- Производитель:
- Sigma-Aldrich
Кат. номер |
MSST0017-10UG |
MSST0017-10UG-PW |
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides,)
Biochem/physiol Actions
IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated clinically as biomarkers in ACS (Acute Coronary Syndrome). Its pathophysiological contribution to ACS is the induction of acute-phase response. Patients with ACS have increased circulating levels of IL-6 compared with those patients who have stable angina. Among patients with unstable angina, an increase in IL-6 levels that occurred 48 hours after admission compared with the admission value was associated with the combined end point of death, myocardial infarction (MI), or refractory angina. High levels of IL-6 are also related to cardiovascular disease, heart attack, and stroke.
Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
SILu is a trademark of Sigma-Aldrich Co. LLC
Quality Level | 200 |
biological source | human |
recombinant | expressed in HEK 293 cells |
assay | 98% (SDS-PAGE) |
form | lyophilized powder |
potency | 98% Heavy amino acids incorporation efficiency by MS |
application(s) | mass spectrometry (MS): suitable |
suitability | suitable for mass spectrometry (standard) |
UniProt accession no. | P05231, |
storage temp. | 20°C |
Gene Information | human ... IL6(3569) |
RIDADR | NONH for all modes of transport |
WGK Germany | WGK 2 |
Flash Point F | Not applicable |
Flash Point C | Not applicable |
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа

С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии

Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.

У большинства компаний срок ожидания составляет 10-12 недель.

Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.

Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.

В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.

Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.