Small Pack Antibodies

KLH-conjugated linear peptide corresponding to 12 amino acids from the C-terminal region of human Musculoskeletal embryonic nuclear protein 1.
Epitope: C-terminus

Research Category
Cell Structure
Western Blotting Analysis: 2 µg/mL from a representative lot detected MUSTN1 in human heart tissue lysate.
Immunohistochemistry Analysis: A 1:250-1,000 dilution from a representative lot detected MUSTN1 in human skeletal muscle, mouse embryo, and mouse embryonic lung tissues.
Western Blotting Analysis: 2 µg/mL from a representative lot detected MUSTN1 in human heart tissue lysate.
Immunohistochemistry Analysis: A 1:250-1,000 dilution from a representative lot detected MUSTN1 in human skeletal muscle, mouse embryo, and mouse embryonic lung tissues.
Anti-MUSTN1, Cat. No. ABD115, is a rabbit polyclonal antibody that detects human and murine Musculoskeletal embryonic nuclear protein 1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in C2C12 cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected MUSTN1 in C2C12 cell lysate.
Target description
~13 kDa observed; 8.91 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine, 0.15 M NaCl, pH7.4 with 0.05% sodium azide.
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine, 0.15 M NaCl, pH7.4 with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Stable for 1 year at 2-8°C from date of receipt.

Concentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human, mouse
species reactivity (predicted by homology)	rat (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG
NCBI accession no.	NP_995325.3,
UniProt accession no.	Q8IVN3,
shipped in	ambient
Gene Information	human ... MUSTN1(389125)

Human Protein Atlas Number:

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-MYBL2 antibody produced in rabbit

HPA030530 Human Protein Atlas characterization data

v-myb avian myeloblastosis viral oncogene homolog-like 2

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78055,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: 1:50-1:200
immunogen sequence	NALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSL
conjugate	unconjugated
UniProt accession no.	P10244,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MYBL2(4605)

Epitope tags are useful for the labeling and detection of proteins using immunoblotting, immunoprecipitation and immunostaining techniques. Due to their small size, they are unlikely to affect the tagged protein′s biochemical properties. The Myc epitope tag is widely used to detect expression of recombinant proteins in bacteria, yeast, insect and mammalian cell systems.
Specificity
Other species cross-reactivity not tested.
Recognizes and is specific for human Myc and recombinant proteins containing the Myc epitope tag.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Myc Tag Antibody

eCl@ss:	32160702
NACRES:	NA.43

Synthetic peptide corresponding to residues 409-420 of human Myc (MEQKLISEEDLN).
Epitope: a.a. 409-420

Research Category
Epitope Tags & General Use
Research Sub Category
Epitope Tags
Anti-Myc Tag Antibody is an antibody against Myc Tag for use in IC & WB.
Immunocytochemistry:
This antibody is reported to detect Myc-tagged proteins in transfected cells.
Quality
Evaluated by Western Blot on Myc-PP2A A subunit transfected NIH/3T3 lysates.
Western Blotting:
1:500 dilution of this antibody detected myc-PP2A on 10 µg of Myc-PP2A A subunit transfected NIH/3T3 lysates.
Target description
Predicted molecular weight for human Myc: 49 kDa Obeserved molecular weight may vary.
Physical form
Format: Purified
Protein A chromatography
Purified rabbit in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl with 0.05% sodium azide. Frozen solution.
Storage and Stability
Stable for 1 year at -20ºC from date of receipt.
Analysis Note
Control
Positive control for human Myc: widespread expression including A431 cell lysate, ovarian cancer cell lysate, or breast carcinoma tissue. Myc fusion protein expressed in cells.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Epitope tags are useful for the labeling and detection of proteins using immunoblotting, immunoprecipitation and immunostaining techniques. Due to their small size, they are unlikely to affect the tagged proteins biochemical properties.
The Myc epitope tag is widely used to detect expression of recombinant proteins in bacteria, yeast, insect and mammalian cell systems.
Specificity
Recognizes recombinant proteins containing the Myc epitope tag (EQKLISEEDL) in a variety of sequence contexts; also recognizes human Myc.

biological source	rabbit
Quality Level	100
antibody form	purified antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
packaging	antibody small pack of 25 µg
Торговая марка	Upstate^®
application(s)	immunocytochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NM_002467.3,
UniProt accession no.	P01106,
shipped in	dry ice

Узнать цену

Подробнее

Anti-Myc Tag Antibody, clone 4A6

peptide corresponding to amino acids 410-420 (MEQKLISEEDL) of human Myc

This Anti-Myc Tag Antibody, clone 4A6 is validated for use in ChIP, IC, IF, IP, WB for the detection of Myc Tag. This antibody has been cited in more than 25 published papers.
Research Category
Epitope Tags & General Use
Research Sub Category
Epitope Tags
Quality
routinely evaluated by immunoblot on Myc-tagged recombinant protein in sequence contexts not well recognized by anti-Myc Tag, clone 9E10 (Catalogue No. CBL430)
Target description
Predicted MW for human Myc: 49 kDa
Physical form
Protein G Purified
Format: Purified
Protein A Purified immunoglobulin in 0.1M Tris-Glycine, 0.15M NaCl, 0.05 Sodium Azide, pH 7.4.
Storage and Stability
Maintain at 2 to 8°C for 1 year from date of shipment.
Analysis Note
Control
Positive control for human Myc: Widespread expression including A431 cell lysate, ovarian cancer cell lysate, or breast carcinoma tissue. Myc fusion protein expressed in cells.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Myelin basic protein (UniProt: also known as MBP) is encoded by the MBP gene in guinea pig. MBP is a homodimeric protein that is found in both the central and the peripheral nervous system. It is one of the most abundant protein component of the myelin membrane in the CNS and plays a role in both the formation and stabilization of this myelin membrane. It is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin. At least 5 charge isomers (C1, C2, C3, C4, and C5) are reported to be produced because of optional post-translational modifications such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. Of these C1 isomer is the most cationic, least modified, and most abundant form and C5 is the least cationic form. C1 and C2 are reported to be unphosphorylated, C3 and C4 are monophosphorylated, and C5 is phosphorylated at two positions. Phosphorylation is achieved with the help of TAOK2, VRK2, MAPK11, MAPK12, MAPK14, and MINK1). MBP can interact with many polyanionic proteins including actin, tubulin, calmodulin, and clathrin, and with negatively charged lipids. (Ref.: Boggs, JM (2006). Cell. Mol. Life Sci. 63(17); 1945-61).
Specificity
This rabbit polyclonal antibody detects myelin basic protein. It targets an epitope within 19 amino acids from the internal region.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	4A6, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
Торговая марка	Upstate^®
application(s)	ChIP: suitable (ChIP-seq)","immunocytochemistry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NM_002467.3,
UniProt accession no.	P01106,
shipped in	ambient

Узнать цену

Подробнее

Anti-Myelin Basic Protein

KLH-conjugated linear peptide corresponding to 19 amino acids from the internal region of Guinea pig myelin basic protein.

Anti-Myelin Basic Protein Antibody, Cat. No. ABN912, is a highly specific rabbit polyclonal antibody that targets Myelin basic protein and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Myelin Basic Protein in human cerebral cortex and rat cerebellum tissue sections.
Quality
Evaluated by Western Blotting in human cerebellum tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Myelin Basic Protein in human cerebellum tissue lysate.
Target description
~17 kDa observed; 18.21 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Specificity
Myelin basic protein [MBP]. By Western blot the antibody recognizes a band at ~14-18 kDa on human brain lysate and ~14-18 kDa on recombinant MBP. An additional band at ~65 kDa may be seen depending on sample and antibody concentration used.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human, rat
species reactivity (predicted by homology)	guinea pig (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
UniProt accession no.	P25188,

Узнать цену

Подробнее

Anti-Myelin Basic protein Antibody

eCl@ss:	32160702
NACRES:	NA.41

Кат. номер

AB15542

AB15542-25UL

Recombinant MBP.

Research Category
Neuroscience
Research Sub Category
Neuronal & Glial Markers
Neurochemistry & Neurotrophins
Western blot: 1:1,000-1:2,000 using recombinant MBP and 1:5,000-1:10,000 using human brain lysate.
Optimal working dilutions must be determined by end user.
Detect Myelin Basic protein using this Anti-Myelin Basic protein Antibody validated for use in WB.
Quality
Tested
Physical form
Serum
Liquid.
Storage and Stability
Maintain at -20°C in undiluted aliquots for up to 6 months after date of receipt. Avoid repeated freeze/thaw cycles.

feature_concentration_valuePlease refer to lot specific datasheet.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Myosin-1 (UniProt: Q5SX40; also known as Myosin heavy chain 1, Myosin heavy chain 2x, MyHC-2x, Myosin heavy chain, skeletal muscle, adult 1) is encoded by the Myh1 gene (Gene ID: 17879) in murine species. Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular sub-fragments (S1) and 1 rod-shaped sub-fragment (S2). In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and non-muscle cells. These isoforms show expression that is spatially and temporally regulated during development. Myosin-1 contains an N-terminal SH3-like domain (aa 33-82), a myosin motor domain (aa 86-785), and an IQ domain (aa 788-817). It also contains 2 actin binding regions (aa 662-684 and 764-778).
Specificity
Clone 6F12H3 is a rat monoclonal antibody that detects Myosin-1 in mouse and rat muscles. It target an epitope within the coiled coil domain in the C-terminal half.

biological source	rabbit
Quality Level	100
antibody form	serum
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
packaging	antibody small pack of 25 µL
Торговая марка	Chemicon^®
application(s)	western blot: suitable
NCBI accession no.	NM_001025081.1,","NM_001025090.1,","NM_001025092.1,","NM_001025094.1,","NM_001025098.1,","NM_001025100.1,","NM_001025101.1,","NM_002385.2,
UniProt accession no.	P02686,
shipped in	dry ice
storage temp.	20°C

Узнать цену

Подробнее

Anti-MYH-1 Antibody, clone 6F12H3

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 29 amino acids from the C-terminal half of murine Myosin-1.

Research Category
Cell Structure
Anti-MYH-1, clone 6F12H3, Cat. No. MABT846, is a rat monoclonal antibody that detects Myosin-1 and has been tested for use in Immunofluorescence. Immunohistochemistry, and Western Blotting.
Immunohistochemistry Analysis: A 1:25 dilution from a representative lot detected MYH-1 in mouse heart and mouse skeletal muscle tissue.
Immunofluorescence Analysis: A representative lot detected MYH-1 in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected MYH-1 in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunohistochemistry Analysis: A representative lot detected MYH-1 in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MYH-1 in mouse soleus muscle tissue lysates.
Target description
~220 kDa observed; 223.34 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	6F12H3, monoclonal
species reactivity	rat, mouse
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_109604,
UniProt accession no.	Q5SX40,

Myosin-2 (UniProt: Q9UKX2; also known as Myosin heavy chain 2, Myosin heavy chain 2a, MyHC-2a, Myosin heavy chain IIa, MyHC-IIa, Myosin heavy chain, skeletal muscle, adult 2) is encoded by the MYH2 (also known as MYHSA2) gene (Gene ID: 4620) in human. Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular sub-fragments (S1) and 1 rod-shaped sub-fragment (S2). In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and non-muscle cells. These isoforms show expression that is spatially and temporally regulated during development. Myosin-2 contains an N-terminal SH3-like domain (aa 33-82), a myosin motor domain (aa 86-784), and an IQ domain (aa 787-816). It also contains 2 actin binding regions (aa 661-683 and 763-777). Mutations in MYH2 gene are known to cause Proximal myopathy and ophthalmoplegia (MYPOP), a muscular disorder characterized by mild-to-moderate muscle weakness and predominance of type 1 fibers and small or absent type 2A fibers.
Specificity
Clone 8F72C8 is a rat monoclonal antibody that detects Myosin-2 in mouse and rat muscle. It targets an epitope within 29 amino acids from the C-terminal half.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MYH-2 Antibody, clone 8F72C8

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 29 amino acids from the C-terminal half of human Myosin-2

Anti-MYH-2, clone 8F72C8, Cat. No. MABT848, is a rat monoclonal antibody that detects Myosin-2 and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected MYH-2 in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected MYH-2 in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunofluorescence Analysis: A representative lot detected MYH-2 in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunohistochemistry Analysis: A 1:25 dilution from a representative lot detected MYH-2 in mouse heart and mouse skeletal muscle tissues.
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MYH-2 in mouse soleus muscle tissue lysate.
Target description
~220 kDa observed; 223.04 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	8F72C8, monoclonal
species reactivity	rat
species reactivity (predicted by homology)	human (based on 100% sequence homology), mouse
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_001093582,
UniProt accession no.	Q9UKX2,

Myosin-4 (UniProt: Q5SX39; also known as Myosin heavy chain 2b, MyHC-2B, Myosin heavy chain 4) is encoded by the Myh4 gene (Gene ID: 17884) in murine species. Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular sub-fragments (S1) and 1 rod-shaped sub-fragment (S2). In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and non-muscle cells. These isoforms show expression that is spatially and temporally regulated during development. Myosin-4 contains an N-terminal SH3-like domain (aa 33-82), a myosin motor domain (aa 86-782), and an IQ domain (aa 785-814). It also contains 2 actin binding regions (aa 659-681 and 761-775).
Specificity
Clone 2G72F10 is a rat monoclonal antibody that detects Myosin-4 in mouse and rat muscles. It targets an epitope within 29 amino acids from the C-terminal half.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MYH-4 Antibody, clone 2G72F10

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 29 amino acids from the C-terminal half of murine Myosin-4.

Research Category
Cell Structure
Anti-MYH-4, clone 2G72F10, Cat. No. MABT847, is a rat monoclonal antibody that detects Myosin-4 and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected MYH-4 in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected MYH-4 in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunofluorescence Analysis: A representative lot detected MYH-4 in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunohistochemistry Analysis: A 1:25 dilution from a representative lot detected MYH-4 in mouse heart and mouse skeletal muscle tissues.
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MYH-4 in mouse soleus muscle tissue lysate.
Target description
~220 kDa observed; 222.86 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	2G72F10, monoclonal
species reactivity	rat, mouse
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_034985,
UniProt accession no.	Q5SX39,

Human Protein Atlas Number:

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MYO18B antibody produced in rabbit

HPA000953 Human Protein Atlas characterization data

Myosin-XVIIIb recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Myosin-XVIIIb is a protein encoded by the MYO18B gene in humans. It is located on chromosome 22q12.1. The gene is may function as a tumor suppressor and its inactivation is involved in lung cancer progression. It is expressed mainly in human cardiac and skeletal muscles and, at lower levels, in testis. It can be used for the treatment of locally advanced malignant pleural mesothelioma (MPM) in humans. Alterations in this gene include both epigenetic and genetic alterations and play an important role in ovarian carcinogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73434,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL
immunogen sequence	GSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKY
conjugate	unconjugated
UniProt accession no.	Q8IUG5,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MYO18B(84700)

Myomesin-2 (UniProt: P54296; also known as 165 kDa connectin-associated protein, 165 kDa titin-associated protein, M-protein, Myomesin family member 2) is encoded by the MYOM2 gene (Gene ID: 9172) in human. Myomesin-2 is a major component of the vertebrate myofibrillar M band and is mainly expressed in fast fibers. It binds myosin, titin, and light meromyosin in a dose-dependent manner. Its primary function is to upkeep M-band filament lattice. It has a unique N-terminal domain followed by 12 repeat domains with strong homology to either fibronectin type III or immunoglobulin C2 domains. Myomesin-2 is shown to interact with dysferlin, a protein that aids in repairing the sarcolemma when it is damaged or torn due to muscle strain and assists in myofibril stability.
Specificity
Clone 3B9.3 detects human muscle Myomesin-2. It targets an epitope with in the N-terminal half.

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Myomesin-2 Antibody, clone 3B9.3

eCl@ss:	32160702
NACRES:	NA.41

GST-tagged recombinant fragment corresponding to 154 amino acids from the N-terminal region of human Myomesin-2.

Research Category
Cell Structure
Anti-Myomesin-2, clone 3B9.3, Cat. No. MABT94, is a mouse monoclonal antibody that detects human Myomesin-2 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in human skeletal muscle tissue lysate.
Western Blotting Analysis: 0.05 µg/mL of this antibody detected Myomesin-2 in human skeletal muscle tissue lysate.
Target description
~165 kDa observed; 164.90 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Localizes an epitope on the myosin heavy chain. Stains the fast (type II) and neonatal isomyosin molecules found in skeletal muscle, but does not stain cardiac muscle, smooth muscle or non-muscle myosin in cultured cells. Does react with human rhabdomyosarcomas.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	3B9.3, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_003961,
UniProt accession no.	P54296,

Узнать цену

Подробнее

Anti-Myosin (Skeletal, Fast) antibody, Mouse monoclonal

MDL number:	MFCD00145920
NACRES:	NA.41

rabbit muscle myosin.

The level of mysosin (fast) in serum samples from sportsmen with past injury was determined by western blot using monoclonal mouse anti-myosin (skeletal/fast) as the primary antibody at a dilution of 1:90000.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	MY-32, monoclonal
form	buffered aqueous solution
species reactivity	chicken, rabbit, feline, mouse, rat, bovine, human, guinea pig
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): 10-20 µg/mL using porcine tongue","microarray: suitable","western blot: 0.5-1.0 µg/mL using total extract of rabbit skeletal muscle
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	P12882,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... MYH1(4619), MYH2(4620) mouse ... Myh1(17879), Myh2(17882) rat ... Myh1(287408), Myh2(691644)

Myosin-7 (UniProt: Q91Z83; also known as Myosin heavy chain 7, Myosin heavy chain slow isoform, MyHC-slow, Myosin heavy chain, cardiac muscle beta isoform, MyHC-beta) is encoded by the MYH7 gene (Gene ID: 140781) in murine species. Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Myosins form regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle. Myosin-7 is a component of thick filaments of the myofibrils. It contains actin- and ATP-binding sites in its conserved catalytic head domain. Its actin binding region is localized to amino acids 655-677 and 757-771 and the ATP-binding region is localized to amino acids 178-185. Myosin-7 has an N-terminal SH3-like domain (aa 32-81), a myosin motor domain (aa 85-778), and an IQ domain (aa 781-810). Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces one light meromyosin (LMM) and one heavy meromyosin (HMM). HMM can be further cleaved into two globular sub fragments (S1) and 1 rod-shaped sub fragment (S2).
Specificity
Clone 4B51E8 is a rat monoclonal antibody that detects murine Myosin-7. It targets an epitope within 39 amino acids from the C-terminall half.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Узнать цену

Подробнее

Anti-Myosin 7 (MYH7) Antibody, clone 4B51E8

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 39 amino acids from the C-terminal region of murine Mysoin-7.

Anti-Myosin 7 (MYH7), clone 4B51E8, Cat. No. MABT849, is a rat monoclonal antibody that detects Mysoin-7 and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:25 dilution from a representative lot detected Myosin 7 (MYH7) in mouse skeletal muscle tissue.
Immunohistochemistry Analysis: A representative lot detected Myosin 7 (MYH7) in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunofluorescence Analysis: A representative lot detected Myosin 7 (MYH7) in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected Myosin 7 (MYH7) in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: 2 µg/mL from a representative lot detected Myosin 7 (MYH7) in mouse soleus muscle tissue lysate.
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse heart tissue.
Immunohistochemistry (Paraffin) Analysis: A 1:25 dilution of this antibody detected Myosin 7 (MYH7) in mouse heart tissue.
Target description
222.88 kDa calculated.
Physical form
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from the date of receipt.

Concentration: Please refer to lot specific datasheet.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	4B51E8, monoclonal
species reactivity	mouse
species reactivity (predicted by homology)	rat (based on 100% sequence homology), human (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
UniProt accession no.	Q91Z83,

Myosin-7 (UniProt: Q9BE39; also known as Myosin heavy chain 7, Myosin heavy chain slow isoform, MyHC-slow, Myosin heavy chain, cardiac muscle beta isoform, MyHC-beta) is encoded by the MYH7 gene (Gene ID: 282714) in bovine species. Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Myosins form regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle. Myosin-7 is a component of thick filaments of the myofibrils. It contains actin- and ATP-binding sites in its conserved catalytic head domain. Its actin binding region is localized to amino acids 655-677 and 757-771 and the ATP-binding region is localized to amino acids 178-185. Myosin-7 has an N-terminal SH3-like domain (aa 32-81), a myosin motor domain (aa 85-778), and an IQ domain (aa 781-810). Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces one light meromyosin (LMM) and one heavy meromyosin (HMM). HMM can be further cleaved into two globular sub fragments (S1) and 1 rod-shaped sub fragment (S2).
Specificity
Clone BA-D5 detects Myosin-7 in multiple mammalian species. It detects both alpha- and beta-slow myosin heavy chain.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Myosin 7 (MYH7) Antibody, clone BA-D5

Purified myosin from bovine atrium.

Research Category
Cell Structure
Immunohistochemistry Analysis: A representative lot detected Myosin 7 (MYH7) in Immunohistochemistry applications (Goh, Q., et. al. (2017). Elife. 6. pii: e20007).
Western Blotting Analysis: A representative lot detected Myosin 7 (MYH7) in Western Blotting applications (De Jong, A., et. al. (2017). PLoS One. 12(3):e0174043; Gan, Z., et. al. (2013). J Clin Invest. 123(6):2564-75).
Immunofluorescence Analysis: A representative lot detected Myosin 7 (MYH7) in Immunofluorescence applications (Gan, Z., et. al. (2013). J Clin Invest. 123(6):2564-75; Pannerec, A., et. al. (2016). Aging (Albany NY). 8(4):712-29).
Anti-Myosin 7 (MYH7), clone BA-D5, Cat. No. MABT838, is a mouse monoclonal antibody that detects Myosin-7 and has been tested for use in Immunofluorescence, Immunohistochemistry, and Western Blotting.
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 4 µg/mL of this antibody detected Myosin 7 (MYH7) in mouse soleus muscle tissue lysate.
Target description
~220 kDa observed; 223.23 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	BA-D5, monoclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_777152,
UniProt accession no.	Q9BE39,

Myosin heavy chain 9 (MYH9) gene codes for the nonmuscle myosin heavy chain IIA.
Myosin heavy chain 9 is expressed in platelets and the gene encoding it is localized on chromosome 22.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Myosin IIA, non muscle antibody produced in rabbit

MDL number:	MFCD03455610
NACRES:	NA.41

synthetic peptide corresponding to amino acids 1949-1960 of human nonmuscle myosin IIA.

Anti-Myosin IIA, non muscle antibody produced in rabbit has been used in:

immunofluorescence
immunohistochemistry
fixed cell staining/ immunofluorescence staining
immunoblot
immunoprecipitation

Biochem/physiol Actions
Nonmuscle myosin II is involved in cell motility and adhesion, cytokinesis, vesicular transport, intracellular force generation and in morphogenesis during development. Its activity is regulated by light chain and possibly heavy chain phosphorylation and by association with proteins such as Mts1. Mutations in the NMHCA gene are found in several syndromes associated with megakaryocyte/platelet/leukocyte disorders. Mutations in the MYH9 gene causes a spectrum of macrothrombocytopenia disorders with neutrophil inclusions, termed as MYH9 disorders.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% BSA and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~200 kDa
species reactivity	human, rat, canine
packaging	antibody small pack of 25 µL
application(s)	indirect immunofluorescence: 1:100 using cultured rat NRK cells","microarray: suitable","western blot: 1:1,000 using whole cell extracts of cultured dog MDCK kidney cells and cultured human Jurkat cells
conjugate	unconjugated
UniProt accession no.	P35579,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... MYH9(4627) rat ... Myh9(25745)

Myosin Light Chain Kinase (MLCK) also known as MYLK is a Ca2+/calmodulin dependent myosin light chain phosphorylating agent. This enzyme plays a major role in the phosphorylation of the regulatory light chains of myosin which are essential for the shortening and tension development of smooth muscle cells resulting in smooth muscle contraction. Myosin light chain kinase are widely expressed in many different tissues and cells of eukaryote species. There are two genes mylk1 and mylk2 encoding the MLCK protein, mylk2 is exclusively expressed in skeletal muscle cells.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Myosin Light Chain Kinase antibody, Mouse monoclonal

Purified chicken gizzard myosin light chain kinase.

Monoclonal Anti-Myosin Light Chain Kinase recognizes the myosin light chain kinase of smooth muscle and from non-muscle cells such as cultured fibroblasts. Reactivity has been observed with myosin light chain kinase from chicken, turkey, bovine, human, mouseand pig origin. The antibody is recommended to use in various immunological techniques, including Immunoblotting (~160kDa), Immunohistochemistry and immunofluorescence.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.

This product is for R&D use only, not for drug, household, or other uses.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	K36, monoclonal
form	buffered aqueous solution
mol wt	~160 kDa
species reactivity	turkey, bovine, pig, mouse, chicken, human
packaging	antibody small pack of 25 µL
concentration	~1 mg/mL
application(s)	immunoblotting: 0.25-0.5 µg/mL using chicken gizzard extract
isotype	IgG2b
UniProt accession no.	Q15746,
shipped in	dry ice
storage temp.	20°C

Cadherin-2 (UniProt P19022; also known as CD325, CDw325, N-cadherin, Neural cadherin) is encoded by the CDH2 (also known as CDHN, NCAD) gene (Gene ID 1000) in human. Cadherins constitute a family of calcium-dependent cell-cell adhesion proteins that play important roles in the embryonic development and maintenance of normal tissue architecture. Cadherins are composed of an extracellular domain (a.a. 160-724 of human N-cadherin) with five homologous repeats that mediates adhesion, a single pass transmembrane domain (a.a. 725-745 of human N-cadherin), and a conserved cytoplasmic domain (a.a. 746-906 of human N-cadherin) that interacts with catenins to link cadherins to the actin cytoskeleton. In addition, a known Src substrate p120ctn also modulate the strength of cadherin-dependent adhesion by interacting with cadherins at their intracellular juxtamembrane domain. Cadherins are synthesized as precursor proteins that must be proteolytically cleaved to generate functional, mature proteins. Newly synthesized proN-cadherin (a.a. 1-906) is phosphorylated and proteolytically processed prior to transport to the plasma membrane. In addition, Plakoglobin (gamma-catenin) and beta-catenin associate only with phosphorylated proN-cadherin, whereas p120ctn can associate with both phosphorylated and non-phosphorylated proN-cadherin. The N-terminal signal and propeptide (a.a. 1-25 and 26-159 of of human N-cadherin) region is proteolytically removed and a core N-cadherin-catenin complex is assembled in the endoplasmic reticulum or Golgi compartment prior to localization at the plasma membrane where linkage to the actin cytoskeleton can be established.
Specificity
Clone 13A9 recognizes N-cadherin, but not P-, E-, or M-cadherin (Knudsen, K.A., et al. (1995). J. Cell Biol. 130(1):67-77).

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-N-Cadherin Antibody, clone 13A9

Epitope: Cytoplasmic domain.
Bacterially expressed human N-cadherin cytoplasmic domain MBP fusion protein (Knudsen, K.A., et al. (1995). J. Cell Biol. 130(1):67-77).

Replaces: 04-1126
Physical form
Mouse monoclonal immunoglobulin hybridoma culture supernatant containing 0.05% sodium azide before the addition of glycerol to 30%.
Unpurified
Storage and Stability
Maintain for 2 years at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
HeLa cell lysate

antibody product type

antibody small pack of 25 µL

Торговая марка

Upstate^®

application(s)

immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable

NCBI accession no.

Na+/K+ ATPase α-1 is a human gene and functions to maintain Na+ and K+ across the cell membrane which is important for osmoregulation. It is a component of (Na+/K+) ATPase, a transporter that catalyzes the hydrolysis of ATP and transports sodium and potassium ions across the plasma membrane. It also partners with Src and other signaling proteins. Binding of ouabain and other cardiotonic steroids to the (Na+/K+) ATPase activates Src, resulting in the assembly and activation of multiple signaling cascades. Binding of ouabain also induces a positive inotropic effect. Diseases associated with ATPase are Thyrotoxic periodic paralysis and hyperthyroidism. (References: Wikipedia and http://www.bioportfolio.com/gene/476-ATP1A1.html)
Specificity
Expected to cross-react with Rat-100%, Mouse-99%; human, pig, rabbit, monkey-96%.
Recognizes the -1 subunit isoform of Na+/K+ ATPase.

Anti-Na+/K+ ATPase -1 Antibody

eCl@ss:	32160702
NACRES:	NA.41

GST-tagged ATPase.
Epitope: Cytoplasmic domain

Research Category
Neuroscience
Research Sub Category
Ion Channels & Transporters
This Anti-Na+/K+ ATPase α-1 Antibody is validated for use in IC, IP, WB for the detection of Na+/K+ ATPase α-1.
Quality
Routinely evaluated by Immunoprecipitation on rat brain microsomal prep. lysate.
Target description
112 kDa
Physical form
Format: Purified
Purified antibody in buffer containing 0.1M Tris-Glycine (pH7.4) 150mM NaCl and 0.05% NaN3.
Protein A purified
Storage and Stability
Stable for 1 year at 2-8ºC from date of receipt.
Analysis Note
Control
Rat Brain Microsomal Prep. lysate.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

biological source	rabbit
Quality Level	100
antibody form	purified antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	bovine, rat, human
packaging	antibody small pack of 25 µg
Торговая марка	Upstate^®
application(s)	immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NM_001001586,
UniProt accession no.	P05023,
shipped in	ambient

Na+/K+-ATPase (also known as the Na+/K+ pump or sodium-potassium pump) is an enzyme located in the plasma membrane (specifically an electrogenic transmembrane ATPase). It is found in the plasma membrane of virtually every human cell and is common to all cellular life. It helps maintain cell potential and regulate cellular volume.
In order to maintain the cell potential, cells must keep a low concentration of sodium ions and high levels of potassium ions within the cell (intracellular). Outside cells (extracellular), there are high concentrations of sodium and low concentrations of potassium, so diffusion occurs through ion channels in the plasma membrane. In order to keep the appropriate concentrations, the sodium-potassium pump pumps sodium out and potassium in through active transport.
Specificity
This antibody recognizes the α-1 subunit isoform of Na+/K+ ATPase.

Anti-Na+/K+ ATPase -1 Antibody, clone C464.6

eCl@ss:	32160702
NACRES:	NA.41

Purified Na+/K+ ATPase isolated from membrane fractions of rabbit kidney outer medulla.

Immunoprecipitation:
2 µg of a previous lot immuno-precipitated the -1 subunit from rat brain microsomal preparations.
Immunohistochemistry:
1-10 µg/mL of a previous lot of this antibody was used in immunohistochemistry on ice-cold methanol-fixed tissue.
1. Do not boil microsomes. Warming to 37C for 15 minutes is recommended.
2. Microsomes from some tissues may contain sodium pump subunits which are below the level of detection by this antibody.
3. Microsomes derived from tissues which are more difficult to prepare, such as smooth and skeletal muscle, frequently show non-specific cross-reactivity.
Detect Na+/K+ ATPase α-1 (sodium/potassium ATPase subunit alpha 1) using this Anti-Na+/K+ ATPase α-1 Antibody, clone C464.6 validated for use in IC, IH, IP & WB.
Research Category
Neuroscience
Research Sub Category
Ion Channels & Transporters
Quality
Routinely evaluated in western blot on rat brain microsomal preparations.
Western Blot Analysis:
0.05-0.1 µg/mL of this lot detected the -1 subunit in 20 µg of rat brain microsomal preparation (Catalog # 12-144). To reduce background, wash the blot with 0.05% Tween-20 in PBS for 15 minutes.
Target description
112 kDa
Physical form
Format: Purified
Protein G Chromatography
Purified mouse monoclonal IgG1 in buffer containing 0.02 M phosphate buffer, pH 7.6, 0.25 M NaCl, 0.1% sodium azide. Frozen at
-20C.
Produced from a culture supernatant of a hybridoma produced by fusing Ag8 mouse myeloma cells with immunized Balb/c splenocytes. Clone C464.6 also called 6H.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations:
Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Analysis Note
Control
Alpha 1 mRNA is present in all cell types examined.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	C464.6, monoclonal
species reactivity	rat, sheep, human, pig, monkey, Xenopus, mouse, rabbit, canine
packaging	antibody small pack of 25 µg
Торговая марка	Upstate^®
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NM_001001586,
UniProt accession no.	P05023,
shipped in	dry ice
Gene Information	human ... ATP1A3(478)

Specificity
Specific for the α-1 subunit isoform.

Anti-Na+/K+ ATPase -1 Antibody, clone C464.6, Alexa Fluor® 555 5-369X-555

eCl@ss:	32160702
NACRES:	NA.41

Purified Na+/K+ ATPase isolated from membrane fractions of rabbit kidney outer medulla.

Detect Na+/K+ ATPase α-1 using this Anti-Na+/K+ ATPase α-1 Antibody, clone C464.6, Alexa Fluor 555 validated for use in FC, IF & WB.
Research Category
Neuroscience
Research Sub Category
Ion Channels & Transporters
Quality
Immunoblot Analysis: 2µg/ml of this lot detected -1 subunit in 40µg of rat brain microsomal preparation.
Immunocytochemistry: 2µg/ml of this lot showed positive immunostaining for -1 subunit in Colo 205 cells.
Flow Cytometry: 0.2µg of this lot detected -1 subunit in fixed NCI H292 cells (see data).
Target description
113 kDa
Physical form
Protein G Purified
25µg Alexa Fluor® 555-conjugated protein G purified mouse IgG1 in 100µl of PBS containing 1% BSA, 0.05% Tween-20, 0.05% sodium azide. Liquid at 4°C.
Storage and Stability
Do Not Freeze. Do not store the material diluted. Stable for 1 year at 4°C from date of shipment. For maximum recovery of product, centrifuge original vial prior to removing cap.
Analysis Note
Control
Included Negative Control: Catalog # 16-239, Alexa Fluor® 555-conjugated Normal Mouse IgG.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

ALEXA FLUOR is a registered trademark of Life Technologies
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Alexa Fluor® is a registered trademark of Molecular Probes, Inc.
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	C464.6, monoclonal
species reactivity	pig, mouse, Xenopus, rabbit, canine, monkey, rat, sheep, human
packaging	antibody small pack of 25 µg
Торговая марка	Upstate^®
application(s)	flow cytometry: suitable","immunofluorescence: suitable","western blot: suitable
isotype	IgG1
conjugate	ALEXA FLUOR^® 555
NCBI accession no.	NM_152296.3,
UniProt accession no.	Q9N0Z6,
shipped in	wet ice
Gene Information	human ... ATP1A3(478)

Sodium/potassium-transporting ATPase subunit alpha-3 (UniProt: P06687; also known as EC: 3.6.3.9, Na(+)/K(+) ATPase alpha-3 subunit, Na(+)/K(+) ATPase alpha(III) subunit, Sodium pump subunit alpha-3) is encoded by the Atp1a3 gene (Gene ID: 24213) in rat. Sodium/potassium-transporting ATPase subunit alpha-3 is a multi-pass membrane protein that is exclusive to the brain tissue and is highly expressed in cell bodies and projections of hippocampus. It is responsible for establishing and maintaining the electrochemical gradients of sodium and potassium ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. Sodium/potassium-transporting ATPase subunit alpha-3 is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic component catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. Reduced levels of neuronal sodium/ potassium ATPase activity in ATP1A3 heterozygous mice increases their susceptibility to depression-like endophenotypes by chronic variable stress.
Specificity
This rabbit polyclonal antibody detects Sodium/potassium-transporting ATPase subunit alpha-3 in human, mouse, and rat brain. It targets an epitope with in 25 amino acids from the N-terminal region.

Anti-Na+/K+ ATPase alpha-3

eCl@ss:	32160702
NACRES:	NA.41

Epitope: N-terminus
KLH-conjugated linear peptide corresponding to 25 amino acids from the N-terminal region of rat Sodium/potassium-transporting ATPase subunit alpha-3.

Immunohistochemistry Analysis: A 1:250-1,000 dilution of this antibody detected Na+/K+ ATPase alpha-3 in human cerebral cortex and human cardiac muscle tissue.
Research Category
Neuroscience
Anti-Na+/K+ ATPase alpha-3, Cat. No. 06-172-I, is a highly specific rabbit polyclonal antibody that targets Sodium/potassium-transporting ATPase subunit alpha-3 and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in adult human brain tissue lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Na+/K+ ATPase alpha-3 in 10 µg of adult human brain tissue lysate.
Target description
~112 kDa observed; 111.75 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
species reactivity (predicted by homology)	mouse (based on 100% sequence homology), rat (based on 100% sequence homology)
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG
NCBI accession no.	NP_036638,
UniProt accession no.	P06687,
shipped in	ambient

Nanog is a homeodomain transcription factor expressed in cells of the inner cell mass of early embryos, in embryonic stem cells (ESC), germ cells and in stem/progenitor cells of some tissues. Together with Oct-4, Sox-2, and Rex-1, it is a molecular marker for pluripotent cells and for undifferentiated stem cells. This protein is crucial for the maintenance of pluripotency of ESCs and is down-regulated when ESCs differentiate.
Nanog controls the expression of many ESC genes together with other stem cell transcription factors like Oct-4 and Sox-2. Nanog targets both repressor and activator complexes to regulatory regions of hundreds of genes in the genome. Expression of nanog can be detected primarily in germ cell tumors and in tumors of other cell types. Nanog is an important marker for Seminomas, testicular carcinomas, teratocarcinomas, and germ cell-like tumors in various tissues. Furthermore, it was shown to transform NIH3T3 cells.
Anti-Nanog antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the hybridoma NNG-811 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with recombinant human Nanog. The human Nanog gene product is a 305 amino acid, 35 kDa protein with a tryptophan repeat domain and two C-terminal trans-activating domains. It is primarily located in the nucleus.
Specificity
Monoclonal Anti-Nanog reacts specifically with human Nanog.

Anti-Nanog antibody, Mouse monoclonal

recombinant human Nanog.

Monoclonal Anti-Nanog antibody is suitable for use in ELISA, immunoblotting (~ 40 kDa), immunocytochemistry and immunoprecipitation.
Immunoblotting: a working antibody concentration of 2-4 mg/mL is recommended using extracts of NT2 cells.
Anti-Nanog antibody, Mouse monoclonal has been used in:

enzyme-linked immunosorbent assay (ELISA)
immunoblotting
immunocytochemistry
flow cytometric analysis
immunoprecipitation
immunofluorescence

Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	NNG-811, monoclonal
form	buffered aqueous solution
mol wt	~40 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~2 mg/mL
application(s)	immunocytochemistry: suitable","immunoprecipitation (IP): suitable","indirect ELISA: suitable","western blot: 4-8 µg/mL
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	Q9H9S0,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... NANOG(79923)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

NANOG is a gene expressed in embryonic stem cells (ESCs) and is thought to be a key factor in maintaining pluripotency. NANOG thought to function in concert with other factors such as POU5F1 and SOX2 to establish ESC identity. These cells offer an important area of study because of their ability to maintain pluripotency, i.e., these cells have the ability to become virtually any cell of any of the three germ layers (endoderm, ectoderm, mesoderm).
NANOG may be useful in the immunohistochemical diagnosis of tumors. NANOG is expressed in germ cells of the fetus and in some germ cell tumors of the gonads and central nervous system (CNS).
Specificity
Antibody recognizes Nanog.

Anti-Nanog Antibody, NT

eCl@ss:	32160702
NACRES:	NA.41

Synthetic peptide from mouse Nanog.
Epitope: N-terminus

Research Sub Category
Pluripotent & Early Differentiation
Western blotting:
0.5-1.0 µg/mL. The antibody recognizes a protein of ~35 kDa on NT2/D1 cell lysate. Additional bands of ~55 and ~130 kDa may be seen depending on sample and antibody dilution used.Optimal working dilutions must be determined by the end user.
Research Category
Stem Cell Research
Detect Nanog using this Anti-Nanog Antibody, N-terminus validated for use in WB.
Quality
Routinely evaluated by Western Blot on Embryonic Mouse Brain lysates.
Western Blot Analysis:
1:500 dilution of this lot detected NANOG on 10 µg of Embryonic Mouse Brain lysates
Target description
39 kDa (MW 34 kDa)
Physical form
Affinity purified
Purified rabbit polyclonal immunoglobulin in buffer containing liquid 0.1% sodium azide.
Storage and Stability
Stable at 2-8°C in undiluted aliquots for up to 6 months from date of receipt.
Analysis Note
Control
Whole cell lysate from mouse embryonic stem cells.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

biological source	rabbit
Quality Level	100
antibody form	affinity purified immunoglobulin
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	rat, mouse, human
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	western blot: suitable
input	sample type: mouse embryonic stem cell(s) sample type: human embryonic stem cell(s) sample type induced pluripotent stem cell(s)
isotype	IgG
NCBI accession no.	NM_024865.2,
UniProt accession no.	Q9H9S0,
shipped in	ambient
storage temp.	2-8°C

Human Protein Atlas Number:

Anti-NBR1 antibody produced in rabbit

HPA022999 Human Protein Atlas characterization data

NBR1 (neighbor of BRCA1 gene 1) contains PB1 (Phox and Bem1), ZZ (zinc-finger domain), LIR (LC3-interacting region) and UBA (ubiquitin-associated) domains. The gene is mapped to human chromosome 17q21.

neighbor of BRCA1 gene 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NBR1 (neighbor of BRCA1 gene 1) is responsible for bringing ubiquitinated proteins to autophagosomes. It is also involved in the formation of protein aggregates. NBR1 works as a scaffold protein and participates in lysosomal degradation of activated FGF (fibroblast growth factor) receptors. It associates with TTN (titin) and controls SRF (serum response factor)-dependent muscle gene expression. It also targets peroxisomes for pexophagy.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75959,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	YSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLS
conjugate	unconjugated
UniProt accession no.	Q14596,
shipped in	wet ice
storage temp.	20°C

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Neural cell adhesion molecule L1-like protein (UniProt: P70232; also known as Cell adhesion molecule with homology to L1CAM, NCAM-L1, Chl1-like protein, Close homolog of L1) is encoded by the Chl1 (also known as Call) gene (Gene ID: in murine species. NCAM-L1 is a single-pass type I membrane protein that is synthesized with a signal peptide (aa 1-25), which is subsequently cleaved off in the mature form. It is expressed in neurons and glial cells in the brain and the spinal cord and has also been detected in the retina and the optic nerve. It is not detectable in mouse forebrain at E11 and becomes weakly detectable at E13 with highest detection at E18 to postnatal day 7. It is down-regulated at postnatal day 15 and is further reduced in four-week-old animals. NCAM-L1 is heavily N-glycosylated and contains N-linked oligosaccharides with a sulfated carbohydrate structure type HNK-1. NCAM-L1 contains an extracellular domain (aa 26-1083), a transmembrane domain (aa 1084-1104), and a cytoplasmic domain (aa 1105-1209). It also has six Ig-like C2 type domains and four fibronectin type -III domains. NCAM-L1 is an extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. It plays a role in neuronal positioning of pyramidal neurons as well as in regulation of both the number of interneurons and the efficacy of GABAergic synapses.
Specificity
This rabbit polyclonal antibody detects NCAM-L1 protein in mouse and rat.

Anti-NCAM-L1

eCl@ss:	32160702
NACRES:	NA.41

Purified full-length murine Neural cell adhesion molecule L1-like protein (NCAM-L1).
Epitope: unknown

Anti-NCAM-L1, Cat. No. ABN2181, is a highly specific rabbit polyclonal antibody that targets Neural cell adhesion molecule L1 and has been tested in Immunofluorescence, Immunoprecipitation, and Western Blotting.
Research Category
Neuroscience
Western Blotting Analysis: A representative lot detected NCAM-L1 in Western Blotting applications (Schmidt, H., et. al. (2002). J Cell Biol. 159(3):489-98; Alberts, P., et. al. (2003). Mol Biol Cell. 14(10):4207-20).
Immunoprecipitation Analysis: A representative lot immunoprecipitated NCAM-L1 in Immunoprecipitation applications (Patel, K., et. al. (1991). Hybridoma. 10(4):481-91).
Western Blotting Analysis: 0.5 µg/mL from a representative lot detected NCAM-L1 in crude membrane fractions of postnatal day 10 brain extracts (Courtesy of Fritz G. Rathjen from Max-Delbruck-Center, Berlin Germany).
Immunofluorescence Analysis: A representative lot detected NCAM-L1 in Immunofluorescence applications (Ter-Avetisyan, G., et. al. (2014). J Neurosci. 34(3):737-47; Abe, P., et. al. (2015). J Neurosci. 35(38):13053-63).
Quality
Evaluated by Western Blotting in Wild type & knock out P10 mouse brain extract crude membrane.
Western Blotting Analysis: 2 µg/mL of this antibody detected NCAM-L1 in crude membrane extact from brain of Wild type, but not in NCAM-L1 knock out P10 mouse.
Target description
~220 kDa observed; 135.07 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified rabbit polyclonal antibody in PBS with 0.05% sodium azide.
Protein A purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
antibody form	purified antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat, mouse
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_031723,
UniProt accession no.	P70232,

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

N-myc downstream regulated 1 (NDRG1) is a member of the N-myc downregulated gene family that belongs to the alpha/beta hydrolase superfamily. In humans, this protein is mainly expressed in epithelial cells.

Anti-NDRG1 (C-terminal) antibody produced in rabbit

MDL number:	MFCD03454849
NACRES:	NA.41

Anti-NDRG1 (C-terminal) antibody produced in rabbit has been used in immunoblotting and immunoprecipitation.
Biochem/physiol Actions
The cytoplasmic protein encoded by N-myc downstream regulated 1 (NDRG1) gene participates in stress responses, hormone responses, cell growth and differentiation. It is necessary for p53-mediated caspase activation and apoptosis. NDRG1 is a Rab4a effector, that participates in vesicular recycling of E-cadherin. It plays a key role in peripheral nervous system myelination. It also helps to modulate lipid fate in breast cancer cells.
Physical form
Solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~43 kDa
species reactivity	mouse, rat, human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	immunoprecipitation (IP): 5-10 µg using lysates of HeLa cells","western blot: 1-2 µg/mL using whole extract of mouse 3T3 and rat NRK cells
conjugate	unconjugated
UniProt accession no.	Q92597,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... NDRG1(10397)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

NEDD9 (neural precursor cell expressed, developmentally down-regulated 9) is a non-catalytic multi-domain scaffolding protein. The gene contains retinoic acid response element (RARE) element in its promoter region, and is composed of seven exons. It encodes for a protein composed of 834 amino acids in humans, and contains an N-terminal SH3 (src homology 3) domain, followed by SD - substrate domain, SRR - serine rich region, FAT - focal adhesion targeting domain. Its C-terminal contains a DYDY motif (amino acids 628–631). This gene is expressed ubiquitously, and shows strong expression in lungs and lung cell lines. NEDD9 is a member of the Cas (Crk-associated substrate) family of scaffolding proteins.
NEDD9 gene is mapped to human chromosome 6p24.2.
Specificity
Anti-Nedd9 (C-terminal region) specifically recognizes human Nedd9.

Anti-Nedd9 (C-terminal region) antibody produced in rabbit

Anti-Nedd9 (C-terminal region) antibody produced in rabbit may be used in immunoblotting and immunofluorescence.
Biochem/physiol Actions
NEDD9 (neural precursor cell expressed, developmentally down-regulated 9) functions in the assembly of oncogenic kinase complexes such as focal adhesion kinase (FAK), ABL, SRC, Aurora-A (AURKA). It, therefore, controls signaling pathways implicated in processes such as cell cycle, migration, adhesion, invasion and chemotaxis that are involved in for tumorigenesis and metastases. In melanoma, glioblastoma, colon cancer and head and neck squamous carcinoma, the overexpression of this protein results in enhanced epithelial to mesenchymal transition, migration, and metastasis.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Serine/threonine-protein kinase Nek6 (UniProt: Q9HC98; also known as EC: 2.7.11.1, Never in mitosis A-related kinase 6, NimA-related protein kinase 6, Protein kinase SID6-1512) is encoded by the NEK6 gene (Gene ID: 10783) in human. Nek6, a member of the NIMA-related serine/threonine kinase family that plays an important role in mitotic cell cycle progression and is required for chromosome segregation at metaphase-anaphase transition. It localizes to spindle microtubules in metaphase and anaphase and to the mid-body during cytokinesis. Nek6 is ubiquitously expressed, with highest expression in heart and skeletal muscle. Its levels are up-regulated in a variety of malignant cancers, such as breast, colon, lung, and gastric cancers. Nek6 is shown to be directly phosphorylated by Chk1 and Chk2, suggesting that it is a direct target of the DNA damage checkpoint. It is also phosphorylated upon IR or UV-induced DNA damage. Nek6 is activated by phosphorylation at Ser206. Although expression of Nek6 is tightly controlled in normal cells, this protein is highly overexpressed in various human cancers and regulates tumor progression and its expression and activity levels directly correlate to tumorigenicity of human cancer cells. Inhibition of Nek6 can lead to apoptosis. (Ref.: Nassirpour, R et al. (2010). Mol. Cancer Res. 8(5); 717-28).
Specificity
This rabbit polyclonal antibody detects Serine/threonine-protein kinase Nek6 in human cells. It targets an epitope with in the first 15 amino acids in the N-terminal region.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~120 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	indirect immunofluorescence: 1.5-3.0 µg/mL using human HS68 cells.120","western blot: 1-2 µg/mL using Jurkat cell lysates
conjugate	unconjugated
UniProt accession no.	Q14511,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... NEDD9(4739) mouse ... Nedd9(18003) rat ... Nedd9(291044)

Anti-Nek6

eCl@ss:	32160702
NACRES:	NA.41

Epitope: N-terminus
KLH-conjugated linear peptide corresponding to the first 15 amino acids from the N-terminal region of human Serine/threonine-protein kinase Nek6.

Anti-Nek6, Cat. No. ABE2875, is a highly specific rabbit polyclonal antibody that targets Serine/threonine-protein kinase Nek6 and has been tested in Immunofluorescence, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Nek6 in human pancreas and human cervical cancer tissue.
Immunofluorescence Analysis: A representative lot detected Nek6 in HeLa cells that were transfected with Nek6 siRNA (ORegan, L., et. al. (2009). Mol Cell Biol. 29(14):3975-90).
Western Blotting Analysis: A representative lot detected Nek6 in IP blot from lysates prepared from untransfected HEK 293 cells synchronized in S or M phase of the cell cycle with hydroxyurea or nocodazole, HeLa cells were either mock transfected or transfected (ORegan, L., et. al. (2009). Mol Cell Biol. 29(14):3975-90; ORegan, L., et. al. (2015). J Cell Biol. 209(3):349-58).
Immunoprecipitation Analysis: A representative lot detected Nek6 in lysates prepared from untransfected HEK 293 cells synchronized in S or M phase of the cell cycle with hydroxyurea or nocodazole (ORegan, L., et. al. (2009). Mol Cell Biol. 29(14):3975-90; ORegan, L., et. al. (2015). J Cell Biol. 209(3):349-58).
Quality
Evaluated by Western Blotting in HT1080 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Nek6 in 10 µg of HT1080 cell lysate.
Target description
~35 kDa observed; 35.71 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001159642,
UniProt accession no.	Q9HC98,
shipped in	ambient
Gene Information	human ... NEK6(10783)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Neogenin (UniProt: P97798) is encoded by the Neo1 (also known as Ngn) gene in murine species. Neogenin is a single-pass type I membrane protein that is expressed ubiquitously throughout the mid to late stages of gestation and in adult tissues. It strong expression is observed in the ventral region of the ventricular zone of the E15.5 mouse neural tube, as well as in the ventricular zones of the mesencephalon and rhombencephalon. Five different isoforms of neogenin have been described that are produced by alternative splicing. Isoform 3 and isoform 4 are shown to be expressed at higher level compared to other isoforms between E11.5 and E16.5. Neogenin is a multi-functional cell surface receptor that regulates cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. It also serves as a receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Interactions between netrin and neogenin result in a chemoattractive axon guidance response and cell-cell adhesion whereas its interaction with RGMa and RGMb can induce a chemorepulsive response. Neogenin is synthesized with a signal peptide (aa 1-36), which is subsequently cleaved off to produce the mature form that has an extracellular domain (aa 37-1136), a short transmembrane domain (aa 1137-1157), and a cytoplasmic domain (aa 1158-1493).
Specificity
Clone 21A8 is a rat monoclonal antibody that specifically detects murine Neuogenin. It targets an epitope with in the extracellular domain.

Anti-Neogenin Antibody, clone 21A8

Murine Neogenin ectodomain region fused to N-terminal CD5 signal peptide and a C-terminal 2X StrepII Tag.
Epitope: extracellular domain

Immunocytochemistry Analysis: A representative lot detected Neogenin in Immunocytochemistry applications (Kuhn, P.H., et. al. (2016). Elife. 5. pii: e12748).
Western Blotting Analysis: A representative lot detected Neogenin in Western Blotting applications (Kuhn, P.H., et. al. (2016). Elife. 5. pii: e12748).
Research Category
Neuroscience
Anti-Neogenin, clone 21A8 Antibody, Cat. No. MABN2316, is a highly specific rat monoclonal antibody that detects murine Neogenin and has been tested for use in Immunocytochemistry and Western Blotting.
Quality
Evaluated by Western Blotting in Non-reduced NIH/3T3 cell lysates.
Western Blotting Analysis: 1 µg/mL of this antibody detected Neogenin in Non-reduced NIH/3T3 cell lysates.
Target description
~163 kDa observed; 163.16 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	21A8, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","western blot: suitable
isotype	IgG1
UniProt accession no.	P97798,

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Specificity
Specifically reacts with the beta -subunit of NGF from mouse, in the 2.5S- as well as in the 7S-form.

Anti-Nerve Growth Factor Antibody, clone 27/21, azide free MAB5260Z

eCl@ss:	32160702
NACRES:	NA.41

2.5 S form of mouse NGF.

Research Sub Category
Neurochemistry & Neurotrophins
The antibody is used for the neutralization of NGF in cell culture systems. Furthermore the antibody is used to immunosympathectomy.
Optimal working dilutions must be determined by end user.
Research Category
Neuroscience
Detect Nerve Growth Factor using this Anti-Nerve Growth Factor Antibody, clone 27/21, azide free validated for use in ELISA, NEUT.

Replaces: 04-1119
Physical form
Format: Purified
Protein A Purified mouse immunoglobulin in 20 mM sodium phosphate, 250 mM NaCl, pH. 7.6, with no preservatives.
Protein A purified
Storage and Stability
Maintain for 6 months at 2–8°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Brain tissue

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	27/21, monoclonal
species reactivity	human, bovine, rat, mouse
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	ELISA: suitable","neutralization: suitable
isotype	IgG1
NCBI accession no.	NM_001102654.1,","NM_002527.4,
UniProt accession no.	P20783,
shipped in	wet ice
Gene Information	human ... NTF3(4908)

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Nestin, a large intermediate filament protein (class Type VI) expressed during development and in myotendinous and neuromuscular junctions. Nestin expression is restricted, typically disappearing by E18. Nestin is thought to be a reasonable neuronal marker; however, recent studies have found nestin expression in other cell types such as endothelial cells {Folia Biologica, 44(5):155, 1998}. Nestin identifies the most primitive neuroepithelium but also identifies many other embryonic tissues, so it is not specific for CNS. Nestin expression is seen in almost all GBMs (Glioblastoma mulitformes) and many melanomas (both primary and metastatic) but not in any metastatic carcinoma.
Specificity
Reacts with human Nestin, with weak reactivity to monkey nestin. Not reactive with rodent nestin.

Anti-Nestin Antibody, clone 10C2

eCl@ss:	32160702
NACRES:	NA.41

Epitope: human
Fusion protein.

Immunoblotting: 1:1,000-1:2,000 on denatured protein. Western blot: 1:1000-1:5000. Recognizes a 220-240kDA band on denaturing SDS gels. There is also a 60-64kDa band present in most lysates, the identity of this smaller fragment is unknown but it is not seen in lysates not containing human nestin protein.
WI-38 (ATCC# CCL75) can be used as a positive control. U251 cell line is also positive.
Immunocytochemistry: 1:200 on cells fixed in 4% paraformaldehyde and permeabilized with 0.02% Triton
Immunohistochemistry: paraformaldehyde is the preferred fixative: 1:200 on formalin fixed, paraffin embedded tissue sections. Use triton 0.02% in block only; dilution buffer 0.1% BSA; incubations 1-2 hours RT. Human fetal brain is suggested as a positive control. (CA Messam et al, Develop. Brain Res, 134:87-92, 2002; Gu, et al., Brain Res. 943:174-180, 2002). Filamentous staining in the cytoplasm of cells
Optimal working dilutions must be determined by end user.
Research Category
Stem Cell Research
Research Sub Category
Neural Stem Cells
This Anti-Nestin Antibody, clone 10C2 is validated for use in IC, IH, IH(P), WB for the detection of Nestin.
Target description
200-220 kDa

Replaces: AB5922
Physical form
Format: Purified
Protein A Purified mouse immunoglobulin in 20 mM sodium phosphate, 250 mM NaCl, pH. 7.6, with 0.1% sodium azide as a preservative.
Protein A purified
Storage and Stability
Antibodies may be stored at 4°C or -20°C. Avoid repeated freeze/thaw cycles.
During shipment, small volumes of product will occasionally become entrapped in the seal of the product vial. For products with volumes of 200µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the containers cap.
Analysis Note
Control
Positive Control: WI-38 (ATCC# CCL75) or U251 cell lines

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
clone	10C2, monoclonal
species reactivity	human
should not react with	rat, mouse
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable
input	sample type neural stem cell(s) sample type epithelial cells
isotype	IgG1
NCBI accession no.	NM_006617.1,
UniProt accession no.	P48681,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.

Anti-NeuN Antibody, clone 13E6, ZooMAb® Rabbit Monoclonal

Specificity

Clone 13E6 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Neuronal nuclei antigen. It targets an epitope with in the first 97 amino acids from the N-terminal region.

GST/His-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine Neuronal nuclei antigen (NeuN).

Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected NeuN in Rat brain nuclear extract.
Immunofluorescence Analysis: A 1:100 dilution from a representative lot detected NeuN in mouse hippocampus FFPE and mouse cerebral cortex frozen sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected NeuN in E18 rat cortical cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected NeuN in mouse brain and human brain tissue sections.
Anti-NeuN, clone 13E6, ZooMAb, Cat. No. ZRB377, is a highly specific recombinant Rabbit Monoclonal antibody that detects Neuronal nuclei antigen and has been tested for use in Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
RNA binding protein fox-1 homolog 3 (UniProt: Q8BIF2; also known as Fox-1 homolog C, Hexaribonucleotide-binding protein 3, Fox-3, Neuronal nuclei antigen, NeuN antigen) is encoded by the Rbfox3 (also known as D11Bwg0517e, Hrnbp3) gene (Gene ID: 52897) in murine species. The NeuN protein is localized in nuclei and perinuclear cytoplasm of most of the neurons in the central nervous system of mammals. It is widely expressed in brain, including in cerebral cortex, hippocampus, thalamus, caudate/putamen, cerebellum, as well as in the spinal cord. However, it is not detected in Cajal-Retzius cells in the neocortex, Purkinje cells, and photoreceptor cells. NeuN expression has been reported as early as embryonic day 9.5 (E9.5) and by E12.5 it can be found in the developing ventral horns and is also detected in the developing dorsal horns as well as in the dorsal root ganglion. It is expressed from embryonic stage to adulthood. Its expression is enhanced by retinoic acid treatment. It can serve as a pre-mRNA alternative splicing regulator and regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay. Initial characterization of NeuN was derived from usage of a monoclonal antibody (A60), but later identified as RBFOX3. Subsequent studies have shown that anti-NeuN antibodies can identify most types of neurons in the whole nervous system with some rare exceptions. NeuN knockout mice display significantly reduced brain weight, impaired neurofilament expression and decreased white matter volume. They show increased susceptibility to seizures and reduced anxiety-related behaviors compared with wild type littermates. Antibodies for NeuN predominantly associate with cell nuclei and, to a lesser extent, with the perinuclear cytoplasm. Two isoforms of the NeuN protein (46 and 48 kDa) are present in both locations but differ in their relative concentration in the nucleus and cytoplasm. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Lin, YS et al. (2018). PLOS One. 13(2); e0192355; Mao, S., et al. (2016). Front. Neuroanat. 13;10:54).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

ZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Neuregulin-1 (UniProt: Q02297; also known as Acetylcholine receptor-inducing activity, ARIA, Breast cancer cell differentiation factor p45, Glial growth factor, Heregulin, HRG, Neu differentiation factor, Sensory and motor neuron-derived factor) is encoded by the NRG1 (also known as GGF, HGL, HRGA, NDF, SMDF) gene (Gene ID: 3084) in human. Neuregulin-1 is a single-pass type 1 membrane protein that acts as a direct ligand for ErbBB3 and ErbB4 tyrosine kinase receptors. It concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Eleven isoforms of Neuregulin-1 are known that are produced by alternative splicing. They have been classified as type I (isoforms with an Ig domain and a glycosylation domain) type II NRGs (isoforms with an Ig domain, but no glycosylation domain). These multiple isoforms perform diverse cellular functions, such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells and inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction. Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form. Dual cleavage of Neuregulin-1 by beta-secretase 1 (BACE1) and ADAM17 is shown to liberate EGF-like domain, which stimulates ErbB3 signaling. (Ref.: Fleck, D., et a. (2013). J. Neurosci. 33(18):7856-7869).
Specificity
Clone 4F10 is a rat monoclonal antibody that detects human Neuregulin-1. It targets an epitope within 10 amino acids from the N-terminal half.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	13E6, monoclonal","recombinant monoclonal
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 40.61 kDa","observed mol wt ~46/48 kDa
species reactivity	mouse, rat, human
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency.
enhanced validation	recombinant expression
application(s)	immunocytochemistry: suitable using 1:100","immunofluorescence: suitable using 1:100","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using 1:100","western blot: suitable using 1:1,000
isotype	IgG
conjugate	unconjugated
UniProt accession no.	Q8BIF2,
shipped in	ambient
storage temp.	2-8°C
Gene Information	mouse ... Rbfox3(52897)

Anti-Neuregulin-1 Antibody, clone 4F10

A linear peptide corresponding to 10 amino acids from the N-terminal, extracellular domain of human Neuregulin 1, isoform 6.
Epitope: extracellular domain

Western Blotting Analysis: A representative lot detected Neuregulin-1 in Western Blotting applications (Fleck, D., et. al. (2013). J Neurosci. 33(18):7856-69; Cheret, C., et. al. (2013). EMBO J. 32(14):2015-28; Fleck, D., et. al. (2016). J Biol Chem. 291(1):318-33; Ben Halima, S., et. al. (2016). Cell Rep. 14(9):2127-2141).
Anti-Neuregulin-1 clone 4F10, Cat. No. MABN2292, is a highly specific rat monoclonal antibody that targets Typ III NRG1 beta-1 and has been tested for use in Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in HEK293 cells transfected with Type I NRG1 and Type III NRG1 and treated with BACE inhibitor.
Western Blotting Analysis: 1 µg/mL of this antibody detected Neuregulin-1 in HEK293 cells transfected with Type I NRG1 and Type III NRG1 and treated with BACE inhibitor.
Target description
~ 71 kDa observed; 71.16 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	4F10, monoclonal
species reactivity	human
species reactivity (predicted by homology)	mouse (based on 100% sequence homology), chimpanzee (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_039250,
UniProt accession no.	Q02297-6,
Gene Information	human ... NRG1(3084)

Neuritin (UniProt: Q9NPD7) is encoded by the NRN1 (also known as NRN) gene (Gene ID: 51299) in human. Neuritin, a conserved, glycosylphosphatidylinositol (GPI)-anchored protein that plays a role in the development, survival and function of neurons. Its activity is induced by brain-derived neurotrophic factor (BDNF) and neurotrophin-3 (NT-3). It is highly expressed by induced and natural regulatory T cells (TREGs). It also promotes the maintenance of the TREGs pool by stabilizing Foxp3 expression and promoting the persistence of these cells. Deficiency of Neuritin is shown to result in an imbalance between central and peripheral TREG populations and functions. Neuritin has a wide variety of effects in the nervous system, such as promoting neurite outgrowth, modulating neurite outgrowth during neuronal differentiation, and protecting motor neuron axons. It can also promote dendritic growth, regulate synaptic plasticity, and stabilize active synapses, and promote synaptic maturation. Its expression in the hippocampus is shown to be induced by neuronal activity following chemical- or electrical-induced seizures, ischemia, and exercise. Chronic antidepressant treatment is reported to increase neuritin expression in rat brain. Neuritin is synthesized with a signal peptide (aa 1-27) and a propeptide (aa 28-116) that are cleaved off in the mature form (aa 117-142). (Ref.: Son, H., et al. (2012). Proc. Natl. Acad. Sci. USA. 109(28); 11378-83; Zhou, S., and Zhou, J (2014). Curr. Med. Chem. 21(10); 1212-19). Note: A6.1 hybridoma clone, and WT/KO validation, courtesy of Lauren Makuch and Dr. Elly Nedivi, Massachusetts Institute of Technology.
Specificity
Clone A6.1 detects human and rat Neuritin.

Anti-Neuritin (CPG15) Antibody, clone A6.1

GST-tagged full-length human recombinant Neuritin.

Research Category
Neuroscience
Anti-Neuritin (CPG15), clone A6.1, Cat. No. MABN1840, is a highly specific mouse monoclonal antibody that targets Neuritin and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting with recombinant human/rat neuritin.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected recombinant human/rat Neuritin (CPG15).
Target description
~15 kDa observed; 15.33 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	A6.1, monoclonal
species reactivity	rat, human
species reactivity (predicted by homology)	monkey (based on 100% sequence homology), bovine (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001265639,
UniProt accession no.	Q9NPD7,
Gene Information	human ... NRN1(51299)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Neurocan core protein (UniProt: P55067; also known as 245 kDa early postnatal core glycoprotein, Chondroitin sulfate proteoglycan 3) is encoded by the Ncan (also known as Cspg3) gene in rat. Neurocan is a secreted protein of the aggrecan/versican proteoglycan family that is found in early postnatal and adult brain. During early postnatal development neurocan accounts for at least 20% of the protein of the soluble brain proteoglycans. Neurocan mostly contains chondroitin sulfate, but also has N-linked and O-linked oligosaccharides. It is shown to be involved in the modulation of cell adhesion and migration and regulates neurite outgrowth. Neurocan interact with several cell surface molecules, such as N-CAM, L1/Ng-CAM, etc., and modulates the cell-binding and neurite outgrowth promoting activates of these molecules. Neurocan is synthesized with a 22 aa signal peptide that is subsequently cleaved to produce the mature form. Neurocan contains one C-type lectin domain, two EGF-like domains, one Ig-like V type domain, two link domains and one Sushi (CCP/SCR) domain. (Ref.: Rauch, U., et al. (2001) Cell Mol. Life Sci. 58(12-13):1842-56; Zhou, XH et al. (2001). Mol. Cell Biol. 21(17): 5970-78).
Specificity
This rabbit polyclonal antibody detects Neurocan in fetal and adult rat brain.

Anti-Neurocan

eCl@ss:	32160702
NACRES:	NA.41

Full-length Neurocan isolated from 7-day embryonic rat brain and purified by monoclonal antibody immunoaffinity chromatography.
Epitope: unknown

Research Category
Cell Structure
This rabbit polyclonal Anti-Neurocan, Cat. No. ABT1382, is a rabbit polyclonal antibody that detects Neurocan core protein and has been tested for use in Immunofluorescence.
Quality
Evaluated by Immunofluorescence in E14 embryonic rat brain (frozen sections) and adult rat brain (frozen sections).
Immunofluorescence Analysis: A 1:500 dilution of this antibody detected Neurocan in E14 embryonic rat brain (frozen sections) and rat E14 neocortex.
Target description
135.55 kDa calculated.
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: suitable
isotype	IgG
NCBI accession no.	NP_113841 (neurocan core protein precursor),
UniProt accession no.	P55067,
shipped in	ambient

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Epitope: C-terminus
GST-tagged recombinant fragment corresponding to 212 amino acids from the C-terminal half of rat Neurocan core protein.

Anti-Neurocan Antibody, C-terminal

eCl@ss:	32160702
NACRES:	NA.41

Radioimmunoassay Analysis: A representative lot detected Neurocan in rat brain (Milev, P., et. al. (1998). Biochem Biophys Res Commun. 247(2):207-12).
Immunohistochemistry Analysis: A representative lot detected Neurocan in E13 and E14 mouse ventral diencephalon and retina in C57 mouse embryos (Leung, K.M., et. al. (2004). Brain Res Dev Brain Res. 152(1):1-10).
Research Category
Cell Structure
Anti-Neurocan, C-terminal, Cat. No. ABT1347, is a rabbit polyclonal antibody that detects Neurocan core protein and has been tested for use in Immunofluorescence, Immunohistochemistry, and Radioimmunoassay.
Quality
Evaluated by Immunofluorescence in E14 rat embryo, E14 rat neocortex, and adult rat brain hippocampus cells.
Immunofluorescence Analysis: A 1:500 dilution of this antibody detected Neurocan in E14 rat embryo, E14 rat neocortex, and adult rat brain hippocampus cells.
Target description
135.55 kDa calculated.
Physical form
Format: Unpurified
Rabbit polyclonal antiserum with 0.02% sodium azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat, mouse
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable","radioimmunoassay: suitable
isotype	IgG
NCBI accession no.	NP_113841 (neurocan core protein precursor),
UniProt accession no.	P55067,
shipped in	ambient

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Monoclonal Anti-Neurocan (mouse IgG1 isotype) is derived from the hybridoma 650.24 produced by the fusion of mouse myeloma cells (P3X cells) and splenocytes from BALB/c mice immunized with embryonic rat brain proteoglycans. Neurocan is a chondroitin sulfate proteoglycan (known also as CSPG3). It accounts for 20−30% of chondroitin sulfate proteoglycans in early postnatal rat brain. The mouse neurocan cDNA encodes for a 1,257-amino acid protein with a 22-amino acid signal peptide followed by an immunoglobulin-like domain and repeating motifs characteristic of the hyaluronic acid-binding region of aggregating proteoglycans. Neurocan is found in large amounts in glial scar, a primarily astrocytic structure formed after an injury in the central nervous system (CNS).
Neurocan is a proteoglycan which is expressed in the nervous tissue.

Anti-Neurocan antibody, Mouse monoclonal

MDL number:	MFCD02263808
NACRES:	NA.41

embryonic rat brain proteoglycans.

Anti-Neurocan antibody, Mouse monoclonal has been used in:

western blotting
immunofluorescence
enzyme-linked immunosorbent assay (ELISA)
immunocytochemistry
immunohistochemistry

Biochem/physiol Actions
Neurocan can inhibit the growth of axons. In presence of central nervous system injuries, it also takes part in tissue repair and neural network reconstruction.
Neurocan participates in the modulation of cell adhesion and migration. It exerts a negative effect on growing cerebellar axons.
Target description
Neurocan is a chondroitin sulfate proteoglycan (knownalso as CSPG3) thought to be involved in the modulation of cell adhesion and migration. It accounts for 20-30% of chondroitin sulfate proteoglycans in early postnatal rat brain.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	650.24, monoclonal
form	buffered aqueous solution
mol wt	antigen 260 kDa (additional band at 160 kDa)
species reactivity	rat
packaging	antibody small pack of 25 µL
concentration	~1 mg/mL
application(s)	immunocytochemistry: suitable","immunohistochemistry (frozen sections): suitable","indirect ELISA: suitable","western blot: 0.1-0.2 µg/mL using neonatal rat brain treated with chondroitinase.
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	P55067,
shipped in	dry ice
storage temp.	20°C
Gene Information	rat ... Ncan(58982)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

GST-tagged recombinant fragement corresponding to 164 amino acids from the N-terminal region of rat Neurocan.

Anti-Neurocan Antibody, N-terminal

eCl@ss:	32160702
NACRES:	NA.41

Anti-Neurocan, N-terminal, Cat. No. ABT1384, is a rabbit polyclonal antibody that detects Neurocan core protein and has been tested for use in Immunofluorescence, Immunohistochemistry, and Radioimmunoassay.
Radioimmunoassay Analysis: A representative lot detected Neurocan in rat brain (Milev, P., et. al. (1998). Biochem Biophys Res Commun. 247(2):207-12).
Immunohistochemistry Analysis: A representative lot detected Neurocan in E13 and E14 mouse ventral diencephalon and retina in C57 mouse embryos (Leung, K.M., et. al. (2004). Brain Res Dev Brain Res. 152(1):1-10).
Quality
Evaluated by Immunofluorescence in E14 Embryonic rat brain (frozen section), rat E14 neocortex, and rat hippocampus cells.
Immunofluorescence Analysis: A 1:500 dilution of this antibody detected Neurocan in E14 Embryonic rat brain (frozen section), rat E14 neocortex, and rat hippocampus cells.
Target description
135.55 kDa calculated.
Physical form
Format: Unpurified

Concentration: Please refer to lot specific datasheet.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat, mouse
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable","radioimmunoassay: suitable
isotype	IgG
NCBI accession no.	NP_113841 (neurocan core protein precursor),
UniProt accession no.	P55067,
shipped in	ambient

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

NeuroD1 gene is mapped to human chromosome 2q31.3.
Neuronal differentiation 1 (NEUROD1) is a transcription factor which is highly expressed in the brain, pancreas and retina.
Specificity
Anti-NeuroD1 specifically recognizes human, mouse and rat NeuroD1.

Anti-NeuroD1 antibody produced in rabbit

MDL number:	MFCD03097085
NACRES:	NA.41

synthetic peptide corresponding to amino acids 76-91 of human NeuroD1 conjugated to BSA. The corresponding sequence differs in mouse and rat by two and three amino acids, respectively.

Anti-NeuroD1 antibody produced in rabbit has been used in chromatin immunoprecipitation and immunoblotting.
Biochem/physiol Actions
NeuroD1 is a basic helix-loop-helix (bHLH) transcription factor, which regulates the fate of specific neuronal, endocrine and retinal cells.
Neuronal differentiation 1 (NEUROD1) binds to promoters and regulates gene expression. It can also enhance tumor cell survival in lung tumors. Mutations in the gene encoding NEUROD1 have been associated with neurological problems and early-onset diabetes.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~45 kDa (doublet bands)
species reactivity	human, rat, mouse
packaging	antibody small pack of 25 µL
concentration	~1 mg/mL
application(s)	western blot: 0.5-1 µg/mL using whole extracts of HEK-293T cells expressing human NeuroD1
conjugate	unconjugated
UniProt accession no.	Q13562,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... NEUROD1(4760) mouse ... Neurod1(18012) rat ... Neurod1(29458)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Neurofibromin (UniProt: P21359; also known as Neurofibromatosis-related protein NF-1) is encoded by the NF1 gene (Gene ID: 4763) in human. Neurofibromin is a GTPase-activating protein that negatively regulatres RAS/MAOK pathway by enhancing the hydrolysis of Ras-bound GTP. Hence, it can display tumor suppressor properties. Neurofibromin has been detected in brain, peripheral nerves, lung, colon, and muscle tissues. It has a CRAL-TRIO domain (aa 1580-1738) that facilitates its binding to phospholipids. It binds primarily glycerophospholipids with monounsaturated C18:1 and/or C16:1 fatty acid moieties and a phosphatidylethanolamine or phosphatidylcholine head group. Neurofibromin also has a Ras-GTP domain (aa 1235-1451). Mutations in NF1 gene are known to cause Neurofibromatosis type I that involved tumors in the peripheral nervous system and fibromatous skin tumors. Some mutations are also known to cause colorectal cancer and juvenile leukemia. Six different isoforms of Neurofibromin have been described that are produced by alternative splicing. (Ref.: Rossi, S., et al. (2018). Mod. Pathol. 31(1), 160-168).
Specificity
Clone NFC specifically detects human Neurofibromin C. it targets an epitope with in the C-terminal region.

Anti-Neurofibromin C Antibody, clone NFC

Recombinant fragment corresponding to 281 amino acids from the C-terminal region of human Neurofibromin C.
Epitope: C-terminus

Anti-Neurofibromin C, clone NFC, Cat. No. MABE1820, is a highly specific mouse monoclonal antibody that targets Neurofibromin and has been tested for use in Immunohistochemistry (Paraffin).
Immunohistochemistry (Paraffin) Analysis: A representative lot detected Neurofibromin C in Immunohistochemistry applications (Rossi, S., et. al. (2018). Mod Pathol. 31(1):160-168).
Western Blotting Analysis: A representative lot detected Neurofibromin C lysate from human NF1 +/+ cells, but not in -/- cells or NF1+/+ cells transfected with siRNA targeting neurofibromin (Reuss, DE.,et al., (2014). Acta Neuropathol. 127(4); 565-572).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Immunohistochemistry (Paraffin) in human kidney tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected Neurofibromin C in human kidney tissue sections.
Target description
319.37 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	NFC, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable (paraffin)
isotype	IgG1
UniProt accession no.	P21359,
Gene Information	human ... NF1(4763)

Neurofilament heavy polypeptide (UniProt: P12036; also known as NF-H, 200 kDa neurofilament protein, Neurofilament triplet H protein) is encoded by the NEFH (also known as KIAA0845, NFH) gene (Gene ID: 4744) in human. Neurofilaments (~ 10 nm in diameter) are intermediate filaments that serve as major elements of the cytoskeleton supporting the axon cytoplasm. They are the most abundant fibrillar components of the axon, being on average 3-10 times more frequent than axonal microtubules. They are built from three intertwined protofibrils, which are themselves composed of two tetrameric protofilament complexes of monomeric proteins. The neurofilament triplet proteins (68/70, 160, and 200 kDa) occur in both the central and peripheral nervous system and are usually neuron specific. The 68/70 kDa NF-L protein can self-assemble into a filamentous structure, however the 160 kDa NF-M and 200 kDa NF-H proteins require the presence of the 68/70 kDa NF-L protein to co-assemble. Antibodies to NF-H are useful for identifying neuronal cells and their processes in tissue sections and in tissue culture. NF-H antibodies are helpful in the identification of neurofilament accumulations seen in many neurological diseases, such as Amyotrophic lateral sclerosis (ALS) and Alzheimers disease. The purified immunogen used to generate this antibody was the very heavily phosphorylated form of NF-H and this antibody binds only this heavily phosphorylated form. Similar, but far fewer phosphorylation sites are also found in NF-M. Hence, this antibody displays some reactivity with NF-M. Enzymatic phosphorylation of porcine and bovine neurofilaments is shown to result in loss of binding.
Specificity
Clone NP1 detects heavily phosphorylated form of Neurofilament H. Displays weaker reactivity with phosphorylated Neurfilament -M.

Anti-Neurofilament NF-H Antibody, phosphorylated Antibody, clone NP1

eCl@ss:	32160702
NACRES:	NA.41

Native Neurofilament H purified from pig spinal cord.

Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Neurofilament NF-H in human ovary tissue.
Immunohistochemistry Analysis: A representative lot detected Neurofilament NF-H in Immunohistochemistry applications (Benson, D.L., et. al. (1996). J Neurocytol. 25(3):181-96; Boylan, K., et. al. (2009). J Neurochem. 111(5):1182-91).
Western Blotting Analysis: A representative lot detected Neurofilament NF-H in Western Blotting applications (Benson, D.L., et. al. (1996). J Neurocytol. 25(3):181-96; Boylan, K., et. al. (2009). J Neurochem. 111(5):1182-91).
ELISA Analysis: A representative lot detected Neurofilament NF-H in ELISA applications (Boylan, K., et. al. (2009). J Neurochem. 111(5):1182-91; Toedebusch, C.M., et. al. (2017). J Vet Intem Med. 31(2):513-520; Mashita, T., et. al. (2015). J Vet Med Sci. 77(4):433-8).
Research Category
Neuroscience
Anti-Neurofilament NF-H, phosphorylated, clone NP1, Cat. No. MAB1592-C, is a highly specific mouse monoclonal antibody that targets Neurofilament heavy polypeptide and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Immunohistochemistry in human cerebral cortex tissue.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected Neurofilament NF-H in human cerebral cortex tissue.
Target description
112.48 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS with 5 mM sodium azide and 50% glycerol.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Quality Level	100
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	NP1, monoclonal
species reactivity	mouse, human, rat, canine
species reactivity (predicted by homology)	porcine (based on 100% sequence homology), bovine (based on 100% sequence homology), chicken (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_066554,
UniProt accession no.	P12036,
shipped in	ambient

Neurogranin (UniProt: Q92686; also known as Ng, RC3) is encoded by the NRGN gene (Gene ID: 4900) in human. Neurogranin is abundantly expressed in cerebral cortex, hippocampus, amygdala, and striatum. In neurons, it is found concentrated at dendritic spines. It acts as a third messenger and serves as a substrate for protein kinase C-mediated molecular cascades during synaptic development and remodeling. It contains an IQ domain (aa 26-347) and a collagen-like domain (aa 48-78). The IQ domain mediates its interaction with calmodulin and phosphatidic acid (PA). Neurogranin is intrinsically unstructured, however, upon binding with calmodulin, the IQ domain adopts a helical conformation. Neurogranin is phosphorylated at serine 36 by protein kinase C and following phosphorylation neurogranin is unable to bind either calmodulin or PA, which can lead to decline in memory-associated functions. Higher levels of neurogranin have also been reported in brains of elderly and is considered a factor in memory decline, independent of Alzheimer s disease. (Ref.: Javier Dez-Guerra, F. (2010). Life. 62(8): 597-606; Casaletto, KB et al. (2017). Neurology 89(17); 1782-1788).
Specificity
This rabbit polyclonal antibody sepecifically detects Neurogranin. It targets an epitope with in 12 amino acids from the C-terminal region.

Anti-Neurogranin

eCl@ss:	32160702
NACRES:	NA.41

Epitope: C-terminus
KLH-conjugated linear peptide corresponding to 12 amino acids from the C-terminal region of human Neurogranin.

Anti-Neurogranin Antibody, Cat. No. 07-425-I, is a highly specific rabbit polyclonal antibody that targets Neurogranin and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected Neurogranin in human and rat brain tissue sections.
Quality
Evaluated by Western Blotting in rat brain tissue lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Neurogranin in rat brain tissue lysate.
Target description
~15 kDa observed; 7.62 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human, rat
species reactivity (predicted by homology)	mouse (based on 100% sequence homology), goat (based on 100% sequence homology), bovine (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001119653,
UniProt accession no.	Q92686,
Gene Information	human ... NRGN(4900)

Anti-Neuropeptide Y (NPY) is developed in rabbits using synthetic neuropeptide Y (porcine) conjugated to keyhole limpet hemocyanin (KLH) as the immunogen.
Neuropeptide Y (NPY), a 36-amino acid peptide amide, is a major regulatory neuropeptide widely distributed in the mammalian central (CNS) and peripheral nervous systems (PNS). NPY belongs to the pancreatic polypeptide family of peptides which are characterized by a common tertiary structure. Within this family, an intestinal peptide hormone, peptide YY (PYY), is most closely related to NPY. In the CNS, NPY is involved in regulation of blood pressure, memory processing, circadian rhythm, and stimulation of food intake. In the PNS, NPY has potent vasoconstrictor activity and acts as a neurotransmitter/neuromodulator of sympathetic neurons and adrenal glands. NPY is one of the most abundant peptides found in the CNS, widely distributed in the brain. High levels of NPY are present in the cerebral cortex, amygdaloid nuclei, hippocampal formation, and hypothalamus. In the PNS, NPY is found mainly in sympathetic neurons that innervate vascular smooth muscle, heart, and urogenital tract. The biological actions of NPY in the brain and periphery are mediated by at least two different NPY receptors, designated Y1 and Y2 receptor subtypes.
Specificity
The antibody recognizes by ELISA, NPY (human), NPY (porcine), NPY (sheep), NPY (13-36), NPY (18-36), and cross-reacts with PYY (human). It does not cross-react with neurokinin B (NKB), neurokinin A (NKA), substance P (SP), calcitonin, somatostatin and BSA.

Anti-Neuropeptide Y (NPY) antibody produced in rabbit

MDL number:	MFCD00162717
NACRES:	NA.41

synthetic neuropeptide Y (NPY, porcine), conjugated to KLH. The corresponding sequence is highly conserved (single amino acid substitution) in human and rat NPY and is highly conserved (84% identity) in the C-terminus region (24-36) of human peptide YY.

Anti-Neuropeptide Y (NPY) antibody produced in rabbit has been used in:

single-labeling immunocytochemistry
immunofluorescence
immunostaining
dot blot
radioimmunoassay (RIA)
enzyme-linked immunosorbent assay (ELISA)

Biochem/physiol Actions
Neuropeptide Y (NPY) plays a vital role in feeding behaviour, anxiety, epilepsy, circadian, rhythm memory processing, sleep, pain and drug addiction. In addition, it is also implicated in regulation of appetite, body weight and obesity. It controls central endocrine secretion and has potent vasoactive effects on the cardiovascular system. NPY is involved in the pathogenesis of atherosclerosis and coronary artery disease.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	whole antiserum
antibody product type	primary antibodies
clone	polyclonal
contains	15 mM sodium azide
species reactivity	pig, human, rat, sheep
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry (frozen sections): 1:8,000-1:16,000 using 4% paraformaldehyde perfusion-fixed sections of rat brain","indirect ELISA: 1:5,000-1:10,000 using using peptide coating at 0.5-1 µg/well in 0.05 M carbonate/bicarbonate buffer, pH 9.6, and pNPP as substrate
conjugate	unconjugated
UniProt accession no.	P01303,
shipped in	dry ice
storage temp.	20°C
Gene Information	rat ... Npy(24604)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

Neuropilin-2 (UniProt: O60462; also known as Vascular endothelial cell growth factor 165 receptor 2) is encoded by the NRP2 (also known as VEGF165R2) gene (Gene ID: 8828) in human. Neuropilin-2 is a single-pass type I membrane protein that serves as a high affinity receptor for VEGF165 and VEGF145, semaphorins 3C, 3F, and the PLGF-2 isoform of PGF. It is synthesized with a signal peptide (aa 1-20) that is subsequently cleaved in the mature form. Neuropilin-2 has an extracellular domain (aa 21-864), a transmembrane domain (aa 865-889), and cytoplasmic tail (aa 890-931). It contains two CUB domains (aa 28-142 and 149-267) that mediate its binding to semaphorin. It also has two F5/8 type -C domains that are responsible for heparin and VEGF binding. Six different isoforms of Neuropilin-2 have been described that are produced by alternative splicing. In non small cell lung cancer (NSCLC) cell lines, TGF-beta signaling is reported to preferentially increase the abundance of NRP2b. Although it has been shown that the presence of NRP2b inhibits the proliferation of cultured cells and diminishes primary tumor growth, it also enhances cellular migration, invasion into Matrigel, and tumorsphere formation in cultured cells in response to TGF-beta. In addition, it is shown to promote metastasis in xenograft murine models. In lung cancer cell lines, knocking down of NRP2 is shown to impair both baseline and TGF-beta-induced migration and invasion. (Ref.: Gemmill, RM., et al., (2017). Sci. Signal. 10, eaag0528).
Specificity
This rabbit polyclonal antibody detects Neuropilin-2b in human and murine cells.

Anti-Neuropilin-2b

eCl@ss:	32160702
NACRES:	NA.41

Epitope: C-terminus
Mixture of two KLH-conjugated peptides corresponding to 17 and 16 amino acids from the C-terminal region of human Neuropilin-2b.

Anti-Neuropilin-2b, Cat. No. ABN2262, is a highly specific rabbit polyclonal antibody that targets Neuropilin-2b (NRP2b) and has been tested for use in Immunocytochemistry,Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Immunoprecipitation Analysis: A representative lot immunoprecipitated Neuropilin-2b in Immunoprecipitation applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Immunocytochemistry Analysis: A representative lot detected Neuropilin-2b in Immunocytochemistry applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Western Blotting Analysis: A representative lot detected Neuropilin-2b in Western Blotting applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Western Blotting Analysis: A 1:250 dilution from a representative lot detected Neuropilin-2b in HEK293 transfected with NRP2b (Courtesy of Dr. Robert Gemmill @ Medical University of South Carolina).
Immunohistochemistry Analysis: A representative lot detected Neuropilin-2b in Immunohistochemistry applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in NIH3T3 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Neuropilin-2b in NIH3T3 cell lysate.
Target description
~115 kDa observed. 104.86 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_061004,","NP_957719,
UniProt accession no.	O60462,
Gene Information	human ... NRP2(8828)

Monoclonal Anti-Nexilin (mouse IgG2a isotype) is derived from the hybridoma NX-38 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide conjugated to KLH. Nexilin is a filamentous actin-binding protein that localizes to focal contacts. Alternative splicing of the gene yields two different isoforms namely, b-nexilin and s-nexilin.
NEXN (nexilin), a cardiac Z-disc protein is made of 675 amino acids. It is present in the heart and skeletal muscle. NEXN is mapped to human chromosome 1p31.
Specificity
Monoclonal Anti-Nexilin recognizes human, rat, and mouse nexilin.

Anti-Nexilin antibody,Mouse monoclonal

Anti-Nexilin antibody,Mouse monoclonal may be used in immunoblotting and immunocytochemistry.
Biochem/physiol Actions
NEXN (nexilin) plays an important role in protecting cardiac Z-discs from forces generated within the sarcomere. Mutations in NEXN results in hypertrophic cardiomyopathy.
Nexilin may be involved in cell adhesion and migration.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze at –20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	NX-38, monoclonal
form	buffered aqueous solution
mol wt	antigen 80 kDa
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µL
concentration	~1 mg/mL
application(s)	immunocytochemistry: suitable","western blot: 1-2 µg/mL using using rat brain S1 fraction extracts
isotype	IgG2a
conjugate	unconjugated
UniProt accession no.	Q0ZGT2,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... NEXN(91624) rat ... Nexn(246172), Nexn(68810)

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

KLH-conjugated linear peptide corresponding to the C-terminus of human NF-E2 related factor 2.
Epitope: C-terminus

Anti-NF-E2-related factor 2 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
species reactivity (predicted by homology)	chimpanzee (based on 100% sequence homology), mouse (based on 100% sequence homology), rhesus macaque (based on 100% sequence homology), rat (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","western blot: suitable
NCBI accession no.	NP_006155,
UniProt accession no.	Q16236,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

The transcription factor NFkappaB (Nuclear Factor kappa B) is involved in the expression and regulation of a number of important cellular and physiological processes such as growth, development, apoptosis, immune and inflammatory response, and activation of various viral promoters including human immunodeficiency virus long terminal repeats. NFkappaB represents a group of structurally related and evolutionarily conserved proteins related to the proto-oncogene c-Rel with five members in mammals that include Rel (cRel), RelA (p65), RelB, NFkappaB1 (p50 and its precursor p105), and NFkappaB2 (p52 and its precursor p100). NFkappaB/Rel proteins exist as homo- or heterodimers to form transcriptionally competent or repressive complexes. Although most NFkappaB dimers are activators of transcription, the p50/50 and p52/52 homodimers can repress the transcription of their target genes. The p50/p65 heterodimer of NFkappaB is the most abundant in cells.
Specificity
Recognizes an epitope overlapping the nuclear location signal (NLS) of the p65 subunit of the NFkB heterodimer. Thus it selectively binds to the activated form of NFkB (Zabel et al., 1993). The antibody can also be used for electrophoretic mobility supershift assays (EMSA). The nuclear factor kB (NFkB) is a sequence-specific DNA-binding protein (Sen & Baltimore, 1986). It is a pleiotropic transcription factor which is involved in the expression of a variety of cellular and viral genes (Lenardo & Baltimore, 1989). NFkB consists of two subunits which are named according to their molecular weight, p50 and p65 (Kawakami et al., 1988). The subunits are stabilized by a so-called inhibitory chain IkB (Baeuerle & Baltimore, 1988). In quiescent cells, NFkB resides in the cytosol in an inactive form which can be activated in vivo by treatment of cells with cytokines or protein kinase activators. In vitro, it is possible to generate the active form of NFkB by treatment with sodium deoxycholate, formadine or electrophoretic size fractionation. The active form of NFkB is a heterotetrameric protein, consisting of the two p50 and two p65 subunits (Lenardo et al., 1987). After activation NFkB translocates from the cytosol to the nucleus of the cell, binds to specific DNA sequences and initiates transcription.

Anti-NFB Antibody, p65 subunit, active subunit, clone 12H11

eCl@ss:	32160702
NACRES:	NA.41

Epitope: p65 subunit, active subunit
Peptide corresponding to human p65 coupled to BSA.

Research Sub Category
Transcription Factors
Use Anti-NFκB Antibody, p65 subunit, active subunit, clone 12H11 (Mouse Monoclonal Antibody) validated in EMSA, FC, ICC, IF, IHC, IHC(P), WB to detect NFκB also known as Rel A.
Research Category
Epigenetics & Nuclear Function
Immunofluorescence:
A 1-10 µg/mL concentration of a previous lot was used in immunofluorescence.
Immunohistochemistry (paraffin sections):
A 5-10 µg/mL (APAAP) concentration of a previous lot was used in immunohistochemistry.
Immunohistochemistry (frozen sections):
A 5-10 µg/mL (APAAP) concentration of a previous lot was used in immunohistochemistry.
Immunohistochemistry:
The clone 12H11 works best in fresh frozen or acetone fixed human tissues, however some groups have had reactivity in traditional formalin fixed tissue when the tissue is of human origin. It is recommended that ABC or enhanced detection systems be employed for the best visualization in either acetone or formalin fixed tissues. The antibody reacts with human tissues best. Rat tissue will also react but at a lower affinity, and the antibody does not react with mouse, other species have not been examined. Microwave citric acid buffer or trypsin digestion antigen recovery have both been successful with 12H11 on formalin fixed tissues.
Western blot: 5-10 µg/mL (ECL)
Electrophoretic Mobility Supershift Assay:
A 0.5-1 µg/mL concentration of a previous lot was used in Supershift assay.
Flow cytometry:
A previous lot of this antibody was used in flow cytometry. Fixed cells only, acetone fixed cells.
Optimal working dilutions must be determined by end user.
Quality
Routinely evaluated by Western Blot on PC12 lysates.
Western blot:
1:500 dilution of this lot detected NF KAPPA B, P65 on 10 µg of PC12 lysates.
Target description
65 kDa
Physical form
Purified mouse monoclonal IgG3 liquid in buffer containing 0.02 M Phosphate buffer, 0.25 M NaCl, pH 7.6 with 0.1% sodium azide.
Format: Purified
Protein A purified
Storage and Stability
Stable for 6 months at 2-8C from date of receipt.
Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
TNF -treated HeLa cells, PMA and calcium ionophore-treated Jurkat cells.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	12H11, monoclonal
species reactivity	rabbit, rat, human
species reactivity (predicted by homology)	mouse
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	electrophoretic mobility shift assay: suitable","flow cytometry: suitable","immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable
isotype	IgG3
NCBI accession no.	NP_068810.3,
UniProt accession no.	Q04206,
shipped in	ambient
storage temp.	2-8°C

Nuclear factor NF-kappa-B p105 subunit (UniProt P19838; also known as DNA-binding factor KBF1, EBP-1, NF-kappa-B, NF-kappaB, NF-kB1, NFkappaB, NFKB-p105, NFKB-p50, Nuclear factor NF-kappa-B p50 subunit, Nuclear factor kappa-B DNA binding subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) is encoded by the NFKB1 gene (Gene ID 4790) in human. NF-κB is a protein complex that plays a key role in regulating the immune response to infection/inflammation. NF-κB1 is synthesized as a 968 a.a protein (p105), which undergoes posttranslational processing to generate the p50 subunit (a.a. 1-433). The p50 NF-κB participates in target gene transactivation by forming heterodimers with RelA, RelB, or c-Rel. In addition, p50 homodimer can bind the nuclear protein Bcl-3 and form a functional transcriptional activator complex. In unstimulated cells, the NF-κB dimers are sequestered in the cytoplasm by the family of IκB (Inhibitor of κB) proteins (IκBα, IκBβ, IκBε, and Bcl-3). Upon stimulation, IκB becomes phosphorylated by the IκB kinase (IKK) complex, leading to IκB ubiquitination and proteasomal degradation. With the degradation of IκB, the NF-κB complex is then freed to enter the nucleus to activate the transcription of target genes.
Specificity
Dectects 105 kDa recursor and 50 kDa processed forms. Immunogen sequence is a.a. 1-12, this polyclonal antibody can therefore detect isoforms 1 and 2, but not 3. Note that isoform 3 is missing amino acids 1-180.

Anti-NFB p50 Antibody

eCl@ss:	32160702
NACRES:	NA.41

KLH conjugated synthetic peptide (MAEDDPYLGRPE-C) corresponding to amino acids 1-12 of NFκB p50, containing a C-terminal cysteine.
Epitope: Amino acid 1-12

Immunoprecipitation Analysis: 10 µg of antibody from a representative lot immunoprecipitated NFkB p50 in 500 µg of A431 cell lysate.
Anti-NFκB p50 Antibody is an antibody against NFκB p50 for use in Western Blotting, Immunoprecipitation.
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: 0.2 µg/mL of this antibody detected NFkB p50 in 10 µg of A431 cell lysate.
Target description
~50/105 kDa observed

Concentration: Please refer to lot specific datasheet.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
species reactivity (predicted by homology)	rhesus macaque (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunoprecipitation (IP): suitable","western blot: suitable
NCBI accession no.	NP_003989,
UniProt accession no.	P19838,
shipped in	ambient
Gene Information	human ... NFKB1(4790)