Sigma-Aldrich
- Сортировать:
- Вид таблицей
-
SILu™Lite IL6 Interleukin 6 human
NACRES: NA.12
Кат. номер MSST0018-50UG MSST0018-50UG-PW General descriptionSILu™ Lite IL-6 is a recombinant human protein expressed in human 293 cells. It is a monomer of 183 amino acids, with a molecular weight of ~21 kDa. SILu™ Lite IL-6 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides,)
Biochem/physiol Actions
IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated clinically as biomarkers in ACS (Acute Coronary Syndrome). Its pathophysiological contribution to ACS is the induction of acute-phase response. Patients with ACS have increased circulating levels of IL-6 compared with those patients who have stable angina. Among patients with unstable angina, an increase in IL-6 levels that occurred 48 hours after admission compared with the admission value was associated with the combined end point of death, myocardial infarction (MI), or refractory angina. High levels of IL-6 are also related to cardiovascular disease, heart attack, and stroke.
Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder mol wt 20812.7 application(s) mass spectrometry (MS): suitable suitability suitable for mass spectrometry (internal calibrator) UniProt accession no. P05231, storage temp. 20°C Gene Information human ... IL6(3569)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite IL8, Interleukin-8 human
NACRES: NA.32
Кат. номер MSST0058-50UG MSST0058-50UG-PW General descriptionSILu™Lite IL8 is a recombinant human protein expressed in human 293 cells. It is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product datasheet. SILu™Lite IL8 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 95% (SDS-PAGE) form lyophilized powder suitability suitable for mass spectrometry (internal calibrator) UniProt accession no. P10145, shipped in ambient storage temp. 20°C Gene Information human ... CXCL8(3576)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite MAPK1 Mitogen Activated Protein Kinase 1 human
NACRES: NA.12
Кат. номер MSST0010-50UG MSST0010-50UG-PW General descriptionSILu™Lite MAPK1 is a recombinant human MAPK1 expressed in human 293 cells. It is a monomer of 380 amino acids (including polyhistidine and flag tags), with an apparent molecular weight of 44 kDa. SILu™Lite MAPK1 is designed to be used as an internal standard for bioanalysis of MAPK1 in mass-spectrometry.
Biochem/physiol Actions
MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear proteins (e.g., Elk-1, c-Myc, c-Jun, c-Fos, and C/EBP β). It is a protein serine/threonine kinase that is a member of the extracellular signal-regulated kinases (ERKs) which are activated in response to numerous growth factors and cytokines. Aberrations in the RAS-MAPK complex (of which MAPK1 is a downstream effector) are implicated in several human cancers, and this renders the pathway an attractive therapeutic target.
Sequence
MDYKDDDDKGHHHHHHHHGGQAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Physical form
Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 95% (SDS-PAGE) form liquid mol wt 43.8 kDa conjugate His tagged suitability suitable for mass spectrometry (internal calibrator) UniProt accession no. P28482, relevant disease(s) cancer storage temp. 20°C
Safety Informationpictograms GHS07 signalword Warning hcodes H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite MAPK3 Mitogen activated protein kinase 3 human
NACRES: NA.12
Кат. номер MSST0020-50UG MSST0020-50UG-PW General descriptionSILu™ Lite MAPK3 is a recombinant human protein expressed in human 293 cells. It is a monomer of 399 amino acids (including N-terminal polyhistidine and flag tags), with a molecular weight of ~45.5 kDa. SILu™ Lite MAPK3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
MAPK3, the first mammalian MAPK to be characterized and cloned, is commonly expressed in most tissues and is activated through the small guanosine triphosphatase Ras and sequential activation of the protein kinases Raf and MEK upon stimulation of cells with a broad range of extracellular signals. Erk was suggested to be a good marker for estradiol and tamoxifen effects. Alzheimers diseases Erk1 and Erk2 index values were inversely correlated with disease duration, suggesting maximal efficacy for early diagnosis. In addition, differential Erk1 and Erk2 phosphorylation, could have important clinical utility for providing increased certainty in the positive diagnosis of AD, particularly in the early phase of disease progression.
Sequence
MDYKDDDDKGHHHHHHHHGGQAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
Physical form
Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 95% (SDS-PAGE) form liquid mol wt 45.5 kDa suitability suitable for mass spectrometry UniProt accession no. P27361, storage temp. 20°C
Safety Informationpictograms GHS07 signalword Warning hcodes H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite MAPT Microtubule-associated protein tau-441 human
NACRES: NA.12
Кат. номер MSST0032-50UG MSST0032-50UG-PW General descriptionTau-441 is a member of the Tau family of proteins. Tau proteins are mainly expressed in the neurons of the central nervous system where they exert a role in stabilizing microtubules, key components of axonal transport, as well as in signal transduction.Tau proteins are subject to phosphorylation and this phenomenon regulates the association of the Tau protein with the microtubules. Deposits of Alzheimer′s disease AD-associated proteins, such as hyperphosphorylated Tau, as well as other shared misfolded proteins, such as, β-amyloid precursor protein (βAPP), ubiquitin, and various chaperones and protein kinases are thought to play a pathologic role in the cognitive decline and muscular failure.3 Malfunctioning of Tau proteins is associated with microtubules disintegration and collapsing of the neuronal transport system Among other diseases, Tau forms in cerebrospinal fluid are considered a reliable biomarker for progressive supranuclear palsy, where the levels of Tau forms ratio were significantly reduced.ImmunogenMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGLDRIRGRKLGPFEGKPIPNPLLGLDSTRTGHHHHHHHHGGQ
Biochem/physiol Actions
SILu™Lite MAPT is a recombinant human protein expressed in human 293 cells. It consists of 481 amino acids (including C-terminal V5 and polyhistidine tags), with a calculated molecular mass of 50 kDa. SILu Lite MAPT is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder potency 98% Heavy amino acids incorporation efficiency by MS mol wt calculated mol wt 50 kDa application(s) mass spectrometry (MS): suitable conjugate 8-His tagged","V5 tagged suitability suitable for mass spectrometry (internal calibrator) UniProt accession no. P02649, storage temp. 20°C Gene Information human ... MAPT(4137)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite PTX3 Pentraxin-related protein 3 human
NACRES: NA.12
Кат. номер MSST0004-50UG MSST0004-50UG-PW General descriptionSILu™ Lite PTX3 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homooctamer and a homodecamer consisting of 364 amino acids (monomer)with a calculated molecular weight of 40 kDa. It contains no tags.
Biochem/physiol Actions
Pentraxin 3 (PTX3) is a secreted glycosylated protein belonging to the pentraxin superfamily1. PTX3 is rapidly produced and released by several cell types, in particular by mononuclear phagocytes, dendritic cells (DCs), fibroblasts and endothelial cells in response to primary inflammatory signals (e.g., toll-like receptor [TLR]engagement,TNF, IL-1)1. PTX3 behaves as an acute phase response protein, as the blood levels of PTX3, low in normal conditions (about 25 ng/mL in the mouse, < 2 ng/mL in humans), increase rapidly (peaking at 6–8 h after induction) and dramatically (200–800 ng/mL)during endotoxic shock, sepsis and other inflammatory and infectious conditions, correlating with the severity of the disease. Under these conditions, PTX3 is a rapid marker for primary local activation of innate immunity and inflammation26. anti-apoptotic cell survival2, cell cycle regulation3, cell adhesion4, tissue remodeling5 and lipid transportation6. PTX3 gene expression in human endothelial cells is suppressed to a greater extent by pitavastatin than the expression of 6,000 other human genes that have been examined, suggesting that PTX3 may be a novel biomarker for inflammatory cardiovascular disease8.
Sequence
ENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder application(s) mass spectrometry (MS): suitable UniProt accession no. P26022, storage temp. 20°C Gene Information human ... PTX3(5806)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite SigmaMAb Adalimumab Monoclonal Antibody
Кат. номер MSQC16-PH MSQC16-0.5MG General descriptionSigmaMAb Adalimumab (MSQC16) was designed to be a standard for the analysis of Adalimumab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Adalimumab (MSQC11).
SigmaMAb Adalimumab is for R&D use only. Not for drug, household, or other uses.
Sequence
SigmaMab Adalimumab Heavy Chain:
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite SigmaMAb Bevacizumab Monoclonal Antibody
Кат. номер MSQC20-0.5MG MSQC20-PH General descriptionSigmaMAb Bevacizumab (MSQC20) was designed to be a standard for the analysis of Bevacizumab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Bevacizumab (MSQC21).
SigmaMAb Bevacizumab is for R&D use only. Not for drug, household, or other uses.SequenceSigmaMab Bevacizumab Heavy Chain:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Bevacizumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™Lite SigmaMAb Cetuximab Monoclonal Antibody
Кат. номер MSQC18-0.5MG MSQC18-PH General descriptionSigmaMAb Cetuximab (MSQC18) was designed to be a standard for the analysis of Cetuximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Cetuximab (MSQC19).
SigmaMAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
Sequence
SigmaMab Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite SigmaMAb Infliximab Monoclonal Antibody
Кат. номер MSQC15-PH MSQC15-0.5MG General descriptionSigmaMAb Infliximab (MSQC15) was designed to be a standard for the analysis of Infliximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Infliximab (MSQC9).
SigmaMAb Infliximab is for R&D use only. Not for drug, household, or other uses.
Sequence
SigmaMab Infliximab Heavy Chain:
EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSAVYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Infliximab Light Chain:
DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVESEDIADYYCQQSHSWPFTFGSGTNLEVKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite SigmaMAb Nivolumab Monoclonal Antibody
Кат. номер MSQC26-0.5MG MSQC26-PH General descriptionSigmaMAb Nivolumab (MSQC26) was designed to be a standard for the analysis of Nivolumab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Nivolumab (MSQC27).
SigmaMAb Nivolumab is for research use only and is not intended for diagnostic or therapeutic use.
Sequence
SigmaMAb Nivolumab Heavy Chain:
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SigmaMAb Nivolumab Light Chain:
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells assay 90% (HPLC) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™Lite SigmaMAb Pembrolizumab Monoclonal Antibody
Кат. номер MSQC24-0.5MG MSQC24-PH General descriptionSigmaMAb Pembrolizumab (MSQC24) was designed to be a standard for the analysis of Pembrolizumab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Pembrolizumab (MSQC25).
SigmaMAb Pembrolizumab is for research use only and is not intended for diagnostic or therapeutic use.
Sequence
SigmaMAb Pembrolizumab Heavy Chain:
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SigmaMAb Pembrolizumab Light Chain:
EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells assay 90% (HPLC) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™Lite SigmaMAb Rituximab Monoclonal Antibody
Кат. номер MSQC17-PH MSQC17-0.5MG General descriptionSigmaMAb Rituximab (MSQC17) was designed to be a standard for the analysis of Rituximab monoclonal antibodies using mass spectrometry. A heavy labeled version is available as SILu™Mab Rituximab (MSQC13).
SigmaMAb Rituximab is for R&D use only. Not for drug, household, or other uses.
Sequence
SigmaMab Rituximab Heavy Chain:
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Rituximab Light Chain:
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite SigmaMAb Trastuzumab Monoclonal Antibody
Кат. номер MSQC22-0.5MG MSQC22-PH General descriptionSigmaMAb Trastuzumab (MSQC22) was designed to be a standard for the analysis of Trastuzumab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Trastuzumab (MSQC23).
SigmaMAb Trastuzumab is for R&D use only. Not for drug, household, or other uses.SequenceSigmaMab Trastuzumab Heavy Chain:
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Trastuzumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™Lite SigmaMAb Universal Antibody Standard human
NACRES: NA.12
Кат. номер MSQC4-1MG-PW MSQC4-1MG MSQC4-PH MSQC4-100MG General descriptionSILU™ Lite SigmaMAb is a recombinant human monoclonal IgG1 lambda light antibody with a molecular mass of 150 kDa expressed in CHO cells. It is designed for optimization of accurate intact mass analysis of monoclonal antibodies, biosimilars, and pharmaceutical products. Accurate intact mass analysis of such large biomolecules can provide comprehensive information about structural and post-translational modifications such as glycosylation. Other information such as heterogeneity, batch-to-batch variation, amino acid truncation, and N-terminal Lys processing, aggregation, and degradation can be determined. Intact mass analysis using mass spectrometry is also very important for formulation and storage in therapeutic monoclonal antibody drug development.
It consists of two identical heavy chains and two identical light chains. The heavy chains and light chains are linked by one disulfide bond. The heavy chains are linked by two disulfide bonds located in a hinge domain. The other 12 cysteine bonds are intramolecularly restricted to six different globular domains. The antibody sequence has been evaluated by intact mass and peptide mapping using four different enzymes: chymotrypsin, Asp-N and Glu-C endoproteinases and trypsin. Sequence coverage of 100% was obtained.ApplicationSILu™ Lite SigmaMAb Universal Antibody Standard human has been used as a model system to investigate the quantitative relationship between gas-phase monoclonal antibody (mAb) unfolding and the discrete levels of mAb glycosylation.Features and BenefitsCalculated molecular weight values of the SigmaMAb light chains, heavy chains, and intact protein, with the most abundant glycoforms, are as follows:
Description / Composition / Modification / Average Mass (Da)
Light chain, reduced / C1006H1555N267O333S7 / Pyroglutamic acid (Q) / 22942.2
Heavy chain, reduced / C2181H3393N587O663S16 / (no modification) / 48957.8
C2237H3485N591O702S16 / G0F / 50403.2
C2243H3495N591O707S16 / G1F / 50565.3
C2249H3505N591O712S16 / G2F / 50727.5
Native intact mass, non-reduced / C6374H9864N1708O1992S46 / 2 X Pyroglutamic acid (Q) / 143767.7
C6486H10048N1716O2070S46 / G0F+G0F / 146658.4
C6492H10058N1716O2075S46 / G0F+G1F / 146820.6
C6498H10068N1716O2080S46 / G1F+G1F / 146982.7
C6504H10078N1716O2085S46 / G1F+G2F / 147144.8
C6510H10088N1716O2090S46 / G2F+G2F / 147307.0Physical formSupplied as a lyophilized powder containing phosphate buffered salinePreparation NoteSigmaMAb recovery is maximized when phosphate buffer, pH 6–7, is used to reconstitute the lyophilized product.Analysis NotePackage size based on protein content determined by A280
SigmaMab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Also available as a stable isotope-labled product, Silu™Mab (Product Number MSQC3)Other NotesAvoid PBS for reconstitution.
Reconstitute the contents of the vial by adding 500µL of ultrapure water or phosphate buffer, and mixing vigorously. The solubilized product can be further diluted as needed.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 recombinant expressed in CHO cells shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite SigmaMAb Vedolizumab Monoclonal Antibody
Кат. номер MSQC28-0.5MG MSQC28-PH General descriptionSigmaMAb Vedolizumab (MSQC28) was designed to be a standard for the analysis of Vedolizumab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Vedolizumab (MSQC29).
SigmaMAb Vedolizumab is for research use only and is not intended for diagnostic or therapeutic use.
Sequence
SigmaMAb Vedolizumab Heavy Chain:
QVQLVQSGAEVKKPGASVKVSCKGSGYTFTSYWMHWVRQAPGQRLEWIGEIDPSESNTNYNQKFKGRVTLTVDISASTAYMELSSLRSEDTAVYYCARGGYDGWDYAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMAb Vedolizumab Light Chain:
DVVMTQSPLSLPVTPGEPASISCRSSQSLAKSYGNTYLSWYLQKPGQSPQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGTHQPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells assay 90% (HPLC) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™Lite SOST, Sclerostin human
NACRES: NA.12
Кат. номер MSST0048-50UG MSST0048-50UG-PW General descriptionSILu™Lite SOST is a recombinant human protein expressed in human 293 cells. It consists of 201 amino acids (including a N-terminal polyhistidine and tag), with a calculated molecular mass of 22.8 kDa. SILu™Lite SOST is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Sclerostin is a secreted Wnt signaling antagonist produced almost exclusively by osteocytes. It can selectively inhibit Wnt/ β-catenin, suppressing the activity of osteoblasts as well as the viability of osteoblasts and osteocytes. Lower sclerostin levels are associated with lower bone mineral content and bone. It was demonstrated that greater total limb bone mineral content was significantly associated with greater circulating levels of sclerostin. In addition, circulating sclerostin is a biomarker of osteoporosis severity in long-term, chronic paraplegia. Serum sclerostin was associated significantly, independently, and positively with bone mineral density of both cortical and cancellous bone. Sclerostin is considered to be one of the factors associated with chronic kidney disease-mineral and bone disorder in hemodialysis patients.
Sequence
HHHHHHHHGGQQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder application(s) mass spectrometry (MS): suitable conjugate 8-His tagged suitability suitable for mass spectrometry (internal calibrator) UniProt accession no. Q9BQB4, storage temp. 20°C Gene Information human ... SOST(50964)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite TIMP1, Metalloproteinase inhibitor 1 human
NACRES: NA.12
Кат. номер MSST0044-50UG MSST0044-50UG-PW General descriptionSILu™Lite TIMP1 is a recombinant human protein expressed in human 293 cells. It consists of 184 amino acids, with a calculated molecular mass of 20.7 kDa. SILu™Lite TIMP1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.
Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 98% (SDS-PAGE) form lyophilized powder suitability suitable for mass spectrometry (internal calibrator) UniProt accession no. P01033, storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite TIMP2, Metalloproteinase inhibitor 2 human
NACRES: NA.12
Кат. номер MSST0046-50UG MSST0046-50UG-PW General descriptionSILu™Lite TIMP2 is a recombinant human protein expressed in human 293 cells. It consists of 194 amino acids, with a calculated molecular mass of 21.7 kDa. SILu™Lite TIMP2 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.
Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 98% (SDS-PAGE) form lyophilized powder suitability suitable for mass spectrometry (internal calibrator) UniProt accession no. P16035, storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Lite VEGFA Vascular endothelial growth factor A human
NACRES: NA.12
Кат. номер MSST0006-50UG MSST0006-50UG-PW General descriptionSILu™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides,)
Biochem/physiol Actions
VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.1 VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.2
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC
Physical form
Supplied as a lyophilized powder containing phosphate buffered salineLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder application(s) mass spectrometry (MS): suitable UniProt accession no. P15692, storage temp. 20°C Gene Information human ... VEGFA(7422)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC11-100UG MSQC11-PH General descriptionSILu™ MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4.
SILu™ MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.ImmunogenSILu™Mab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGR
FTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™Mab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECApplicationPoster: Multiplex Quantification of Infliximab and Adalimumab in Human Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards,
Sequence
Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic Digest
Universal Peptide Sequence Location
GLEWVSAITWNSGHIDYADSVEGRHeavy chain
APYTFGQGTKLight chain
FSGSGSGTDFTLTISSLQPEDVATYYCQRLight chain
Preparation Note
Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.
SILu™Mab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.
Reconstitution
SILu™Mab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 µL of ultrapure water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.
Each vial of SILu™Mab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.
Analysis Note
Quantitative
MRM settings provided (xls,)Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells antibody product type primary antibodies assay 90% (SDS-PAGE) packaging vial of 100 µg shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAb Bevacizumab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC21-100UG MSQC21-PH General descriptionSILu™MAb Bevacizumab (MSQC21) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Bevacizumab in human serum.
SILu™MAb Bevacizumab is for R&D use only. Not for drug, household, or other uses.
Sequence
SILu™MAb Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™MAb Cetuximab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC19-100UG MSQC19-PH General descriptionSILu™MAb Cetuximab (MSQC19) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Cetuximab in human serum.
SILu™MAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
Sequence
SILu™MAb Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™MAb Infliximab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC9-100UG MSQC9-PH General descriptionSILu™MAb Infliximab Stable-Isotope Labeled Monoclonal Antibody (MSQC9) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Infliximab in human serum. Infliximab is a chimeric monoclonal antibody biologic drug that works against tumor necrosis factor alpha (TNF-a) and is used to treat autoimmune diseases.
Infliximab has been approved for the treatment of Crohns disease, ulcerative colitis, psoriasis, psoriatic arthritis, ankylosing spondylitis, and rheumatoid arthritis. SILu™MAb Infliximab Stable-Isotope Labeled Monoclonal Antibody is for R&D use only. Not for drug, household, or other uses.ApplicationPoster: Quantification of Infliximab in Human Serum by LC-MS/MS Using A Full-Length Stable Isotope Labeled Internal Standard,
Physical form
Each vial of SILu™Mab Infliximab Stable-Isotope Labeled Monoclonal Antibody contains the labeled antibody in a lyophilized form containing phosphate buffered saline.
Preparation Note
Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.
SILu™Mab Infliximab Stable-Isotope Labeled Monoclonal Antibody is designed to be used as a internal standard for analysis of Infliximab in human serum.
Reconstitution
SILu™Mab Infliximab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 µL of ultrapure water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.
Analysis Note
Quantitative
MRM settings provided (xls,)Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells antibody product type primary antibodies assay 90% (SDS-PAGE) packaging vial of 100 µg shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAb K1 Pharmacokinetic Kit MSKT0001-1KT
General descriptionAll critical reagents necessary to perform the assay are provided in the kit. The plate-based format avoids the high cost and potential LC column blockage associated with bead-based enrichment formats. Sample preparation with the SILu™MAb PK kit can be performed in under 5 hours and consists of coating wells with high-specificity capture antibody, followed by immunoaffinity enrichment and rapid, in-plate trypsin digestion. The resulting digest is ready for injection, with no SPE or other cleanup required.ApplicationThe SILu™MAb K1 Pharmacokinetic (PK) kit enables a robust, high-throughput assay for quantification of human IgG1 antibody in animal sera by LC-MS/MS.
Storage and Stability
Store the kit at 2-8°C. The kit is stable for two years refrigerated.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыsuitability suitable for mass spectrometry storage temp. 2-8°C
Safety Informationpictograms GHS02,GHS06,GHS08 signalword Danger hcodes H226 - H301 + H311 + H331 - H370 pcodes P210 - P233 - P280 - P301 + P310 - P303 + P361 + P353 - P304 + P340 + P311 RIDADR UN 3316 9 Flash Point F 75.2 °F Flash Point C 24 °C Узнать цену -
SILu™MAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody
NACRES: NA.12
Кат. номер MSQC6-PH MSQC6-100UG MSQC6-100UG-KC MSQC6-5MG MSQC6-100UG-PW ApplicationSILu™ MAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody has been used to spike peptide samples to assess preparation reproducibility.
Features and Benefits
Universal Peptide Sequence Location
FNWYVDGVEVHNAK Heavy Chain (IgG1)
VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4)
SGTASVVCLLNNFYPR Light Chain (kappa)
VDNALQSGNSQESVTEQDSK Light Chain (kappa)
DSTYSLSSTLTLSK Light Chain (kappa)
SILu™Mab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.- SILu™Mab yielded reproducible, linear curves from 0.1 µg/mL to 1000 µg/mL without enrichment or depletion.
- Good agreement was observed between multiple peptides derived from the same target.
- Label incorporation was determined to be >98% by mass spectrometry.
- Sequence coverage was confirmed by peptide mapping.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline
Preparation Note
SILu™Mab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILu™Mab provides universal utility, thus eliminating the need for production of candidate-specific internal standards.
Produced utilizing enriched media containing stable isotope labeled amino acids are 13C<SUB>6</SUB>, 15N<SUB>4</SUB>-labeled Arginine and 13C<SUB>6</SUB>, 15N<SUB>2</SUB>-labeled Lysine.
Reconstitution
SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 µL of purified water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.
Analysis Note
SILuMAb K1 Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILuMAb K1 Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVLTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Target overlap areas are underlined
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
Quantitative
MRM settings provided (xls,)Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells antibody product type primary antibodies assay 90% (SDS-PAGE) packaging vial of 100 µg (± 10% Lot-specific vial content given on certificate of analysis) shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAb K4 Stable-Isotope Labeled Universal Monoclonal Antibody
NACRES: NA.12
Кат. номер MSQC7-100UG MSQC7-PH ApplicationMultiplex Universal Peptide Quant Approach Using Microflow LC/MS/MS for Non-human Preclinical PK Study of Therapeutic Monoclonal Antibodies ( Webinar ,)
Applying Best-in-Class HPLC Column Technologies to the Analysis of Proteins and Biotherapeutics Using SILuMab ( Webinar ,)
Features and Benefits
Universal Peptide Sequence Location
YGPPCPPCPAPEFLGGPSVFLFPPKPK Heavy Chain (IgG4 Stabilized)
VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4)
TTPPVLDSDGSFFLYSR Heavy Chain (IgG4)
SGTASVVCLLNNFYPR Light Chain (kappa)
VDNALQSGNSQESVTEQDSK Light Chain (kappa)
DSTYSLSSTLTLSK Light Chain (kappa)
Underlined is a Serine-Proline substitution in the hinge region that is present in many human IgG4-based therapeutic monoclonal antibodies
SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.- SILuMab yielded reproducible, linear curves from 0.1 µg/mL to 1000 µg/mL without enrichment or depletion.
- Good agreement was observed between multiple peptides derived from the same target.
- Label incorporation was determined to be >98% by mass spectrometry.
- Sequence coverage was confirmed by peptide mapping.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline
Preparation Note
Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled arginine and 13C6, 15N2-labeled lysine
SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides universal utility, thus eliminating the need for production of candidate-specific internal standards.
Reconstitution
SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 µL of purified water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.
Analysis Note
SILuMAb K4 Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SILuMAb K4 Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVLTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Target overlap areas are underlined
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
Quantitative
MRM settings provided (xls,)Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells antibody product type primary antibodies assay 90% (SDS-PAGE) packaging vial of 100 µg (± 10% Lot-specific vial content given on certificate of analysis) shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAb Mouse Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC10-PH MSQC10-100UG General descriptionSILu™MAb Mouse is a recombinant, stable isotope-labeled, mouse monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILu™MAb Mouse is designed to be used as a universal internal standard for bioanalysis of monoclonal murine antibodies in animal pharmacokinetics (PK) studies.
SILu™MAb Mouse is an IgG1 antibody with a kappa light chain. Because of overlap with common sequences in the Fc region with candidate murine antibodies, SILu™MAb Mouse provides universal utility, and thus, eliminates the need to produce candidate-specific internal standards.
Physical form
Each vial of SILu™MAb Mouse contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4.
Preparation Note
Produced utilizing enriched media containing stable isotope labeled amino acids such as [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Mouse is designed to be used as a universal internal standard for bioanalysis of monoclonal murine antibodies in animal pharmacokinetics (PK) studies
Reconstitution
SILu™MAb Mouse recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.
Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 µL of ultrapure water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.
Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, biological source mouse recombinant expressed in CHO cells antibody product type primary antibodies assay 90% (SDS-PAGE) packaging vial of 100 µg shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAb Nivolumab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC27-100UG MSQC27-PH General descriptionSILu™MAb Nivolumab (MSQC27) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Nivolumab in human and animal serum.
SILu™MAb Nivolumab is for research use only and is not intended for diagnostic or therapeutic use.
Sequence
SILu™MAb Nivolumab Heavy Chain:
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SILu™MAb Nivolumab Light Chain:
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells assay 90% (HPLC) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™MAb Pembrolizumab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC25-100UG MSQC25-PH General descriptionSILu™MAb Pembrolizumab (MSQC25) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Pembrolizumab in human and animal serum.
SILu™MAb Pembrolizumab is for research use only and is not intended for diagnostic or therapeutic use.
Sequence
SILu™MAb Pembrolizumab Heavy Chain:
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SILu™MAb Pembrolizumab Light Chain:
EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells assay 90% (HPLC) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™MAb Rituximab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC13-PH MSQC13-100UG General descriptionSILu™MAb Rituximab (MSQC13) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Rituximab in human serum.
Sequence
SILuMab Rituximab Heavy Chain:
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILuMab Rituximab Light Chain:
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, recombinant expressed in CHO cells antibody product type primary antibodies assay 90% (SDS-PAGE) form solid packaging vial of 100 µg suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Mab Stable Isotope-Labeled Monoclonal Antibody Glycan Standard Mouse IgG2b MSQC5-100UG
ApplicationPackage size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
SILuMab G is ideal for the qualitative and quantitative analysis of glycoprotein glycans, and can be applied to individual glycans or complex mixtures.
Physical properties
Supplied as a frozen solution in phosphate-buffered saline pH 7.5
SILuMab G is produced by a proprietary process to yield 15N-labeled N-glycans.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыform aqueous solution shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human
NACRES: NA.12
Кат. номер MSQC3-100UG-PW MSQC3-100UG MSQC3-PH General descriptionSILu™Mab is a recombinant, stable isotope-labeled, human monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMab is designed to be used as a universal internal standard for bioanalysis of monoclonal antibodies. Because of overlap with common sequences in the Fc region with candidate antibodies, SILuMab provides universal utility and thus eliminates the need to produce candidate-specific internal standards. SILuMab is an IgG1 antibody with lambda light chain, but contains peptide sequences common to other IgG isotypes.ApplicationSILu™MAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human has been used in a comparative study of automated antibody de novo sequencing.Features and BenefitsUniversal Peptide SequenceLocation
DTLMISRHeavy Chain (IgG1, IgG2, IgG3, IgG4)
FNWYVDGVEVHNAKHeavy Chain (IgG1)
VVSVLTVLHQDWLNGKHeavy Chain (IgG1, IgG3, IgG4)
NQVSLTCLVKHeavy Chain (IgG1, IgG2, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYKHeavy Chain (IgG1, IgG4)
AGVETTTPSKLight Chain (lambda)
YAASSYLSLTPEQWKLight Chain (lambda)
SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.- SILuMab yielded reproducible, linear curves from 0.1 µg/mL to 1000 µg/mL without enrichment or depletion.
- Good agreement was observed between multiple peptides derived from the same target.
- Label incorporation was determined to be >98% by mass spectrometry.
- Sequence coverage was confirmed by peptide mapping.
Physical formSupplied as a lyophilized powder containing phosphate buffered salinePreparation NoteProduced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled arginine and 13C6, 15N2-labeled lysine
SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides universal utility, thus eliminating the need for production of candidate-specific internal standards.ReconstitutionSILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 µL of purified water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.
Analysis NoteSILuMab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILuMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Target overlap areas are underlined
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
Qualitative
Intact heavy and light chains (FASTA file)
Quantitative
MRM settings provided (Skyline, xls)Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 recombinant expressed in CHO cells assay 90% (SDS-PAGE) packaging vial of 100 µg (± 10% Lot-specific vial content given on certificate of analysis) shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™MAb Trastuzumab Stable-Isotope Labeled Monoclonal Antibody
Кат. номер MSQC23-100UG MSQC23-PH General descriptionSILu™MAb Trastuzumab (MSQC23) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Trastuzumab in human serum.
SILu™MAb Trastuzumab is for R&D use only. Not for drug, household, or other uses.
Sequence
SILu™MAb Trastuzumab Heavy Chain:
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Trastuzumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in CHO cells assay 90% (SDS-PAGE) form solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 20°C
Safety InformationWGK Germany WGK 3 Узнать цену -
SILu™Pep C-peptide MSPS004-100UG
Analysis Note
General Description
SILu™Pep C-peptide is a synthetic, stable isotope-labeled human peptide.
Sequence
EAEDLQVGQVELGGGPGAGSLQPLA-Leu(U13C6)-EGS-Leu(U13C6)-Q
Terminal modifications: N-Term: [H] C-Term: [OH]
Length (residues): 31
Label Incorporation
>= 98% as determined by mass spectrometryLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, assay 95% (HPLC) form lyophilized color off-white shipped in ambient storage temp. 20°C
Safety Informationpictograms GHS05 signalword Danger hcodes H314 pcodes P260 - P280 - P301 + P330 + P331 - P303 + P361 + P353 - P304 + P340 + P310 - P305 + P351 + P338 RIDADR UN 3261 8 / PGII WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Pep GLP-1 active MSPS002-100UG
Analysis Note
General Description
SILu™Pep GLP-1 Active is a synthetic, stable isotope-labeled human peptide.
Sequence
HAEGTFTSDVSSY-Leu(U13C6)-EGQAAKEFIAW-Leu(U13C6)-VKGR-NH2
Terminal modifications: N-Term: [H]
Length (residues): 30
Label Incorporation
>= 98% as determined by mass spectrometryLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, assay 95% (HPLC) form lyophilized color off-white shipped in ambient storage temp. 20°C
Safety Informationpictograms GHS05 signalword Danger hcodes H314 pcodes P260 - P280 - P301 + P330 + P331 - P303 + P361 + P353 - P304 + P340 + P310 - P305 + P351 + P338 RIDADR UN 3261 8 / PGII WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Pep Glucagon MSPS001-100UG
Analysis Note
General Description
SILu™Pep Glucagon is a synthetic, stable isotope-labeled human peptide.
Sequence
HSQGTFTSDYSKY-Leu(U13C6)-DSRRAQDFVQW-Leu(U13C6)-MNT
Terminal modifications: N-Term: [H] C-Term: [OH]
Length (residues): 29
Label Incorporation
>= 98% as determined by mass spectrometryLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, assay 95% (HPLC) form lyophilized color off-white shipped in ambient storage temp. 20°C
Safety Informationpictograms GHS05 signalword Danger hcodes H314 pcodes P260 - P280 - P301 + P330 + P331 - P303 + P361 + P353 - P304 + P340 + P310 - P305 + P351 + P338 RIDADR UN 3261 8 / PGII WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Pep Oxyntomodulin MSPS003-100UG
Analysis Note
General Description
SILu™Pep Oxyntomodulin is a synthetic, stable isotope-labeled human peptide.
Sequence
HAEGTFTSDVSSY-Leu(U13C6)-EGQAAKEFIAW-Leu(U13C6)-VKGR-NH2
Terminal modifications: N-Term: [H]
Length (residues): 30
Label Incorporation
>= 98% as determined by mass spectrometryLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, assay 95% (HPLC) form lyophilized color off-white shipped in ambient storage temp. 20°C
Safety Informationpictograms GHS05 signalword Danger hcodes H314 pcodes P260 - P280 - P301 + P330 + P331 - P303 + P361 + P353 - P304 + P340 + P310 - P305 + P351 + P338 RIDADR UN 3261 8 / PGII WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot AKT1,RAC-alpha serine/threonine-protein kinase human
Кат. номер MSST0049-10UG MSST0049-10UG-PW General descriptionSILu™Prot AKT1 is a recombinant, stable isotope-labeled human AKT1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of AKT1 in mass-spectrometry. SILu™Prot TIMP1 is a protein of 501 amino acids (including N-terminal polyhistidine and flag tags), with a calculated molecular mass of 58.8 kDa.
Sequence
MDYKDDDDKGHHHHHHHHGGQMSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Physical form
Supplied as a liquid containing phosphate buffered saline.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 95% (SDS-PAGE) form liquid potency 98% (Heavy amino acids incorporation efficiency by MS) suitability suitable for mass spectrometry (standard) UniProt accession no. P31749, shipped in dry ice storage temp. 20°C Gene Information human ... AKT1 (207)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot AKT2, RAC-beta serine/threonine-protein kinase human
NACRES: NA.12
Кат. номер MSST0051-10UG MSST0051-10UG-PW General descriptionSILu™Prot AKT2 is a recombinant, stable isotope-labeled human AKT2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of AKT2 in mass-spectrometry. SILu™Prot AKT2 is a protein of 502 amino acids (including N-terminal polyhistidine and flag tags), with a calculated molecular mass of 58.9 kDa.
Sequence
MDYKDDDDKGHHHHHHHHGGQMNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
Physical form
Supplied as a liquid containing phosphate buffered saline.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 95% (SDS-PAGE) form liquid potency 98% (Heavy amino acids incorporation efficiency by MS) suitability suitable for mass spectrometry (standard) UniProt accession no. P31751, shipped in dry ice storage temp. 20°C Gene Information human ... AKT2(208)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot AKT3, RAC-gamma serine/threonine-protein kinase human
NACRES: NA.12
Кат. номер MSST0053-10UG MSST0053-10UG-PW General descriptionSILu™Prot AKT3 is a recombinant, stable isotope-labeled human AKT3 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of AKT3 in mass-spectrometry. SILu™Prot SOST is a protein of 500 amino acids (including N-terminal polyhistidine and flag tags), with a calculated molecular mass of 58.9 kDa.
Sequence
MDYKDDDDKGHHHHHHHHGGQMSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Physical form
Supplied as a liquid containing phosphate buffered saline.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 95% (SDS-PAGE) form liquid potency 98% (Heavy amino acids incorporation efficiency by MS) conjugate His tagged suitability suitable for mass spectrometry (standard) UniProt accession no. Q9Y243, shipped in dry ice storage temp. 20°C Gene Information human ... AKT3(10000)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot ALB Albumin human
NACRES: NA.12
Кат. номер MSST0011-10UG MSST0011-10UG-PW General descriptionSILu™Prot ALB is a recombinant, stable isotope-labeled human albumin which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of albumin in mass-spectrometry. SILu™Prot ALB is a monomer of 607 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~69 kDa.
Biochem/physiol Actions
Albumin is synthesized exclusively by the liver parenchymal cells at a rate of 14 g/day. While it is the most abundant plasma protein (>50%), increased urine albumin concentrations indicate bleedings in the lower urinary tract (ureter, bladder) or infections of the renal pelvis. A small abnormal albumin excretion is known as Microalbuminuria and serves as an indicator for temporary overload of the glomerular filtration (fever, excessive sports) or chronic injury of the glomeruli (diabetes).
Sequence
RRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLDYKDDDDKGHHHHHHHHGGQ
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder potency 98% Heavy amino acids incorporation efficiency by MS application(s) mass spectrometry (MS): suitable conjugate His tagged suitability suitable for mass spectrometry (standard) UniProt accession no. P02768, storage temp. 20°C Gene Information human ... ALB(213)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot AMBP Alpha-1 Microglycoprotein human
NACRES: NA.12
Кат. номер MSST0013-10UG MSST0013-10UG-PW General descriptionSILu™ Prot AMBP is a recombinant, stable isotope-labeled human AMBP which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of AMBP in mass-spectrometry. SILu™ Prot AMBP is a monomer of 204 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~23 kDa.
Biochem/physiol Actions
AMBP is synthesized by the liver, with approximately half of the circulating protein complexed to IgA. The free form is readily filtered by the glomerulus and reabsorbed by proximal tubule cells. AMBP has been found to be a sensitive biomarker for proximal tubular dysfunction even in the early phase of injury when no histologic damage is observable. In addition, urinary AMBP has been proposed to be a useful marker of tubular dysfunction even in low-gestational-age preterm infants, a population at high risk for AKI (Acute Kidney Injury).
Sequence
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVDYKDDDDKGHHHHHHHHGGQ
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder potency 98% Heavy amino acids incorporation efficiency by MS application(s) mass spectrometry (MS): suitable conjugate His tagged suitability suitable for mass spectrometry (standard) UniProt accession no. P02760, storage temp. 20°C Gene Information human ... AMBP(259)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot APOA1, Apolipoprotein A-1 human
Кат. номер MSST0001-10UG MSST0001-10UG-PW General descriptionApoA-1 (apolipoprotein A-1) is a 29.0kDa protein produced in the liver and intestine, and secreted as the predominant constituent of nascent high-density lipoprotein (HDL) particle. BP- ApoA-1 (apolipoprotein A-1), which is found exclusively in HDL (high-density lipoprotein), has a unique ability to capture and solubilize free cholesterol. This apoA-1 ability enables HDL to remove excess peripheral cholesterol and return it to the liver for recycling and excretion. The therapeutic potential of apoA-1 has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-1 (called apoA-1 Milano). The availability of recombinant normal apoA-1 should facilitate further investigation into the potential usefulness of apoA-1 in preventing atherosclerotic vascular diseases. Changes in the level of serum apoA-1 may serve as a prognostic marker for non-metastatic nasopharyngeal carcinoma. Low levels of apoA-1 in the plasma are linked to hyperhomocysteinemia.ApplicationPosters:
Characterization of Heavy Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows,
Characterization of stable isotope labeled APO-A1 for use as an internal standard in a quantitative MS workflow,
Characterization of Clinically-Relevant Stable Isotope Labeled Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows,
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Preparation Note
Briefly centrifuge the vial before opening. It is recommended to reconstitute the protein in sterile ultrapure water to a final concentration of 100μg/ml.
Storage and Stability
Store the lyophilized product at –20 oC. The product is stable for at least 2 years as supplied. After reconstitution, it is recommended to store the protein in working aliquots at –20 oC.
Analysis NoteGeneral descriptionSILu™Prot ApoA is a recombinant, stable isotope-labeled human Apo A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of ApoA1 in mass-spectrometry. SILu Prot Apo A- is a monomer of 280 amino acids (including C-terminal polyhistidine and V5 tags), with an apparent molecular weight of 32.3 kDa.
Sequence
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLK
LLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKV
QPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEM
RDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK
AKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQSDPSRGPFEGK
PIPNPLLGLDSTRTGHHHHHHHHGGQ
The N-terminal signal peptide and C-terminal linker peptide, V5 and polyhistidine tags are italicized. Suggested transitions for three peptides (bolded) are used for selected reaction monitoring analysis (SRM).
Label Incorporation
98% as determined by mass spectrometry
Other Characterization- Sequence confirmed by intact mass analysis
- Identity verified by peptide mapping
- Purity >98% by SDS-PAGE
- Vial content was determined by the Bradford method using BSA as a calibrator. The correction factor of Bradford-to-AAA is 88.33%
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides,)Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder packaging vial of 10-13 µg (Lot-specific vial content given on certificate of analysis) application(s) mass spectrometry (MS): suitable conjugate His tagged","V5 tagged UniProt accession no. P02647, storage temp. 20°C Gene Information human ... APOA1(335)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot APOA2 Apolipoprotein A-II human
NACRES: NA.12
Кат. номер MSST0029-10UG MSST0029-10UG-PW General descriptionApolipoprotein A-II (ApoA-II) occurs in plasma as a dimer of two 77-amino acid chains linked by a disulfide bridge. After apoA-I, it is the second major protein component of HDL, accounting for approximately 20% of HDL total protein. ApoA-II is thought to play an important role in triglyceride metabolism both from animal and human studies. 3 Recent findings attribute apoA-II to inhibitory effects on lipoprotein lipase-mediated hydrolysis of triglyceride-rich particles. Additional associations of apoA-II have been reported for a variety of protein factors including hepatic lipase (HL), lipoprotein lipase (LPL), endothelial lipase, CETP, PLTP, and LCAT.ImmunogenQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQDYKDDDDKGHHHHHHHHGGQ
Biochem/physiol Actions
SILu™ Prot APOA2 is a recombinant, stable isotope-labeled human APOA2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N4]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of APOA2 in mass-spectrometry. SILu Prot APOA2 is a homodimer of 97 amino acids (including C-terminal polyhistidine and FLAG® tags), with a calculated molecular mass of 11 kDa.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
FLAG is a registered trademark of Sigma-Aldrich Co. LLC
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder potency 98% Heavy amino acids incorporation efficiency by MS application(s) mass spectrometry (MS): suitable conjugate 8-His tagged suitability suitable for mass spectrometry (standard) UniProt accession no. P02652, storage temp. 20°C Gene Information human ... APOA2(336)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot APOD, Apolipoprotein D human
NACRES: NA.32
Кат. номер MSST0061-10UG MSST0061-10UG-PW General descriptionSILu™Prot APOD is a recombinant, stable isotope-labeled human APOD which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of APOD in mass-spectrometry. SILu™Prot APOD is a protein of 189 amino acids (including a C-terminal polyhistidine and tag), with a calculated molecular mass of 21.8 kDa.
Biochem/physiol Actions
Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.
Sequence
QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыrecombinant expressed in HEK 293 cells Quality Level 200 assay 95% (SDS-PAGE) form lyophilized powder potency 98% (Heavy amino acids incorporation efficiency by MS) suitability suitable for mass spectrometry (standard) UniProt accession no. P05090, shipped in ambient storage temp. 20°C Gene Information human ... APOD(347)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot B2M beta-2-microglobulin human
NACRES: NA.12
Кат. номер MSST0015-10UG MSST0015-10UG-PW General descriptionSILu™ Prot B2M is a recombinant, stable isotope-labeled human B2M which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of B2M in mass-spectrometry. SILu™ Prot B2M is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides,)
Biochem/physiol Actions
B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).
Sequence
IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human recombinant expressed in HEK 293 cells assay 98% (SDS-PAGE) form lyophilized powder potency 98% Heavy amino acids incorporation efficiency by MS application(s) mass spectrometry (MS): suitable suitability suitable for mass spectrometry (standard) UniProt accession no. P61769, storage temp. 20°C Gene Information human ... B2M(567)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Prot CCL2 C-C motif chemokine 2 human
NACRES: NA.12
Кат. номер MSST0035-10UG MSST0035-10UG-PW General descriptionCCL2, the most thoroughly characterized CC chemokine, is a monocyte-specific chemoattractant that was demonstrated to attract T lymphocytes and NK cells, but not neutrophils. Enhanced expression of CCL2 was demonstrated in a variety of pathologic conditions, associated with inflammation and mononuclear cell infiltration. Extensive experimental evidence suggests that CCL2 is highly expressed in atherosclerotic plaques. In a recent study, CCL2 was shown to have value as a biomarker for risk stratification in both the initial and the chronic phases after an acute coronary syndromes (ACS). In contrast to CRP, CCL2 levels may be an indicator of long-term cardiovascular risk rather than a marker of acute prognosis. In urine, CCL2 levels were directly associated to Systemic Lupus Erythematosus disease activity, making it a non-invasive biomarker (avoiding blood sampling or tissue biopsies).ImmunogenQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKTDYKDDDDKGHHHHHHHHGGQ
Biochem/physiol Actions
SILu™Prot CCL2 is a recombinant, stable isotope-labeled human CCL2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of CCL2 in mass-spectrometry. SILu Prot CCL2 is a homodimer consisting of 96 amino acids (including C-terminal polyhistidine and FLAG® tags), with a calculated molecular mass of 11 kDa.
Physical form
Lyophilized from a solution of phosphate buffered saline.Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
FLAG is a registered trademark of Sigma-Aldrich Co. LLC
SILu is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200 biological source human assay 98% (SDS-PAGE) form lyophilized powder potency 98% Heavy amino acids incorporation efficiency by MS application(s) mass spectrometry (MS): suitable suitability suitable for mass spectrometry (standard) UniProt accession no. P13500, storage temp. 20°C Gene Information human ... CCL2(6347)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
