breast cancer cells expressing ADAM12, MMP-14 is shown to be recruited to the cell surface which results in ADAM12 activation and accelerates tumor progression. ADAM12 does not affect tumor cell proliferation, but it causes a diminution in tumor cell apoptosis and increases stromal cell apoptosis. (Ref.: Sundberg, C., et al. (2004). J. Biol. Chem. 279(49); 51601 51611; Albrechtsen, R., et al. (2013). J. Cell Sci. 126(20); 4707 4720; Kveiborg, M., et al. (2005). Cancer Res. 65(11); 4754-4761).
Specificity
Clone 6E6 detects ADAM 12-DeltaCyt. It targets an epitope with in extracellular disintegrin-cysteine-rich domains.ImmunogenA full-length recombinant human ADAM12 secreted form expressed in HEK293 cells.ApplicationFlow Cytometry Analysis: 1 µg from a representative lot detected ADAM 12 in one million ADAM 12-DeltaCyt MCF-7 cells.
Western Blotting Analysis: A representative lot detected ADAM 12 in Western Blotting applications.
Immunoprecipitation Analysis: A representative lot immunoprecipitated ADAM 12 in Immunoprecipitation applications.
Immunocytochemistry Analysis: A representative lot detected ADAM 12 in Immunocytochemistry applications.
Flow Cytometry Analysis: A representative lot detected ADAM 12 in Flow cytometry applications.
This mouse monoclonal Anti-ADAM 12, clone 6E6, Cat. No. MABT1331, is a mouse monoclonal antibody that detects Disintegrin and metalloproteinase domain-containing protein 12 and has been tested for use in Flow Cytometry, Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Immunocytochemistry in ADAM 12-DeltaCyt MCF-7 cells.
Immunocytochemistry Analysis: A 1:250 dilution of this antibody detected ADAM 12-DeltaCyt in MCF-7 cells.
Target description
99.54 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 6E6, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001275903, UniProt accession no. O43184, Gene Information human ... ADAM12(8038) Узнать цену -
Anti-ADAM 12 Antibody, clone 8F8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT1330-25UG MABT1330-100UG General descriptionDisintegrin and metalloproteinase domain-containing protein 12 (UniProt: O43184, also known as ADAM 12, Meltrin-alpha) is encoded by the ADAM12 (also known as MLTN, UNQ346/PRO545) gene (Gene ID: 8038) in human. ADAM (A disintegrin and metalloprotease) family consists of multidomain cell-surface proteins that are synthesized in their proform. Four isoforms of ADAM12 have been described that are produced by alternative splicing. Isoform 1 is a single-pass transmembrane protein and isoforms 2,3, and 4 are secreted proteins. ADM12 is synthesized with a signal peptide (aa 1-28) and a propeptide (aa 29-207), which are subsequently cleaved off in the mature form. Isoform 1 shown to be expressed in placenta and in skeletal, cardiac, and smooth muscle. Isoform 2 is reported to be expressed only in placenta or in embryo and fetus. ADAM12 contains a cysteine rich domain (aa 514-649) that support cell adhesion through syndecans and triggers signaling events that lead to beta-1 integrin-dependent cell spreading. However, in carcinoma cells the binding of this domain to syndecans does not allow the integrin-mediated cell spreading. The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. Dissociation of the cysteine from the zinc ion activates the enzyme. Upregulation of ADAM12 has been reported in malignant tumors. In human breast cancer cells expressing ADAM12, MMP-14 is shown to be recruited to the cell surface which results in ADAM12 activation and accelerates tumor progression. ADAM12 does not affect tumor cell proliferation, but it causes a diminution in tumor cell apoptosis and increases stromal cell apoptosis. (Ref.: Sundberg, C., et al. (2004). J. Biol. Chem. 279(49); 51601 51611; Albrechtsen, R., et al. (2013). J. Cell Sci. 126(20); 4707 4720; Kveiborg, M., et al. (2005). Cancer Res. 65(11); 4754-4761).
Specificity
Clone 8F8 detects ADAM 12-DeltaCyt secreted form in human cells. It targets an epitope with in the prodomain region.ImmunogenA full-length recombinant human ADAM12 secreted expressed in HEK293 cells.ApplicationAnti-ADAM 12, clone 8F8, Cat. No. MABT1330, is a mouse monoclonal antibody that detects Disintegrin and metalloproteinase domain-containing protein 12 (ADAM12) and has been tested for use in Flow Cytometry, Immunocytochemistry, Immunoprecipitation, Inhibition Assays, and Western Blotting.
Immunoprecipitation Analysis: A representative lot immunoprecipitated ADAM 12 in Immunoprecipitation applications (Kveiborg, M., et. al. (2005). Cancer Res. 65(11):4754-61).
Inhibition Analysis: A representative inhibited ADAM 12 induced gelatin degradation. (Albrechtsen, R., et. al. (2013). J Cell Sci. 126(Pt 20):4707-20).
Flow Cytometry Analysis: 1 µg from a representative lot detected ADAM 12 in one million ADAM 12-DeltaCyt MCF-7 cells.
Immunocytochemistry Analysis: A representative lot detected ADAM 12 in Immunocytochemistry applications (Sundberg, C., et. al. (2004). J Biol Chem. 279(49):51601-11).
Western Blotting Analysis: A representative lot detected ADAM 12 in Western Blotting applications (Kveiborg, M., et. al. (2005). Cancer Res. 65(11):4754-61).
Research Category
Apoptosis & Cancer
Quality
Evaluated by Immunocytochemistry in ADAM 12-DeltaCyt MCF-7 cells.
Immunocytochemistry Analysis: A 1:50 dilution of this antibody detected ADAM 12-DeltaCyt MCF-7 cells.
Target description
99.54 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 8F8, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","inhibition assay: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001275903, UniProt accession no. O43184, Gene Information human ... ADAM12(8038)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ADAR1 Antibody, clone RD4B11
eCl@ss: 32160702
Кат. номер MABE1790-25UG MABE1790-100UG General descriptionDouble-stranded RNA-specific adenosine deaminase (UniProt: Q99MU3; also known as EC: 3.5.4.37, DRADA, RNA adenosine deaminase 1) is encoded by the Adar gene (Gene ID: 56417) in murine species. ADAR catalyzes the editing of adenosine-to-inosine (A to I) by deaminating genomically encoded A-to-I in double stranded RNA (DsRNA). A-to-I editing predominantly occurs in noncoding, repetitive elements and short interspersed nuclear elements (SINEs). A-to-I editing affects gene expression and function in several ways, including mRNA translation by changing codons and hence the amino acid sequence of proteins. It also affects pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; and genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication. In mammals three different ADAR proteins have been described: ADAR1, -2, and -3. ADAR1 is shown to be expressed during embryonic and postnatal development and is present predominantly in the nucleus. Highest levels of ADAR1 are reported in brain and spleen and lowest levels are observed in liver. Five different isoforms of ADAR1 have been reported that are produced by alternative splicing. Isoforms 1 and 2 (long forms) are predominantly found in cytoplasm and shuttle between the cytoplasm and nucleus. Isoforms 3 and 4 (short forms starting at Met-519) are exclusively found in the nucleolus. Under normal conditions long forms are dominant, however, under conditions of inflammation short forms are selectively induced. (Ref.: Liddicoat, BJ et al., (2015). Science 349 (6252); 1115-1120).
Specificity
Clone RD4B11 is a rat monoclonal antibody that detects Double-stranded RNA-specific adenosine deaminase in human and murine cells.ImmunogenHis-tagged recombinant fragment corresponding to 401 amino acids from the internal region of murine Double-stranded RNA-specific adenosine deaminase (ADAR1). Immunogen sequnece is conserved isoforms 1 and 2.ApplicationWestern Blotting Analysis: A representative lot detected ADAR1 in Western Blotting applications (Liddicoat, B.J., et. al. (2015). Science. 349(6252):1115-20).
Anti-ADAR1, clone RD4B11, Cat. No. MABE1790, is a highly specific rat monoclonal antibody that targets ADAR1 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in Kusa4b10 mouse cell line overexpressing mouse ADAR1 p110.
Western Blotting Analysis: 4 µg/mL of this antibody detected ADAR1 in Kusa4b10 mouse cell line overexpressing mouse ADAR1 p110.
Target description
~110 kDa observed; 130.45 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone RD4B11, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2a NCBI accession no. NP_062629.3, UniProt accession no. Q99MU3, Узнать цену -
Anti-ADAR2 antibody, Mouse monoclonal
MDL number: MFCD02686608 NACRES: NA.41
Кат. номер SAB4200142-25UL SAB4200142-200UL General descriptionAdenosine deaminase acting on RNA type 2 (ADAR2) is localized predominantly in the nucleus.
Adenosine deaminase acting on RNA type 2 (ADAR2), also known as adenosine deaminase, RNA specific B1 (ADARB1), is encoded by the gene mapped to human chromosome 21q22.3. ADARB1 is characterized with two double-stranded RNA-binding domains and a deaminase domain involved in editing action.ApplicationMonoclonal Anti-ADAR2 antibody produced in mouse has been used in immunoblotting.
Biochem/physiol Actions
Adenosine deaminase acting on RNA type 2 (ADAR2) enzyme plays a vital role in editing pre-mRNA of glutamate receptor B subunit. Combined effect of ADAR2 and HTR2C (5-hydroxytryptamine receptor 2C) variants contribute to the suicide attempt (SA) vulnerability in psychiatric patients. ADAR2 is a candidate gene for neurological diseases, such as bipolar affective disorder and epilepsy. Decrease in the activity of ADAR2 enzyme results in -amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor-mediated death of motor neurons in mice. ADAR2 enzyme is expressed consistently in carcinomas and sarcomas and it is upregulated in lymphomas and seminomas when compared to normal tissues.
Adenosine deaminase acting on RNA type 2 (ADAR2) activity is directly involved in both cell cycle by slowing down cell growth rate at the S-G2 phase and in cell migration. Decrease in ADAR2 editing activity is linked to tumor malignancy (astrocytoma grade I-IV) in children.
Physical form
Solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone ADAR2-8, monoclonal mol wt antigen ~81 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) western blot: 1-2 µg/mL using HL-60 total cell extract conjugate unconjugated UniProt accession no. P78563, shipped in dry ice storage temp. 20°C Gene Information human ... ADARB1(104)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Adenosylhomocysteinase (AHCY)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1803 ABE1803-25UG General descriptionAdenosylhomocysteinase (UniProt: P23526; also known as EC: 3.3.1.1, AdoHcyase, S-adenosyl-L-homocysteine hydrolase) is encoded by the AHCY (also known as SAHH) gene (Gene ID: 191) in human. Adenosylhomocysteinase is a homotetrametic enzyme that catalyzes the reversible hydrolysis of S-adenosylhomocysteine to adenosine and L-homocysteine. Hence, it regulates the intracellular S-adenosylhomocysteine concentration, which is thought to be important for transmethylation reactions. Two isoforms of adenosylhomocysteinase have been reported that are produced by alternative splicing. It contains three nucleotide binding regions (aa 157-159; 222-227; and 299-301). Defects in AHCY gene cause hypermethioninemia that is characterized with failure to thrive, mental and motor retardation, facial dysmorphism with abnormal hair and teeth, and myocardiopathy.
Specificity
This rabbit polyclonal antibody detects Adenosylhomocysteinase in human. It targets and epitope within 12 amino acids from the C-terminus region.ImmunogenKLH-conjugated linear peptide corresponding to 12 amino acids from the C-terminus region of human Adenosylhomocysteinase.
Epitope: C-terminusApplicationWestern Blotting Analysis: 2 µg/mL from a representative lot detected Adenosylhomocysteinase (AHCY) in 200 µg of human placental tissue lysate.
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Adenosylhomocysteinase (AHCY) in human kidney and human skin tissues.
Research Category
Epigenetics & Nuclear Function
Anti-Adenosylhomocysteinase (AHCY) Antibody, Cat. No. ABE1803, is a highly specific rabbit polyclonal antibody that targets Adenosylhomocysteinase (AHCY) and has been tested for use in Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Adenosylhomocysteinase (AHCY) in 200 µg of HeLa cell lysate.
Target description
~47 kDa observed; 47.72 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, pH 7.4, with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) chimpanzee (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_000678.1, UniProt accession no. P23526, shipped in ambient Gene Information human ... AHCY(191)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Adenylate Cyclase 5 Antibody, clone 19D5.C1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2049-25UG MABS2049-100UG General descriptionAdenylate cyclase type 5 (P84309; also known as EC: 4.6.1.1, ATP pyrophosphate-lyase 5, Adenylate cyclase type V, Adenylyl cyclase 5, AC5) is encoded by the Adcy5 gene (Gene ID: 224129) in murine species. Adenylate cyclase catalyzes the formation of cyclic AMP in response to G-protein signaling. It regulates the increase of free cytosolic calcium in response to increased blood glucose levels and contributes to the regulation of calcium-dependent insulin secretion. Adenylyl cyclases are typically made up of two clusters of six transmembrane domains separating two intracellular, overlapping catalytic domains. The amino acid sequence of each cytoplasmic domain that contains the nucleotide (ATP)-binding site, is well conserved among various subtypes. Thus far 9 different hormone-sensitive, membrane-bound AC isoforms have been identified. Adenylyl Cyclase 5 deficiency is shown to protect against diet-induced obesity and insulin resistance in mice and extends their life span. Adenylate cyclase 5 knockout mice display signs of reduced stress and protection against the stress of chronic pressure overload on heart. Adenylate cyclase 5 activity is stimulated by forskolin and is inhibited by adenosine and ATP analogs. (Ref.: Ho, D., et al. (2015). Diabetes. 64(7); 2636-2645. Vatner, SF., et al. (2015). Oxid. Med. Cell. Longev. 2015:250310).
Specificity
Clone 19D5.C1 detects Adnylate Cyclase 5 in murine, rat, and procine cells. It targets an epitope within 20 amino acids from the cytoplasmic domain.ImmunogenEpitope: cytoplasmic domain
KLH-conjugated linear peptide corresponding to 20 amino acids from the cytoplasmic domain of murine adenylate cyclase V.ApplicationAnti-Adenylate Cyclase 5, clone 19D5.C1, Cat. No. MABS2049, is a mouse monoclonal antibody that detects adenylate cyclase 5 and has been tested for use in ELISA and Western Blotting.
Western Blotting Analysis: A representative lot detected Adenylyl Cyclase 5 in Western Blotting applications (Hu, C.L., et. al. (2009). Am J Physiol Heart Circ Physiol. 297(5):H1776-82; De Lorenzo, M.S., et. al. (2014). Aging Cell. 13(1):102-10).
ELISA Analysis: A representative lot detected Adenylyl Cyclase 5 in ELISA applications (Hu, C.L., et. al. (2009). Am J Physiol Heart Circ Physiol. 297(5):H1776-82).
Research Category
Signaling
Quality
Evaluated by Western Blotting in mouse brain membrane preparations.
Western Blotting Analysis: 1 µg/mL of this antibody detected Adenylate Cyclase 5 in mouse brain membrane preparations.
Target description
~150 kDa observed; 139.12 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 19D5.C1, monoclonal species reactivity rat, porcine, mouse species reactivity (predicted by homology) human (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) ELISA: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001012783.3, UniProt accession no. P84309,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Adenylate Cyclase Toxin Antibody, B. pertussis Antibody, clone 3D1
eCl@ss: 32160702
Кат. номер MABF2086-25UG MABF2086-100UG General descriptionAdenylate Cyclase Toxin (UniProt: C8C508; also known as ACT or CyaA) is one of several virulence factors produced by the bacterium Bordetella pertussis. Bordetella pertussis, a gram-negative bacterium, is shown to be the causative agent for whooping cough. It produces several virulence factors, including Cya A. The CyaA toxin is a bifunctional protein of 1,706 residues consisting of an NH2-terminal catalytic domain of 400 amino acids and a COOH-terminal part with 1,306 residues. The CyaA polypeptide is synthesized as an inactive protoxin, which is then converted to an active toxin by posttranslational palmitoylation of two internal lysine residues (Lys 856 and 963). Upon interaction of its C-terminal hemolysin moiety with the cell surface receptor alphaM-beta2 integrin ((Cd11b/Cd18), the N-terminal cyclase domain translocates into the host cell cytosol where it generates supraphysiological levels of cAMP concentration, which inhibits host cell anti-bacterial activities and apoptotic death of macrophages. CyaA toxin is also shown to elicit potassium ion efflux from erythrocytes in a process that is thought to be a precursor event to osmotic lysis of erythrocytes.Clone 3D1 is shown to cause both an enhancement of hemolysis and inhibition of intoxication in erythrocytes. It also inhibits toxin-induced cAMP accumulation in Jurkat cells. (Ref.: Guermonprez, P., et al. (2001). J. Exp. Med. 193(9); 1035 1044; Gray, MC., et al. (2001). J. Bacteriol. 183(20); 5904-5910; Holubova, J., et al. (2012). Infect. Immun. 80(3); 1181 1192).
Specificity
Clone 3D1 is a mouse monoclonal antibody that detects Adenylate cyclase (AC) toxin from Bordetella pertussis.ImmunogenAdenylate cyclase (AC) toxin from Bordetella pertussis.ApplicationInhibition Analysis: A representative lot inhibited AC toxin-induced cAMP accumulation in Jurkat cells and inhibited intoxication of sheep erythrocytes. (Bumba, L., et. al. (2016). Mol Cell. 62(1):47-62; Gray, M.C., et. al. (2001). J Bacteriol. 183(20):5904-10; Holubova, J., et. al. (2012). Infect Immun. 80(3):1181-92; Hewlett, E.L., et. al. (2006). Mol Microbiol. 59(2):447-59).
Flow Cytometry Analysis: A representative lot detected Adenylate Cyclase Toxin, B. pertussis in Flow Cytometry applications (Gray, M.C., et. al. (2001). J Bacteriol. 183(20):5904-10).
Western Blotting Analysis: A representative lot detected Adenylate Cyclase Toxin, B. pertussis in Western Blotting applications (Lee, S.J., et. al. (1999). Infect Immun. 67(5):2090-5).
ELISA Analysis: A representative lot detected Adenylate Cyclase Toxin, B. pertussis in ELISA applications (Weingart, C.L., et. al. (2000). Infect Immun. 68(12):7152-5; Wang, X., et. al. (2015). J Biol Chem. 290(38):23025).
Neutralizing Analysis: A representative lot neutralized Adenylate Cyclase Toxin action. (Holubova, J., et. al. (2012). Infect Immun. 80(3):1181-92.
Anti-Adenylate Cyclase Toxin, B. pertussis, clone 3D1 , Cat. No. MABF2086, is a mouse monoclonal antibody that detects Adenylate cyclase (AC) toxin from Bordetella pertussis and has been tested for use in ELISA, Flow Cytometry, Inhibition Assay, Neutralizing, and Western Blotting.
Quality
Evaluated by Western Blotting in Adenylate cyclase toxin from Bordetella pertussis.
Western Blotting Analysis: 0.2 µg/mL of this antibody detected Adenylate Cyclase Toxin from Bordetella pertussis.
Target description
~220 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 3D1, monoclonal species reactivity bacteria packaging antibody small pack of 25 μg application(s) ELISA: suitable, flow cytometry: suitable, inhibition assay: suitable, neutralization: suitable, western blot: suitable isotype IgG1κ Узнать цену -
Anti-Adenylate Cyclase Toxin Antibody, B. pertussis Antibody, clone 9D4
eCl@ss: 32160702
Кат. номер MABF2087-25UL MABF2087-100UL General descriptionAdenylate Cyclase Toxin (UniProt: C8C508; also known as ACT or Cya A) is one of several virulence factors produced by the bacterium Bordetella pertussis. Bordetella pertussis, a gram-negative bacterium, is shown to be the causative agent for whooping cough. It produces several virulence factors, including Cya A. The CyaA toxin is a bifunctional protein of 1,706 residues consisting of an NH2-terminal catalytic domain of 400 amino acids and a COOH-terminal part with 1,306 residues. The CyaA polypeptide is synthesized as an inactive protoxin, which is then converted to an active toxin by posttranslational palmitoylation of two internal lysine residues (Lys 856 and 963). Upon interaction of its C-terminal hemolysin moiety with the cell surface receptor alphaM-beta2 integrin ((Cd11b/Cd18), the N-terminal cyclase domain translocates into the host cell cytosol where it generates supraphysiological levels of cAMP concentration, which inhibits host cell anti-bacterial activities and apoptotic death of macrophages. Cya A toxin is also shown to elicit potassium ion efflux from erythrocytes in a process that is thought to be a precursor event to osmotic lysis of erythrocytes. Clone 9D4 binds to an epitope of AC toxin in the glycine- and aspartate- rich region. Hence, it recognizes other RTX toxins in addition to AC toxin. Clone 9D4 increases the fraction of AC toxin (CyaA) that is secreted to cell surface and release of CyaA into culture supernatant(Ref.: Guermonprez, P., et al. (2001). J. Exp. Med. 193(9); 1035-1044; Gray, MC., et al. (2001). J. Bacteriol. 183(20); 5904-5910; Holubova, J., et al. (2012). Infect. Immun. 80(3); 1181-1192).
Specificity
Clone 9D4 is a mouse monoclonal antibody that detects Adenylate cyclase (AC) toxin from Bordetella pertussis.ImmunogenAdenylate cyclase toxin from Bordetella pertussis.ApplicationFunction Analysis: A representative lot increased the fraction of AC toxin (CyaA) that is secreted to cell surface and release of CyaA into culture supernatant. (Gray, M.C., et. al. (2001). J Bacteriol. 183(20):5904-10).
Western Blotting Analysis: A representative lot detected Adenylate Cyclase Toxin, B. pertussis in Western Blotting applications (Holubova, J., et. al. (2012). Infect Immun. 80(3):1181-92; Lee, S.J., et. al. (1999). Infect Immun. 67(5):2090-5).
Dot Blot Analysis: A representative lot detected Adenylate Cyclase Toxin, B. pertussis in Dot Blot applications (Lee, S.J., et. al. (1999). Infect Immun. 67(5):2090-5).
Anti-Adenylate Cyclase Toxin, B. pertussis, clone 9D4, Cat. No. MABF2087 is a mouse monoclonal antibody that detects Adenylate cyclase (AC) toxin from Bordetella pertussis and has been tested for use in Dot Blot, Function Assay and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in Adenylate cyclase toxin from Bordetella pertussis.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Adenylate Cyclase Toxin from from Bordetella pertussis.
Target description
~220 kDa observed.
Physical form
Format: Purified
Protein G purified
Purified mouse monoclonal antibody IgG2a in PBS without preservatives.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 9D4, monoclonal species reactivity bacteria packaging antibody small pack of 25 μL application(s) cell analysis: suitable (function assay), dot blot: suitable, western blot: suitable isotype IgG2aλ Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
