Small Pack Antibodies

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
This rat monoclonal Anti-Ly-6G Antibody (mouse), FITC, clone RB6-8C5 , Cat. No. MABF1482 is validated for use in Flow Cytometry, for the detection of Ly-6G.
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg from a representative lot detected Ly-6G in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	RB6-8C5, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
conjugate	FITC conjugate
UniProt accession no.	P35461,

The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils. In the mouse, the 1A8 antibody is typically used in combination with the macrophage labeling antibody M1/70 (Anti-CD11b) for phenotypic analysis of monocytes, macrophages and granulocytes. Note: for identification of Ly-C, an alternative antibody, clone RB6-8C5, has been reported to cross-react with Ly-6C on cells expressing this antigen (Fleming et al. 1993. J. Immunol. 151: 2399-2408 and Sasmono et al. 2007. J. Leukoc. Biol. 82: 111-123) and has been cited in the literature for identification of Ly-6G/Ly-6C.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G (mouse), PE-Cy7, clone 1A8 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
This Anti-Ly-6G (mouse), PE-Cy7, clone 1A8 Antibody is validated for use in Flow Cytometry for the detection of Ly-6G.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected Ly-6G in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	1A8, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2a
conjugate	PE-Cy7
UniProt accession no.	P35461,

The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils. In the mouse, the 1A8 antibody is typically used in combination with the macrophage labeling antibody M1/70 (Anti-CD11b) for phenotypic analysis of monocytes, macrophages and granulocytes. Note: for identification of Ly-C, an alternative antibody, clone RB6-8C5, has been reported to cross-react with Ly-6C on cells expressing this antigen (Fleming et al. 1993. J. Immunol. 151:2399-2408 and Sasmono et al. 2007. J. Leukoc. Biol. 82: 111-123) and has been cited in the literature for identification of Ly-6G/Ly-6C.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G (mouse), redFluor® 710, clone 1A8 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
Anti-Ly-6G (mouse), redFluor® 710, clone 1A8 Antibody is an antibody against Ly-6G for use in Flow Cytometry.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected Ly-6G in one million C57Bl/6 splenocytes.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.

redFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	1A8, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2a
conjugate	redFluor^® 710
UniProt accession no.	P35461,

Anti-Ly-6G (mouse), redFluor® 710, clone RB6-8C5 Antibody is an antibody against Ly-6G for use in Flow Cytometry.
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.015 µg from a representative lot detected Ly-6G in one million C57Bl/6 bone marrow cells.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G (mouse), redFluor® 710, clone RB6-8C5 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Concentration: Please refer to lot specific datasheet.

redFluor is a registered trademark of Tonbo Biotechnologies

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	RB6-8C5, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	redFluor^® 710
UniProt accession no.	P35461,

The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils. In the mouse, the 1A8 antibody is typically used in combination with the macrophage labeling antibody M1/70 (Anti-CD11b) for phenotypic analysis of monocytes, macrophages and granulocytes. Note: for identification of Ly-C, an alternative antibody, clone RB6-8C5, has been reported to cross-react with Ly-6C on cells expressing this antigen (Fleming et al. 1993. J. Immunol. 151:2399-2408 and Sasmono et al. 2007. J. Leukoc. Biol. 82: 111-123) and has been cited in the literature for identification of Ly-6G/Ly-6C.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G (mouse), violetFluor® 450, clone 1A8 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Anti-Ly-6G (mouse), violetFluor® 450, clone 1A8 Antibody is an antibody against Ly-6G for use in Flow Cytometry.
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected Ly-6G in one million C57Bl/6 bone marrow cells.

Concentration: Please refer to lot specific datasheet.

violetFluor is a registered trademark of Tonbo Biotechnologies

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	1A8, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2a
conjugate	violetFluor^® 450
UniProt accession no.	P35461,

Immunogen information for this antibody is proprietary information.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G (mouse), violetFluor® 450, clone RB6-8C5 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Research Sub Category
Immunoglobulins & Immunology
Anti-Ly-6G (mouse), violetFluor® 450, clone RB6-8C5 Antibody is an antibody against Ly-6G for use in Flow Cytometry.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.06 µg from a representative lot detected Ly-6G in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.

violetFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	RB6-8C5, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	violetFluor^® 450
UniProt accession no.	P35461,

The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils. In the mouse, the 1A8 antibody is typically used in combination with the macrophage labeling antibody M1/70 (Anti-CD11b) for phenotypic analysis of monocytes, macrophages and granulocytes. Note: for identification of Ly-C, an alternative antibody, clone RB6-8C5, has been reported to cross-react with Ly-6C on cells expressing this antigen (Fleming et al. 1993. J. Immunol. 151:2399-2408 and Sasmono et al. 2007. J. Leukoc. Biol. 82: 111-123) and has been cited in the literature for identification of Ly-6G/Ly-6C.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G Antibody (mouse), APC, clone 1A8 MABF736

eCl@ss:	32160702
NACRES:	NA.41

General description

Immunogen information for this antibody is proprietary information.

This rat monoclonal antibody Anti-Ly-6G (mouse), APC & clone 1A8 validated for use in Flow Cytometry for the detection of Ly-6G.
Research Category
Inflammation & Immunology
Quality
The monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg of this antibody detected Ly-6G in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat Monoclonal Antibody in buffer containing 10 mM NaH2PO4, 150 mM NaCl, 0.1% gelatin, pH 7.2, and up to 0.1% sodium azide.
Size Exclusion Chromatography
Storage and Stability
It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	1A8, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
concentration	0.2 mg/mL
application(s)	flow cytometry: suitable
isotype	IgG2a
conjugate	Allophycocyanin conjugate
UniProt accession no.	P35461,
shipped in	wet ice

This rat monoclonal antibody Anti-Ly-6G (mouse), FITC & clone 1A8 validated for use in Flow Cytometry for the detection of Ly-6G.
The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils. In the mouse, the 1A8 antibody is typically used in combination with the macrophage labeling antibody M1/70 (Anti-CD11b) for phenotypic analysis of monocytes, macrophages and granulocytes. Note: for identification of Ly-C, an alternative antibody, clone RB6-8C5, has been reported to cross-react with Ly-6C on cells expressing this antigen (Fleming et al. 1993. J. Immunol. 151:2399-2408 and Sasmono et al. 2007. J. Leukoc. Biol. 82: 111-123) and has been cited in the literature for identification of Ly-6G/Ly-6C.
Quality
The monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg of this antibody detected Ly-6G in one million C57Bl/6 bone marrow cells.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G Antibody (mouse), FITC, clone 1A8 MABF737

eCl@ss:	32160702
NACRES:	NA.41

General description

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	1A8, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
concentration	0.5 mg/mL
application(s)	flow cytometry: suitable
isotype	IgG2a
conjugate	FITC conjugate
UniProt accession no.	P35461,
shipped in	wet ice

The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils. In the mouse, the 1A8 antibody is typically used in combination with the macrophage labeling antibody M1/70 (Anti-CD11b) for phenotypic analysis of monocytes, macrophages and granulocytes. Note: for identification of Ly-C, an alternative antibody, clone RB6-8C5, has been reported to cross-react with Ly-6C on cells expressing this antigen (Fleming et al. 1993. J. Immunol. 151:2399-2408 and Sasmono et al. 2007. J. Leukoc. Biol. 82: 111-123) and has been cited in the literature for identification of Ly-6G/Ly-6C.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly-6G Antibody (mouse), PerCP-Cy5.5, clone 1A8 MABF738

eCl@ss:	32160702
NACRES:	NA.41

General description

Immunogen information for this antibody is proprietary information.

This rat monoclonal antibody Anti-Ly-6G (mouse), PerCP-Cy5.5 & clone 1A8 validated for use in Flow Cytometry for the detection of Ly-6G.
Research Category
Inflammation & Immunology
Quality
The monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg of this antibody detected Ly-6G in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat Monoclonal Antibody in buffer containing 10 mM NaH2PO4, 150 mM NaCl, 0.1% gelatin, pH 7.2, and up to 0.1% sodium azide.
Size Exclusion Chromatography
Storage and Stability
It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	1A8, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
concentration	0.2 mg/mL
application(s)	flow cytometry: suitable
isotype	IgG2a
conjugate	PerCP-Cy5.5
UniProt accession no.	P35461,
shipped in	wet ice

T-cell surface glycoprotein YE1/48 (UniProt: P20937; also known as Lymphocyte antigen 49a, Ly-49a, T lymphocyte antigen A1) is encoded by the Klra1 (also known as Ly-49, Ly-49a, Ly49, Ly49A) gene in murine species. LY49A is a single-pass type II membrane protein that serves as an inhibitory receptor on natural killer (NK) cells for H-2d(Dd) MHC class I molecules on target cells. It inhibits the activity of NK cells thereby preventing cell lysis. Ly49A-mediated NK cell inhibition is shown to be dependent on a lateral binding site, which is located beneath the peptide-binding platform of Dd. Ly49A is reported to contribute to target cell adhesion and accumulate at synapses with Dd-expressing target cells when NK cells themselves lack Dd. In cases where NK cells display Dd expression Ly49A does not contribute to adhesion. Higher expression of LY49A is observed in T-lymphoma cell lines and normal lymphocytes exhibit low expression. LY49A has a cytoplasmic domain (aa 1-44), a transmembrane domain (aa 45-66), and an extracellular domain (aa 67-262). (Ref.: Back, J., et al. (2007). Proc. Natl. Acad. Sci. USA 104(10); 3978 3983).
Specificity
Clone A1 specifically detects Lymphocyte antigen 49a (LY49A) in murine species.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Ly49A Antibody, clone A1

EL-4 T lymphoma cells.

Immunoprecipitation Analysis: A representative lot detected Ly49A in Immunoprecipitation applications (Nagasawa, R., et. al. (1987). J Immunol. 138(3):815-24; Yokoyama, W.M., et. al. (1989). J Immunol. 143(4):1379-86).
Immunocytochemistry Analysis: A representative lot detected Ly49A in Immunocytochemistry applications (Nagasawa, R., et. al. (1987). J Immunol. 138(3):815-24; Back, J., et. al. (2007). Proc Natl Acad Sci U S A. 104(10):3978-83).
Flow Cytometry Analysis: A representative lot detected Ly49A in Flow Cytometry applications (Nagasawa, R., et. al. (1987). J Immunol. 138(3):815-24; Yokoyama, W.M., et. al. (1989). J Immunol. 143(4):1379-86; Back, J., et. al. (2007). Proc Natl Acad Sci U S A. 104(10):3978-83; Silver, E.T., et. al. (2000). J Immunol. 165(4):1771-81).
This mouse monoclonal Anti-Ly49A, clone A1, Cat. No. MABF2090 is tested for use in Flow Cytometry, Immunocytochemistry and Immunoprecipitation, for the detection of Lymphocyte antigen 49a.
Quality
Evaluated by Flow Cytometry in EL-4 T lymphoma cells.
Flow Cytometry Analysis: 1 µg of this antibody detected Ly49A in 1X10E6 EL-4 T lymphoma cells.
Target description
30.50 kDa calculated.
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

Lysine-specific demethylase 4C (UniProt: Q9H3R0; also known as EC: 1.14.11.-; Gene amplified in squamous cell carcinoma 1 protein, GASC-1 protein, JmjC domain-containing histone demethylation protein 3C, Jumonji domain-containing protein 2C, Jmjd2c) is encoded by the KDM4C (also known as GASC1, JHDM3C, JMJD2C, KIAA0780) gene (Gene ID: 23081) in human. Jmjd2c is an ubiquitously expressed histone demethylase that specifically demethylates Lys-9 and Lys-36 residues of histone H3. It is shown to demethylate only the trimethylated H3 and does not affect mono- and dimethylated residues. It does neither demethylate histone Lys-4 or Lys-27 of histone H3 nor the Lys-20 of histone H4. Human Jmjd2C contains one jumonji N domain (aa 16-58), a catalytic jumonji C domain (aa 144-310), two PHD zinc finger regions (aa 689-865), and two TUDOR methylated-histone binding domains (aa 877-991). Jmjd2c, along with its closely demethylase Jmjd2b, plays a vital role in self-renewal of embryonic stem cells (ESC) and in generation of induced pluripotent stem cells. Full-length Jmjd2b and Jmjd2c are shown to restore the normal ESC growth phenotype, ESC colony morphology, and also SSEA-1 expression. Jmjd2c is reported to assist polycomb repressive complex (PRC) in transcriptional repression. It is overexpressed in several esophageal squamous cell carcinomas.
Specificity
This polyclonal antibody detects Lysine-specific demethylase 4C in multiple human and mouse cell types.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	A1, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable
isotype	IgG2a
UniProt accession no.	P20937,

Узнать цену

Подробнее

Anti-Lysine-Specific Demethylase 4C (JMJD2C)

eCl@ss:	32160702
NACRES:	NA.41

KLH-Conjugated linear peptide corresponding to 18 amino acids from the N-terminal half of human Lysine-specific demethylase 4C.

Anti-Lysine-Specific Demethylase 4C (JMJD2C) Antibody, Cat. No. ABE1409, is a highly specific rabbit polyclonal antibody that targets Lysine-specific demethylase 4C and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Western Blotting Analysis: 2 µg/mL from a representative lot detected Lysine-Specific Demethylase 4C (JMJD2C) in 10 µg of C2C12 and HEK293 nuclear extract.
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected Lysine-Specific Demethylase 4C (JMJD2C) in human tonsil, human cervical cancer, and human liver cancer tissues.
Quality
Evaluated by Western Blotting in BALB/3T3 clone A31 cell nuclear extract.
Western Blotting Analysis: 2 µg/mL of this antibody detected Lysine-Specific Demethylase 4C (JMJD2C) in 10 µg of BALB/3T3 clone A31 nuclear extract.
Target description
~120 kDa observed; 119.98 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
NCBI accession no.	NP_055876,
UniProt accession no.	Q9H3R0,
shipped in	ambient
Gene Information	human ... KDM4C(23081)

Mucosal addressin cell adhesion molecule 1 (UniProt: Q61826; also known as MAdCAM-1, mMAdCAM-1) is encoded by the Madcam1 gene (Gene ID: 17123) in murine species. MAdCAM-1 is a cell adhesion leukocyte receptor that helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It is highly expressed on high endothelial venules (HEV) of organized intestinal lymphoid tissues and mesenteric lymph nodes, and in the lamina propria of the intestine. Its expression is also observed in brain endothelioma cells and mucosal tissues during chronic inflammation. Aberrant expression of MAdCAM-1 has also been reported in the inflamed pancreas. MAdCAM-1 can bind both the integrin alpha-4/beta-7 and L-selectin and is involved in regulating both the passage and retention of leukocytes. It is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off in mature form. MAdCAM-1 has an extracellular domain (aa 22-109), a transmembrane domain (aa 365-385), and a cytoplasmic domain (aa 386-405). It also contains three Ig-like domains (aa 22-109; 110-227; 258-357) and a Mucin-like region (aa 221-257). Two isoforms of MAdCAM-1 have been described that are produced by alternative splicing. Both isoforms can adhere to integrin alpha-4/beta-7. Isoform 2 that lacks the mucin-like domain is believed to be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding. Interaction between integrin alpha 4 and MAdCAM-1 is considered to be important for the homing of diabetogenic T cells to the pancreas. (Ref.: Savinov, AY., et al. (2003). J. Exp. Med. 197(5); 643-656; Rivera-Nieves, J., et al. (2005). J. Immunol. 174(4); 2343-2352).
Specificity
Clone MECA-367 detects Mucosal addressin cell adhesion molecule 1 (MAdCAM-1) in murine cells.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-MAdCAM-1 Antibody, clone MECA-367

Endothelial cells isolated from BALB/c mouse mesenteric and peripheral lymph nodes.

Western Blotting Analysis: A representative lot detected MAdCAM-1 in Western Blotting applications (Streeter, P.R., et. al. (1988). Nature. 331(6151):41-6).
Immunohistochemistry (Paraffin) Analysis: A representative lot detected MAdCAM-1 in Immunohistochemistry applications (Streeter, P.R., et. al. (1988). Nature. 331(6151):41-6).
Immunohistochemistry Analysis: A representative lot detected MAdCAM-1 in Immunohistochemistry applications (Streeter, P.R., et. al. (1988). Nature. 331(6151):41-6; Rantakari, P., et. al. (2016). Nature. 538(7625):392-396).
Neutralizing Analysis: A representative lot neutralizes the action on MAdCAM-1 and reduces chronic ileitis (Rivera-Nieves, J., et. al. (2005). J Immunol. 174(4):2343-52).
Inhibits Activity/Function: A representative lot almost completely inhibited lymphocyte migration to Peyer s patches and also blocked the adhesion of the mucosal high endothelial venules (HEV) binding to T cell lymphoma TK1. (Streeter, P.R., et. al. (1988). Nature. 331(6151):41-6; Briskin, M.J., et. al. (1993). Nature. 363(6428):461-4).
Anti-MAdCAM-1, clone MECA-367, Cat. No. MABF2072, is a rat monoclonal antibody that detects murine Mucosal addressin cell adhesion molecule 1 (MAdCAM-1) and has been tested for use in Immunohistochemistry (Paraffin), Inhibition/Function assays, Neutralizing, and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse colon tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected MAdCAM-1 in mouse colon tissue sections.
Target description
43.65 kDa calculated.
Physical form
Format: Purified
Purified rat monoclonal antibody IgG2a in PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

MAP kinase (MAPK, mitogen-activated protein kinase) is also termed as extracellular regulated protein kinase (ERK). It consists of a family of protein kinases. MAP kinase isoforms are widely expressed in the central nervous system, thymus, spleen, heart, lung, kidney, and in high levels in PC12 cells and in fibroblasts.
Specificity
Staining of the 42 kDa and 44 kDa bands is specifically inhibited with MAP kinase peptide (317-339), but not with MAP kinase kinase (MEK) peptide (34-48) corresponding to N-terminal sequence of MEK. Anti-MAPK Kinase (ERK-1, ERK-2) specifically reacts with both phosphorylated and unphosphorylated forms of ERK-1 and ERK-2 (44 and 42 kDa, respectively).

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	MECA-367, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","neutralization: suitable","western blot: suitable
isotype	IgG2a
NCBI accession no.	XP_006513356.1,
UniProt accession no.	Q61826,

Узнать цену

Подробнее

Anti-MAP Kinase (ERK-1, ERK-2) antibody produced in rabbit

MDL number:	MFCD00282359
NACRES:	NA.44

synthetic peptide corresponding to amino acids 317-339 derived from subdomain XI of human MAP kinase (ERK1).

Anti-MAP Kinase (ERK-1, ERK-2) antibody produced in rabbit has been used in western blot analysis at a minimum dilution of 1:40000 in rat brain extract and at 1:20000 in mouse NIH 3T3 fibroblasts.
Biochem/physiol Actions
Mitogen-activated protein kinase (MAPK) superfamily of enzymes is involved in widespread signalling pathways. Members of this family include the ERK1/2 (extracellular signal-regulated protein kinase, also termed p42/p44 MAPK), JNK and p38 MAPK subfamilies. These are the terminal enzymes in a signalling cascade where each kinase phosphorylates and activates the next member in the sequence. Phosphorylation of both tyrosine and threonine is essential for the full activation of all MAPKs. Several kinases participate in activation of the ERK cascade. This cascade is initiated by the small G protein Ras, which upon stimulation causes activation Raf1 kinase. Raf1 continues the transmission by activating MEK. Activated MEK appears to be the only kinase capable of specifically phosphorylating and activating ERK. ERK appears to be an important regulatory molecule, which by can phosphorylate regulatory targets in the cytosol (phospholipase A2, PLA2), translocated into and phosphorylate substrates in the nucleus (ELK1). The activation of ERK cascade mediates and regulates the signal transduction pathways in response to stress, mitogenic signals and is important in development and differentiation, learning, memory and survival. MAPK plays a crucial role in various signal transduction pathways, leading signals of growth factor and G protein coupled receptors to their intracellular targets. MAP kinase regulates several cellular processes including proliferation, differentiatio, cellular morphology and oncogenesis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	whole antiserum
antibody product type	primary antibodies
clone	polyclonal
mol wt	antigen ERK-2 42 kDa","antigen, ERK-1 44 kDa
contains	15 mM sodium azide
species reactivity	mouse, rat, human
packaging	antibody small pack of 25 µL
application(s)	microarray: suitable","western blot: 1:40,000-1:20,000 using rat brain extract and mouse NIH 3T3 fibroblast extract, respectively
conjugate	unconjugated
UniProt accession no.	P28482,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... MAPK1(5594), MAPK3(5595) mouse ... Mapk1(26413), Mapk3(26417) rat ... Mapk1(116590), Mapk3(50689)

Mitogen-activated protein kinase (MAPK) are also known as the extracellular signal-regulated kinase (ERKs), they exist in two isoforms namely, ERK1 (MAPK3) and ERK2 (MAPK1). ERK2 is mapped to human chromosome 22q11.2. ERK1 is located on human chromosome 16p11.2.
Anti-MAP Kinase, Activated (Diphosphorylated ERK-1&2) antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the MAPK-YT hybridoma produced by the fusion of mouse myeloma cells (NS1) and splenocytes from BALB/c mice immunized with a synthetic phosphorylated peptide containing amino acids corresponding to the phosphorylated form of ERK-activation loop, conjugated to KLH. The isotype is determined by a double diffusion immunoassay using Mouse Monoclonal Antibody Isotyping Reagents, Product Number ISO2.
Specificity
Monoclonal Anti-MAP Kinase, Activated (Diphosphorylated ERK-1&2) is specific for the active, dually-phosphorylated form of MAP kinase (ERK-1 and ERK-2, 44 kDa and 42 kDa, respectively). Reactivity has been observed with human, bovine, rat, mouse, hamster, Xenopus, Drosophila, Spodoptera frugiperda, C. elegans, and yeast.
The antibody reacts specifically with the diphosphorylated form of MAP kinase (ERK-1 and ERK-2). It does not recognize the non-phosphorylated or the monophosphorylated forms of MAP kinase or the diphosphorylated forms of JNK and p38 MAP kinase. The epitope recognized by the antibody contains the phosphorylated threonine and tyrosine residues within the regulatory site of active MAP kinase.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MAP Kinase, Activated (Diphosphorylated ERK-1&2) antibody, Mouse monoclonal

synthetic peptide HTGFLpTEpYVAT corresponding to the phosphorylated form of the ERK-activation loop.

The antibody may be used for immunoblotting applications at a working concentration of 0.5-1.0 µg/mL in cultured cells as well as tissue extracts. A working dilution of 1:80-1:100 is suitable for immunohistochemistry (formalin and formaldehyde-fixed sections). The antibody may also be used for immunocytochemistry, immunoprecipitation, indirect ELISA and protein microarray.
Monoclonal Anti-MAP Kinase, activated (Diphosphorylated ERK-1&2) antibody produced in mouse has been used in detection of

ERK1/2 in cardiac myocytes using immunofluorescence microscopy
ERK1/2 in human eosinophils using western blotting
ERK in human bronchial epithelial cells using protein array
ERK proteins in human liver cell lines using immunofluorescence assay and western blot analysis
ERK1/2 in human embryonic kidney cells by immunoprecipitation

Biochem/physiol Actions
Mitogen-activated protein kinase (MAPK) superfamily of enzymes is involved in widespread signalling pathways. Members of this family include the ERK1/2 (extracellular signal-regulated protein kinase, also termed p42/p44 MAPK), JNK and p38 MAPK subfamilies. These are the terminal enzymes in a signalling cascade where each kinase phosphorylates and activates the next member in the sequence. Phosphorylation of both tyrosine and threonine is essential for the full activation of all MAPKs. Several kinases participate in activation of the ERK cascade. This cascade is initiated by the small G protein Ras, which upon stimulation causes activation Raf1 kinase. Raf1 continues the transmission by activating MEK. Activated MEK appears to be the only kinase capable of specifically phosphorylating and activating ERK. ERK appears to be an important regulatory molecule, which by can phosphorylate regulatory targets in the cytosol (phospholipase A2, PLA2), translocated into and phosphorylate substrates in the nucleus (ELK1). The activation of ERK cascade mediates and regulates the signal transduction pathways in response to stress, mitogenic signals and is important in development and differentiation, learning, memory and survival.
Monoclonal Anti-MAP Kinase, Activated (Diphosphorylated ERK-1 and 2) is specific for the active, dually-phosphorylated form of MAP kinase (ERK-1 and ERK-2, 44 kDa and 42 kDa, respectively). The epitope recognized by the antibody contains the phosphorylated threonine and tyrosine residues within the regulatory site of active MAP kinase (Thr183 and Tyr185 in ERK-2). It does not recognize the non-phosphorylated or the monophosphorylated forms of the MAP kinase molecule or the diphosphorylated form of Jun-kinase (JNK) and p38 MAP kinase.
Signaling pathways mediated by MAPK are associated in the pathogenesis of neurodegenerative disorders and cancer. Deletion in the ERK1 gene locus is associated with DiGeorge syndrome (DGS) and velocardiofacial syndrome (VCFS) and congenital heart defects. Rearrangements in MAPK3 gene locus may contribute in the pathogenesis of autism spectrum disorders and schizophrenia.
Physical form
Solution in phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze in working aliquots at -20 °C. Repeated freezing and thawing, or storage in frost free freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

purified immunoglobulin

antibody product type

buffered aqueous solution

mol wt

antigen ERK-1 44 kDa","antigen ERK-2 42 kDa

species reactivity

mouse, Xenopus, Drosophila, Caenorhabditis elegans, rat, yeast, hamster, bovine, human

packaging

antibody small pack of 25 µL

concentration

1.5-2 mg/mL

application(s)

immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","immunoprecipitation (IP): suitable","indirect ELISA: suitable","microarray: suitable","western blot: 0.5-1 µg/mL using a whole cell extract of RAT-1 cells treated with vanadate and H₂O₂.

UniProt accession no.

human ... MAPK1(5594), MAPK3

MAP-2 (microtubule associated protein-2) is one of several high molecular weight proteins that play an important role in brain neuron microtubule assembly. In addition to its association with microtubules, MAP-2 associates with neurofilaments and actin filaments suggesting that it may guide interaction among microtubules, other cytoskeletal elements, and cytoplasmic organelles. MAP-2 is a stringent marker for neurons. In addition, MAP-2 displays intracellular specificity. In the central nervous system, MAP-2 is confined to neuronal cell bodies and dendrites. There are exceptions, however, where some axons stain positive for small amounts of MAP-2. MAP-2 is uniformly distributed throughout the cell when first expressed in cultured neurons but becomes selectively localized as dendritic development proceeds. (Caceres, 1986; Dotti, 1987).
Specificity
MAB3418 binds specifically to MAP-2.
Expected to cross-react with human, cow, chicken, quail, and Xenopus.

Anti-MAP2 Antibody, clone AP20

eCl@ss:	32160702
NACRES:	NA.41

Bovine brain microtubule protein.

Research Sub Category
Neuronal & Glial Markers
Anti-MAP2 Antibody, clone AP20 detects level of MAP2 & has been published & validated for use in IH & WB.
Western Blot:
60 ng/mL. In SDS-PAGE, MAP-2 from adult rat migrates as a closely associated doublet having a molecular weight of approximately 280-300 kD representing the MAP-2A and -2B isoforms but not the 70 kDa MAP-2C isoform. However, early in brain development (postnatal day 10 in rats), MAP-2 migrates as a single band that is identical to the lower molecular weight band of the adult MAP-2 doublet (MAP-2b). Later in development (postnatal days 17-18), the mobility of MAP-2 changes to the adult doublet form. (In the spinal cord, conversion to the adult form occurs earlier). Users should run 4%-20% SDS-PAGE gradient gels.
Immunohistochemistry:
5 µg/mL (4% PFA fixed frozen sections).
Immunohistochemistry:
5 µg/mL of a previous lot was used. Anti-MAP-2 can be used to stain tissue (brain or spinal cord) fixed with paraformaldehyde.
Optimal working concentrations must be determined by the end user.
Research Category
Neuroscience
Quality
Routinely evaluated by Western Blot on Rat Brain lysate.
Western Blot Analysis:
1:1000 dilution of this lot detected MAP2 on 10 µg of Rat Brain lysate.
Target description
230 kDa
Physical form
Format: Purified
Protein A purified
Purified mouse monoclonal IgG1 in buffer containing 0.02 M Phosphate buffer, pH 7.6, 0.25 M NaCl with 0.1% sodium azide.
Storage and Stability
Stable for 6 months at 2-8°C in undiluted aliquots from date of receipt.
During shipment, small volumes of product will occasionally become entrapped in the seal of the product vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container’s cap.
Analysis Note
Control
Brain, Neuronal culture, Human glioblastoma T98G cells.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	AP20, monoclonal
species reactivity	mouse, rat, quail, Xenopus, chicken, bovine, human
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	immunohistochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NM_001039538.1,
UniProt accession no.	P11137,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

MAP2 is the major microtubule associated protein of brain tissue. There are three forms of MAP2; two are similarly sized with apparent molecular weights of 280 kDa (MAP2a and b) and the third with a lower molecular weight of 70 kDa (MAP2c). In the newborn rat brain, MAP2b and MAP2c are present while MAP2a is absent. Between postnatal days 10 and 20, MAP2a appears at levels equal to that of MAP2b. At the same time, the level of MAP2c drops by 10-fold. This change happens during the period when dendrite growth is completed and neurons have reached their mature morphology.
MAP2 is known to promote microtubule assembly and to form side arms on microtubules. It also interacts with neurofilaments, actin and other elements of the cytoskeleton.
Specificity
Reacts with all known forms of MAP2, namely MAP2a, MAP2b and MAP2c. Does not cross-react with other MAPs or tubulin. By immunohistochemical staining of formalin-fixed, paraffin-embedded brain tissue, the antibody shows selective labeling of dendritic trees throughout the brain.
This antibody recognizes all known forms of MAP2, namely MAP2a, MAP2b and MAP2c. It does not cross-react with other MAPs or tubulin. By immunohistochemical staining of formalin-fixed, paraffin-embedded brain tissue, the antibody shows selective labeling of dendritic trees throughout the brain.

Anti-MAP2 antibody, Mouse Monoclonal

MDL number:	MFCD00164683
NACRES:	NA.41

rat brain microtubule-associated proteins (MAPs).

Anti-MAP2 antibody has been used in immunofluorescence. It has also been used in immunohistochemistry.
May be used in various immunochemical techniques including immunoblotting, immunohistochemistry, and immunocytochemistry. Monoclonals antibodies to MAP2 are used to study the cytoskeleton structure in cells.
By immunoblotting, a working antibody concentration of 1-2 µg/ml is recommended using a rat brain extract.
Packaging
200 μL in glass insert
Biochem/physiol Actions
MAP2 (microtubule-associated protein 2) expression is monitored to predict the disease progression in glioma. MAP2 is critical in the formation of dendritic protrusions in astrocytes and oligodendrocytes. In eukaryotes, MAP2 is essential for spindle assembly and chromosome segregation.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, and 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 C for up to one month. For extended storage, freeze in working aliquots at 20 C. Repeated freezing and thawing, or storage in frost-free freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	HM-2, monoclonal
form	buffered aqueous solution
mol wt	antigen ~280 kDa
species reactivity	rat, mouse, chicken, human, bovine, quail
packaging	antibody small pack of 25 µL
concentration	~2 mg/mL
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable","microarray: suitable","western blot: 1-2 µg/mL using rat brain extract
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	P11137,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... MAP2(4133) mouse ... Mtap2(17756) rat ... Map2(25595)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Structural polyprotein (UniProt: Q8QZ72; also known as p130) is encoded by the MAYVgp3 gene (Gene ID: 935141) in Mayaro virus. Following its synthesis it is cleaved into the following six chains: Capsid protein (aa 1-258), Precursor of protein E3/E2 (aa 259-746), Assembly protein E3 (aa 259-324), Spike glycoprotein E2 (aa 325-746), 6K protein (aa 747-806), and Spike glycoprotein E1 (aa 807-1242). Mayaro virus (MAYV) is a mosquito-transmitted arthritogenic alphavirus in the Togaviridae family of positive-stranded RNA viruses. Its envelope glycoproteins associate in the endoplasmic reticulum and form a heterotrimer comprised of the E3, E2, and E1 proteins. E2 is a single-pass type I membrane protein that plays a role in viral attachment to target host cell, by binding to the cell receptor. It is synthesized as a p62 precursor (precursor of protein E3/E2), which is then processed by furin at the cell membrane just before virion budding, giving rise to E2-E1 heterodimer. The p62-E1 heterodimer is shown to be stable, whereas E2-E1 is unstable and dissociates at low pH. It has been reported that p62 is processed at the last step, presumably to avoid E1 fusion activation before its final export to cell surface. The C-terminus region of E2 contains a transitory transmembrane region that is disrupted by palmitoylation and results in reorientation of the C-terminal tail from lumenal to cytoplasmic side. Clone MAY-134 offers protection against lethal effects of MAYV in a murine model when injected one day prior to virus inoculation. However, its protective effects are significantly reduced when injected two days post infection. It also promotes phagocytosis of MAYV antigen-coated beads in murine neutrophils and monocytes. This clone displays higher protective activity as IgG2a than IgG1 even though their neutralizing activity in vitro and half-lives in vivo were identical. (Ref.: Earnest, JT., et al. (2019). J. Exp. Med. 216(10); 2282-2301).
Specificity
Clone MAY-134 is a mouse monoclonal antibody that detects E2 protein of Mayaro virus. It targets an epitope within the B domain in the extracellular region.

Anti-Mayaro Virus E2 Antibody, clone MAY-134

MAYV strain CH and boosted twice with recombinant, bacterially produced MAYV E2 ectodomain (amino acids 1-340) in Freund s incomplete adjuvant.

Anti-Mayaro Virus E2, clone MAYV-134 , Cat. No. MABF3046, is a mouse monoclonal antibody that detects E2 protein of Mayaro virus CH and is tested for use in ELISA and Neutralizing applications.
Quality Control Testing
Evaluated by ELISA with recombinant Mayaro virus E2 protein.
ELISA Analysis (ELISA): Various dilutions of this antibody detected recombinant E2 protein of Mayaro virus CH (strain Peru).
Tested Applications
Neutralizing: A representative lot neutralized Mayaro Virus E2 in Neutralizing applications (Earnest, J.T., et al. (2019). J Exp Med. 216(10): 2282-2301).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Storage and Stability
Store at -10°C to -25°C. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	MAYV-134, monoclonal
mol wt	calculated mol wt 137.06 kDa
purified by	using protein G
species reactivity	virus
packaging	antibody small pack of 100 µL
application(s)	ELISA: suitable","neutralization: suitable
isotype	IgG2a
epitope sequence	Extracellular domain
conjugate	unconjugated
UniProt accession no.	DQ487410,
shipped in	dry ice

Methyl-CpG-binding domain protein 5 (UniProt: Q9P267; also known as Methyl-CpG-binding protein MBD5) is encoded by the MBD5 (also known as KIAA1461) gene (Gene ID: 55777) in human. MBD proteins play a role in diverse processes, including chromatin remodeling, DNA damage repair, histone methylation, and X chromosome inactivation. MBD5 is detected in heart, placenta, liver, skeletal muscle, kidney, and pancreas. It binds to heterochromatin, but does not interact with either methylated or unmethylated DNA (in vitro). It contains a MBD domain (aa 11-81) and a PWWP (Pro-Trp-Trp-Pro) domain (aa 1385-1447). Both MBD and PWWP domains are shown to be essential for chromocentric localization. Two isoforms of MBD5 have been reported that are produced by alternative splicing. However, only the isoform 1 associates with pericentric heterochromatin. Mutations in MBD5 gene are known to cause autosomal dominant mental retardation, which is characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior. (Ref.: Camarena, V et al., (2014). EMBO Mol. Med. 6(8); 1003 1015).
Specificity
This rabbit polyclonal antibody detects isoform 1 of human Methyl-CpG-binding domain protein 5. It targets an epitope within 16 amino acids fromt the C-terminal region.

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MBD5

KLH-conjugated linear peptide corresponding to 16 amino acids from the C-terminal region of human Methyl-CpG-binding domain protein 5 (MBD5).
Epitope: unknown

Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected MBD5 in human pancreas and human cervical cancer tissue sections
Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected MBD5 in HeLa, A431, and HEK293 cells.
Western Blotting Analysis: 2 µg/mL from a representative lot detected MBD5 in human liver tissue lysate.
Research Category
Epigenetics & Nuclear Function
Anti-MBD5, Cat. No. ABE1322, is a highly specific rabbit polyclonal antibody that targets Methyl-CpG-binding domain protein 5 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Immunohistochemistry in human prostate tissue sections.
Immunohistochemistry Analysis: A 1:250 dilution of this antibody detected MBD5 in human prostate tissue sections.
Target description
~160 kDa observed; 159.89 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Methyl-CpG-binding domain protein 6 (UniProt: Q96DN6; also known as Methyl-CpG-binding protein MBD6) is encoded by the MBD6 (also known as KIAA1887) gene (Gene ID: 114785) in human. The methyl-CpG-binding domain (MBD) proteins are primary candidates for the readout of DNA methylation. MBD proteins require a functional MBD domain and methyl-CpGs, although some MBD proteins can also bind unmethylated DNA. MBD proteins are involved in transcriptional repression by histone modification, nucleosome remodeling or chromatin organization. MBD6 is highly expressed in testes. Its MBD domain is localized in the N-terminal region (aa 11-81) and it also contains proline-rich domains. MBD6 binds to heterochromatin, but does not interact with either methylated or unmethylated DNA. MBD6 is reported to interact directly with the human polycomb deubiquitinase complex, PR-DUB, which catalyzes deubiquitination of H2AK119. Mutations in MBD6 that lead to R883W alteration are reported to cause autism. (Ref.: Cukier, HN., et al. (2012). Autism Res. 5(6); 385-397; Du, Q., et al. (2015). Epigenomics 7(6); 1051-1073).
Specificity
This rabbit polyclonal antibody detects Methyl-CpG-binding domain protein 6 in human and murine cells. It targets an epitope within 16 amino acids from the N-terminal half.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
species reactivity (predicted by homology)	mouse (based on 100% sequence homology), rat (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
NCBI accession no.	NP_060798.2,
UniProt accession no.	Q9P267,
Gene Information	human ... MBD5(55777)

Anti-MBD6

KLH-conjugated linear peptide corresponding to 16 amino acids from the N-terminal half of human Methyl-CpG-binding domain protein 6.

Anti-MBD6, Cat. No. ABE1321, is a highly specific rabbit polyclonal antibody that targets Methyl-CpG-binding domain protein 6 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected MBD6 in HeLa, A431, HEK293, and NIH3T3 cells.
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected MBD6 in human skin and human stomach tissue sections.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in SH-SY5Y cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MBD6 in SH-SY5Y cell lysate.
Target description
~110 kDa observed; 101.20 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
NCBI accession no.	NP_443129.3,
UniProt accession no.	Q96DN6,
Gene Information	human ... MBD6(114785)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Myelin basic protein (UniProt: P02686; also known as MBP, Myelin A1 protein, Myelin membrane encephalitogenic protein) is encoded by the MBP gene (Gene ID: 4155) in human. MBP is a homodimeric protein that is found in both the central and the peripheral nervous system. It is one of the most abundant protein component of the myelin membrane in the CNS and plays a role in both the formation and stabilization of this myelin membrane. It is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin. MBP can interact with many polyanionic proteins including actin, tubulin, calmodulin, and clathrin, and with negatively charged lipids. MBP isoforms are found in both the central and the peripheral nervous system, whereas Golli-MBP isoforms are expressed in fetal thymus, spleen and spinal cord, as well as in cell lines derived from the immune system. MBP expression begins abruptly in 14-16-week-old fetuses. Even smaller isoforms seem to be produced during embryogenesis; some of these persisting in the adult. MBP citrullination by peptidylarginine deiminase (PAD) leads to incomplete protein-lipid bilayer interactions and increases its vulnerability to proteolytic enzymes, resulting in disorganization of the myelin sheath in the central nervous system. Citrullinated MBP (citMBP) has been suggested to be a hallmark of demyelination. MBP citrullination has frequently been demonstrated in various CNS disorders. citMBP at R25, R122, and R130 is reported in the brains of subjects with Creutzfeldt-Jakob disease (CJD). Clone 1H1 specifically recognizes citMBP at R122. (Ref.: Jang, B., et al. (2017). Mol. Neurobiol. 55(4); 3172-3184; Boggs, JM (2006). Cell. Mol. Life Sci. 63(17); 1945-1961).
Specificity
Clone 1H1 is a mouse monoclonal antibody that detects human and murine myelin basic protein citrullinated on residue 122. It targets an epitope with in 19 amino acids from the C-terminal half.

Anti-MBP (Citrulline R122) Antibody, clone 1H1

KLH-conjugated linear peptide corresponding to 19 amino acids from isoform 5 of human Myelin Basic Protein with citrullination on residue 122.

Research Category
Cell Structure
Anti-MBP (Citrulline R122), clone 1H1, Cat. No. MABT1499, is a mouse monoclonal antibody that detects Myelin basic protein citrullinated on residue 122 and has been is tested for use in ELISA, Immunohistochemistry, and Western Blotting.
ELISA Analysis: A representative lot detected MBP (Citrulline R122) in ELISA applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Western Blotting Analysis: A representative lot detected MBP (Citrulline R122) in Western Blotting applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected MBP (Citrulline R122) in Myelin basic protein (MBP) treated with human PAD2 (Courtesy of Byungki Jang, Ph.D./Eun-Kyoung Choi, Ph.D., Ilsong Institute of Life Science, Hallym University, South Korea).
Immunohistochemistry Analysis: A representative lot detected MBP (Citrulline R122) in Immunohistochemistry applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
(Courtesy of Byungki Jang, Ph.D./Eun-Kyoung Choi, Ph.D., Industry Academic Cooperation Foundation, Hallym University, South Korea).
Quality
Evaluated by Western Blotting in GST-tagged myelin basic protein (MBP) treated with human PAD-2.
Western Blotting Analysis: 1 µg/mL of this antibody detected MBP (Citrulline R122) in GST-tagged myelin basic protein (MBP) treated with human Peptidyl Arginine Deiminase 2 (PAD-2)(200 ng for 4 h at 37°C).
Target description
~41 kDa observed; 18.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	1H1, monoclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001020252,
UniProt accession no.	P02686,

Myelin basic protein (UniProt: P02686; also known as MBP, Myelin A1 protein, Myelin membrane encephalitogenic protein) is encoded by the MBP gene (Gene ID: 4155) in human. MBP is a homodimeric protein that is found in both the central and the peripheral nervous system. It is one of the most abundant protein component of the myelin membrane in the CNS and plays a role in both the formation and stabilization of this myelin membrane. It is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin. MBP can interact with many polyanionic proteins including actin, tubulin, calmodulin, and clathrin, and with negatively charged lipids. MBP isoforms are found in both the central and the peripheral nervous system, whereas Golli-MBP isoforms are expressed in fetal thymus, spleen and spinal cord, as well as in cell lines derived from the immune system. MBP expression begins abruptly in 14-16-week-old fetuses. Even smaller isoforms seem to be produced during embryogenesis; some of these persisting in the adult. MBP citrullination by peptidylarginine deiminase (PAD) leads to incomplete protein-lipid bilayer interactions and increases its vulnerability to proteolytic enzymes, resulting in disorganization of the myelin sheath in the central nervous system. Citrullinated MBP (citMBP) has been suggested to be a hallmark of demyelination. MBP citrullination has frequently been demonstrated in various CNS disorders. citMBP at R25, R122, and R130 is reported in the brains of subjects with Creutzfeldt-Jakob disease (CJD). Clone 3C6 specifically recognizes citMBP at R130. (Ref.: Jang, B., et al. (2017). Mol. Neurobiol. 55(4); 3172-3184; Boggs, JM (2006). Cell. Mol. Life Sci. 63(17); 1945-1961).
Specificity
Clone 3C6 is a mouse monoclonal antibody that detects human and murine myelin basic protein citrullinated on residue 130. It targets an epitope with in 19 amino acids from the C-terminal half.

Anti-MBP (Citrulline R130) Antibody, clone 3C6

KLH-conjugated linear peptide corresponding to 19 amino acids from isoform 5 of human Myelin Basic Protein with citrullination on residue 130.

Immunohistochemistry Analysis: A representative lot detected MBP (Citrulline R130) in Immunohistochemistry applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected MBP (Citrulline R130) in Myelin basic protein (MBP) treated with human PAD2 (Courtesy of Byungki Jang, Ph.D./Eun-Kyoung Choi, Ph.D., Ilsong Institute of Life Science, Hallym University, South Korea).
Western Blotting Analysis: A representative lot detected MBP (Citrulline R130) in Western Blotting applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
ELISA Analysis: A representative lot detected MBP (Citrulline R130) in ELISA applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Research Category
Cell Structure
Anti-MBP (Citrulline R130), clone 3C6, Cat. No. MABT1488, is a mouse monoclonal antibody that detects Myelin basic protein citrullinated on residue 130 and has been tested for use in ELISA, Immunohistochemistry, and Western Blotting.
Quality
Evaluated by Western Blotting in GST-tagged myelin basic protein (MBP) treated with human PADI-2.
Western Blotting Analysis: 4 µg/mL of this antibody detected MBP (Citrulline R130) in GST-tagged myelin basic protein (MBP) treated with human Peptidyl Arginine Deiminase 2 (PAD-2)(200 ng for 4 h at 37°C).
Target description
~41 kDa observed; 18.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	3C6, monoclonal
species reactivity	human, mouse
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001020252,
UniProt accession no.	P02686,

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Myelin basic protein (UniProt: P02686; also known as MBP, Myelin A1 protein, Myelin membrane encephalitogenic protein) is encoded by the MBP gene (Gene ID: 4155) in human. MBP is a homodimeric protein that is found in both the central and the peripheral nervous system. It is one of the most abundant protein component of the myelin membrane in the CNS and plays a role in both the formation and stabilization of this myelin membrane. It is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin. MBP can interact with many polyanionic proteins including actin, tubulin, calmodulin, and clathrin, and with negatively charged lipids. MBP isoforms are found in both the central and the peripheral nervous system, whereas Golli-MBP isoforms are expressed in fetal thymus, spleen and spinal cord, as well as in cell lines derived from the immune system. MBP expression begins abruptly in 14-16-week-old fetuses. Even smaller isoforms seem to be produced during embryogenesis; some of these persisting in the adult. MBP citrullination by peptidylarginine deiminase (PAD) leads to incomplete protein-lipid bilayer interactions and increases its vulnerability to proteolytic enzymes, resulting in disorganization of the myelin sheath in the central nervous system. Citrullinated MBP (citMBP) has been suggested to be a hallmark of demyelination. MBP citrullination has frequently been demonstrated in various CNS disorders. citMBP at R25, R122, and R130 is reported in the brains of subjects with Creutzfeldt-Jakob disease (CJD). Clone 1B8 specifically recognizes citMBP at R25. (Ref.: Jang, B., et al. (2017). Mol. Neurobiol. 55(4); 3172-3184; Boggs, JM (2006). Cell. Mol. Life Sci. 63(17); 1945-1961).
Specificity
Clone 1B8 is a mouse monoclonal antibody that detects human and murine myelin basic protein citrullinated on residue 25. It targets an epitope with in 18 amino acids from the N-terminal region.

Anti-MBP (Citrulline R25) Antibody, clone 1B8

KLH-conjugated linear peptide corresponding to 18 amino acids from isoform 5 of human Myelin Basic Protein with citrullination on residue 25.

Research Category
Cell Structure
Anti-MBP (Citrulline R25), clone 1B8, Cat. No. MABT1510, is a mouse monoclonal antibody that detects is Myelin basic protein citrullinated on residue 25 and has been tested for use in ELISA, Electron Microscopy, Immunofluorescence, Immunohistochemistry, and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected MBP (Citrulline R25) in Immunohistochemistry applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Electron Microscopy Analysis: A representative lot detected MBP (Citrulline R25) in Electron Microscopy applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected MBP (Citrulline R25) in Myelin basic protein (MBP) treated with human PAD2 (Courtesy of Byungki Jang, Ph.D./Eun-Kyoung Choi, Ph.D., Ilsong Institute of Life Science, Hallym University, South Korea).
Immunofluorescence Analysis: A representative lot detected MBP (Citrulline R25) in Immunofluorescence applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Western Blotting Analysis: A representative lot detected MBP (Citrulline R25) in Western Blotting applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
ELISA Analysis: A representative lot detected MBP (Citrulline R25) in ELISA applications (Jang, B., et. al. (2018). Mol Neurobiol. 55(4):3172-3184).
Quality
Evaluated by Western Blotting in Myelin basic protein (MBP) either treated with human PAD-2.
Western Blotting Analysis: 1 µg/mL of this antibody detected Myelin basic protein (MBP) treated with human human Peptidyl Arginine Deiminase 2 (PAD-2) (200 ng for 4 hours at 37°C) with R25 citrullination.
Target description
~19 kDa observed; 18.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	1B8, monoclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","electron microscopy: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001020252,
UniProt accession no.	P02686,

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

MUC18 antigen (CD146), a member of the immuoglobulin superfamily, is an intrinsic membrane glycoprotein of 110-120 kDa found on the surface of endothelial cells, bone marrow fibroblasts and various melanomas. MUC18 has been used as a marker of tumor progression in human melanoma because expression in those tumors correlates strongly with poor prognosis and the development of metastic disease. In addition, a number of human T, B and myeloid leukemic cell lines seem to express MUC18. The close structural relationship with N-CAM and related molecules suggests that MUC18 may be also a developmentally regulated cell adhesion molecule (Melanoma adhesion molecule or MCAM).
Specificity
Detects circulating endothelial cells in human. Expected to cross-react with dog & mouse.

Anti-MCAM Antibody, clone P1H12

eCl@ss:	32160702
NACRES:	NA.41

Immunization of mice with HUVEC.

Immunocytochemistry:
1-10 µg/mL of a previous lot worked in immunocytochemistry.Works best on EDTA or Trypsin lifted endothelial cells.
Immunohistochemistry:
1-10 µg/mL. 4% PFA for 30min RT or <2hrs at 4°C. Block w/ 1%BSA/0.2% tween20/PBS for 30min. Works well in frozen tissue; fixed or unfixed.
Immunoprecipitation:
1-10 µg/mL of a previous lot worked in immunoprecipitation.
ELISA:
1-10 µg/mL of a previous lot worked in ELISA.
FACS Analysis:
1-10 µg/mL of a previous lot worked in FACS.
Optimal working dilutions must be determined by end user.
Anti-MCAM Antibody, clone P1H12 detects level of MCAM & has been published & validated for use in ELISA, FC, IC, IH, IP & WB.
Quality
Routinely evaluated by Western Blot on HUVEC lysates.
Western Blot Analysis:
1:500 dilution of this lot detected MCAM on 10µg of HUVEC lysates.
Target description
110 kDa
Physical form
Format: Purified
Purified mouse monoclonal IgG1 in buffer containing 0.02 M PB with 0.25 M NaCl, pH=7.6, with 0.1% sodium azide.
Analysis Note
Control
HUVEC cells.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	P1H12, monoclonal
species reactivity	mouse, human, canine
should not react with	rat
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	ELISA: suitable","flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
suitability	not suitable for immunohistochemistry (Paraffin)
NCBI accession no.	NM_006500.2,
UniProt accession no.	P43121,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... MCAM(4162)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Mcl-1 (Induced myeloid leukemia cell differentiation protein) is a potential transmembrane protein associated with the mitochondria belonging to the Bcl-2 family of proteins. Members of the Bcl-2 family have known participation in regulatory roles for apoptosis, cell growth, and differentiation. The hydrophobic carboxyl terminus is conserved among members of this family and in other members has proven to be a transmembrane region. Mcl-1 is found to be expressed early in myeloid differentiation. Two separate isoforms of Mcl-1 exist with opposing functions. Full length Mcl-1 (Isoform 1) promotes cell viability, over proliferation. Isoform 2 results from the skipping of the central exon of Mcl-1 during mRNA processing and the joining of the first and third exons. The function of the resulting protein induces apoptosis when accumulated. Pro-apoptotic function is shown to increase when isoform 1 and 2 dimerize.

Anti-Mcl-1 Antibody, clone RC13

eCl@ss:	32160702
NACRES:	NA.41

Recombinant protein corresponding to human Mcl-1.

Research Sub Category
BCL2 & Inhibition
Immunohistochemistry Analysis: A previous lot was used by an independent laboratory in follicular lymphoma, diffuse large cell lymphoma, and polymorphic lymphoma tissues. (Zhou, P., et al. (2001). Blood. 97(12):3902-3909).
Immunoprecipitation Analysis: A previous lot was used by an independent laboratory in IP (Han, J., et al. (2005). Biological Chemistry. 280:16383-16392).
Detect Mcl-1 using this Anti-Mcl-1 Antibody, clone RC13 validated for use in WB, IH & IP.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blot in Raji cell lysate.
Western Blot Analysis: A 1:1,000 dilution of this antibody detected Mcl-1 in 10 µg of Raji cell lysate.
Target description
~37 kDa observed

Linkage

Replaces: MAB4602
Physical form
Protein G Purified
Purified mouse monoclonal IgG1κ in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
Raji cell lysate
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	RC13, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_068779,
UniProt accession no.	Q07820,
shipped in	ambient
Gene Information	human ... MCL1(4170)

Merkel cells are neuroendocrine cells found in skin that have synaptic contacts with somatosensory afferents. These cells can turn malignant and form an aggressive form of skin cancer, which is known as Merkel cell carcinoma (MCC). A vast majority of MCC are caused by a polyomavirus known as Merkel cell polyomavirus (MCPyV or MCV). The MCPyV genome is reported to undergo clonal integration into the host cell chromosomes of MCC tumors and expresses small T antigen and truncated large T antigen. Full-length MCPyV large T-antigen is a 125 kDa nuclear protein, however, MCPyV T-antigens obtained from MCC have natural truncating mutations, which result in variably-sized, smaller proteins. Based on homology to other polyomaviruses, the MCPyV large and small T antigens are predicted to be oncogenic and contribute directly to the carcinogenesis of MCC. MCPyV large T antigen can serve as a specific marker for MCC.
Specificity
Clone CM2B4 is highly specific for MCPyV large T and 57kT isoforms, but does not detect MCPyV small T antigen.

Anti-MCPyV large T-antigen Antibody, clone CM2B4

KLH-conjugated linear peptide corresponding to RSRKPSSNASRGA sequence from the Merkel cell polyomavirus large T antigen exon 2 with a C-terminal cystiene.

Anti-MCPyV large T-antigen, clone CM2B4, Cat. No. MABF2044, is a mouse monoclonal antibody that detects MCPyV large T antigen and has been tested for use in Immunohistochemistry, Immunoprecipitation, and Western Blotting for the detection of Merkel cell polyomavirus.
Western Blotting Analysis: A representative lot detected MCPyV large T-antigen in Western Blotting applications (Liu, X., et. al. (2011). J Biol Chem. 286(19):17079-90; Rodig, S.J., et. al. (2012) J Clin Invest. 122(12):4645-53).
Immunoprecipitation Analysis: A representative lot detected MCPyV large T-antigen in Immunoprecipitation applications (Liu, X., et. al. (2011). J Biol Chem. 286(19):17079-90).
Immunohistochemistry Analysis: A representative lot detected MCPyV large T-antigen in Immunohistochemistry applications (Rodig, S.J., et. al. (2012) J Clin Invest. 122(12):4645-53; Busam, K.J., et. al. (2009). Am J Surg Pathol. 33(9):1378-85).
Quality
Evaluated by Western Blotting in MKL-1 cell lysates.
Western Blotting Analysis: 1 µg/mL of this antibody detected MCPyV large T-antigen in 10 µg of MKL-1 cell lysates.
Target description
45 kDa observed for truncaed form. For intact form MW 125 kDaUncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

Quality Level	100,
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	CM2B4, monoclonal
species reactivity	human
packaging	antibody small pack of 25 μg
application(s)	immunohistochemistry: suitable, immunoprecipitation (IP): suitable, western blot: suitable
isotype	IgG2bκ
shipped in	ambient

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Human Protein Atlas Number:

Anti-MDH1 antibody produced in rabbit

HPA027296 Human Protein Atlas characterization data

malate dehydrogenase 1, NAD (soluble) recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77854,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500
immunogen sequence	AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
conjugate	unconjugated
UniProt accession no.	P40925,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MDH1(4190)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

MDM2 is over-expressed in many tumors. Its principal function is the ubiquitination and degradation of p53 tumor suppressor protein. This monoclonal antibody also recognizes a peptide epitope around Thr-216 of murine MDM2 when Thr-216 is unphosphorylated. SMP14 also cross reacts with some cytokeratins (6, 14 & 16). This is only a problem when working with certain epithelial cells and not fibroblasts.
Specificity
This antibody recognizes MDM2.

Anti-MDM2 Antibody, clone 3G9

eCl@ss:	32160702
NACRES:	NA.41

His-tagged recombinant protein corresponding to human MDM2.
Epitope: Unknown

Research Sub Category
RNA Metabolism & Binding Proteins
Ubiquitin & Ubiquitin Metabolism
Immunoprecipitation Analysis: A representative lot was used by an independent laboratory for this application. (Changgong, L., et al. (2002). Molecular and Cellular Biology. 22(21):7562-7571.)
Research Category
Epigenetics & Nuclear Function
Anti-MDM2 Antibody, clone 3G9 is a Mouse Monoclonal Antibody for detection of MDM2 also known as Double minute 2 protein or Mdm2 p53 binding protein homolog & has been validated in WB, IP, ICC & IHC.
Quality
Evaluated by Western Blot in MCF-7 cell lysate.
Western Blot Analysis: 0.5 µg/ml of this antibody detected MDM2 on 10 µg of MCF-7 cell lysate.
Target description
~ 75 kDa
Physical form
Protein G Purified
Purified mouse monoclonal IgGκ in buffer containing 0.1 M Tris-Glycine (pH 7.4, 150 mM NaCl) with 0.05% sodium azide.
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
MCF-7 cell lysate

Quality Level	100
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	3G9, monoclonal
species reactivity	human
species reactivity (predicted by homology)	mouse (based on 100% sequence homology)
packaging	antibody small pack of 25 µL
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
NCBI accession no.	NP_002383.2,
UniProt accession no.	Q00987,
shipped in	ambient

NA methyltransferases methylate the 5-position of cytosine in the context of CpG dinucleotides. DNA methylation is crucial for normal embryonic development, imprinting, and X chromosome inactivation. Methyl CpG binding proteins (MeCPs) specifically recognize methylated regions of DNA and repress transcription both directly and by association with known corepressor proteins which include members of the histone deacetylase protein families.
Specificity
Recognizes MeCP2, Mr 75 kDa. A protein at ~75 kDa was also observed in HeLa nuclear extract. This protein was competed by pre-incubation of the antibody with the immunogenic peptide, suggesting that some HeLa strains contain MeCP2 or a related protein, contrary to a previous report.
Predicted to cross-react with human based on the conservation of the immunogenic sequence.

Anti-MeCP2 Antibody

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated, synthetic peptide corresponding to amino acids 465-478 of mouse MeCP2 (C-PRPNREEPVDSRTP) with an N-terminal cysteine added for conjugation purposes.

Use Anti-MeCP2 Antibody (rabbit polyclonal antibody) validated in WB to detect MeCP2 also known as MeCP-2 protein, mental retardation X-linked 16, mental retardation X-linked 79, methyl CpG binding protein 2.
Research Sub Category
Histones
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blot on Mouse Brain lysates.
Target description
~75 kDa observed
Physical form
Format: Purified
Purified rabbit polyclonal IgG in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide.
Protein A purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
Mouse Brain lysate.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat, mouse
packaging	antibody small pack of 25 µg
Торговая марка	Upstate^®
application(s)	western blot: suitable
isotype	IgG
NCBI accession no.	NP_004983,
UniProt accession no.	P51608,
shipped in	ambient

Mediator of RNA polymerase II transcription subunit 25 (UniProt: Q71SY5; also known as Activator interaction domain-containing protein 1, Activator-recruited cofactor 92 kDa component, ARC92, Mediator complex subunit 25, p78) is encoded by the MED25 (also known as ACID1, ARC92, PTOV2, TCBAP0758) gene (Gene ID: 81857) in human. It is a member of the Mediator complex subunit 25 family that is ubiquitously expressed. Higher expression levels are observed in brain, heart, kidney, peripheral leukocytes, placenta, skeletal muscle and spleen. It acts as a coactivator that is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator complex subunit 25 functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. It is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Six isoforms of Mediator complex subunit 25 have been described that are generated by alternative splicing. Defects in MED25 gene are known to cause Charcot-Marie-Tooth disease 2B2, a disorder of the peripheral nervous system characterized by progressive weakness and atrophy.
Specificity
This rabbit polyclonal antibody detects Mediator of RNA polymerase II transcription subunit 25 (MED25) in human and murine species. it targets an epitope within 16 amino acids from the internal region. Detects all isoforms of Mediator complex subunit 25.

Anti-Mediator complex subunit 25

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 16 amino acids from the internal region of human Mediator of RNA polymerase II transcription subunit 25 (MED25).

Research Category
Epigenetics & Nuclear Function
Anti-Mediator complex subunit 25, Cat. No. ABE1420, is a highly specific rabbit polyclonal antibody that targets MED25 and has been tested in Immunohistochemistry (Paraffin), Peptide Inhibition Assay, and Western Blotting.
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected Mediator complex subunit 25 in human cerebellum and mouse cerebral cortex tissues.
Peptide Inhibition Analysis: 2 µg/mL from a representative lot blocked Mediator complex subunit 25 in mouse brain tissue lysate.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Mediator complex subunit 25 in 10 µg of HeLa cell lysate.
Target description
~70 kda observed; 78.17 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1M Tris-Glycine, 0.15 M NaCl, pH 7.4 with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human, mouse
species reactivity (predicted by homology)	bovine (based on 100% sequence homology), yeast (based on 100% sequence homology), rat (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","inhibition assay: suitable (peptide)","western blot: suitable
NCBI accession no.	NP_112235.2,
UniProt accession no.	Q71SY5,
shipped in	ambient

Homeobox protein Meis1 (UniProt: Q60954-1; P97367-2 and P97367-3; also known as Myeloid ecotropic viral integration site 1 (Meis1) and Meis1-related protein 1) is encoded by the Meis1 gene (Gene ID: 17268). Meis proteins act as transcription factors that are orthologous to the Drosophila homothorax (Hth) protein. Meis protein contain a TALE (three-amino-acid loop extension) sub-class of the homeodomain that binds to DNA. Meis protein directly bind to Pbx proteins and the Meis/Pbx protein complex binds to DNA through respective Meis- and Pbx-consensus binding sites to regulate transcription. The Meis/Pbx complex plays important roles during development of multiple organs. In humans and mice, three homologues Meis1, Meis2 and Meis3 have been identified. Meis1 is expressed at high levels in the lung and at lower levels in the heart and brain. On the other hand, Meis 2 displays spatially restricted expression patterns in the developing nervous system, limbs, face, and in various viscera. In adult, it is mainly expressed in the brain and female genital tract, with a different distribution of the alternative splice forms in these organs. Pancreatic beta cells express both Meis1 and 2. Both Meis1 and 2 are expressed at high levels in all stages of embryonic development of mice (day 7 to 17). Deficiency of Meis1 or Meis 2 can lead to embryonic lethality. (Ref.: Machon, O et al. (2015). BMC Dev. Biol. 515:40).
Specificity
This rabbit polyclonal antibody detects Meis1 in human and murine cells. It targets an epitope within the C-terminal region.

Flash Point F	does not flash
Flash Point C	does not flash

Anti-Meis1

KLH-conjugated linear peptide corresponding 14 amino acids from the C-terminal region of Meis1.
Epitope: C-terminus

Western Blotting Analysis: 1 µg/mL of this antibody detected Meis1 in 10 µg of K562 cell lysate.
Immunofluorescence Analysis: A representative lot detected Meis1 in adjacent stage (St) 41 sagittal hindbrain and eye sections (Mercader, N., et. al. (2005). Development. 132(18):4131-42).
Western Blotting Analysis: A 1:800 dilution from a representative lot detected Meis1 in HEK293T cells transfectd with Meis1a (Courtesy of Dr.Valeria Azcoitia and Dr. Miguel Torres).
Chromatin Immunoprecipitation (ChIP) Analysis: A representative lot detected Meis1 in Chromatin Immunoprecipitation applications (Penkov, D., et. al. (2013). Cell Rep. 3(4):1321-33).
Western Blotting Analysis: A representative lot detected Meis1 in proximal, distal, and RA-treated distal blastemas (Mercader, N., et. al. (2005). Development. 132(18):4131-42).
Anti-Meis1, Cat. No. ABE2864, is a highly specific rabbit polyclonal antibody that targets Homeobox protein Meis1 has been tested in Chromatin Immunoprecipitation (ChIP), Immunofluorescence, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Meis1 in 10 µg of HeLa cell lysate.
Target description
~52 kDa observed; 43.0 kDa (Meis1) calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in PBS with 0.05% sodium azide and 50% glycerol.
Format: Purified
Protein A purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	purified antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	ChIP: suitable (ChIP-chip)","immunofluorescence: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001129544,","NP_001153039,","NP_001180200,

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Homeobox protein Meis1 (UniProt: Q60954-1; also known as Myeloid ecotropic viral integration site 1) Homeobox protein Meis2 (UniProt: P97367-2; also known as Meis1-related protein 1) are encoded by the Meis1 and Meis2 (also known as Mrg1, Stra10) genes (Gene ID: 17268 and 17536) in murine species. Meis proteins act as transcription factors that are orthologous to the Drosophila homothorax (Hth) protein. They are expressed dynamically in several organs during embryogenesis and exert potent regulatory activity through their interaction with Hox proteins and other transcription factors. Meis protein contain a TALE (three-amino-acid loop extension) sub-class of the homeodomain that binds to DNA. They directly bind to Pbx proteins and the Meis/Pbx protein complex binds to DNA through respective Meis- and Pbx-consensus binding sites to regulate transcription. The Meis/Pbx complex plays important roles during development of multiple organs. In humans and mice, three homologues Meis1, Meis2 and Meis3 have been identified. Meis1 is expressed at high levels in the lung and at lower levels in the heart and brain. On the other hand, Meis 2 displays spatially restricted expression patterns in the developing nervous system, limbs, face, and in various viscera. In adult, it is mainly expressed in the brain and female genital tract, with a different distribution of the alternative splice forms in these organs. Pancreatic beta cells express both Meis1 and 2. Both Meis1 and 2 are expressed at high levels in all stages of embryonic development of mice (day 7 to 17). Meis3 is expressed in pancreatic islets and is reported to control the expression of expression of PDK1, which promotes survival of pancreatic beta-cells. Deficiency of Meis1 or Meis 2 can lead to embryonic lethality. Meis1-deficient mice die around midgestation due to a general failure of definitive hematopoiesis. (Ref.: Machon, O et al. (2015). BMC Dev. Biol. 515:40; Azcoitia, V et al., (2005). Dev. Biol. 280 (2); 307-320).
Specificity
This rabbit polyclonal antibody detects Meis1/2. It targets an epitope with in 14 amino acids from the C-terminal region.

Anti-Meis1/2

eCl@ss:	32160702
NACRES:	NA.41

Epitope: C-terminus
KLH-conjugated linear peptide corresponding to 14 amino acids from the C-terminal region of murine Meis1a, Meis2a, and 13 amino acids from Meis2b isoforms.

Immunofluorescence Analysis: A representative lot detected Meis1/2 in Immunofluorescence applications (Mercader, N., et. al. (2005). Development. 132(18):4131-42; Marcos, S., et. al. (2015). Development. 142(17):3009-20).
Chromatin Immunoprecipitation (ChIP) Analysis: A representative lot detected Meis1/2 in Chromatin Immunoprecipitation applications (Penkov, D., et. al. (2013). Cell Rep. 3(4):1321-33; Marcos, S., et. al. (2015). Development. 142(17):3009-20).
Western Blotting Analysis: A representative lot detected Meis1/2 in Western Blotting applications (Mercader, N., et. al. (2005). Development. 132(18):4131-42).
Anti-Meis1/2 Antibody, Cat. No. ABE2865, is a highly specific rabbit polyclonal antibody that targets Meis1/2 and has been tested in Chromatin Immunoprecipitation (ChIP), Immunofluorescence, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HEK293T cells transfected with pCMVTAG2-Flag-Meis2a.
Western Blotting Analysis: 2 µg/mL of this antibody detected Meis1/2 in HEK293T cells transfected with pCMVTAG2-Flag-Meis2a.
Target description
~51 kDa observed; 43.00, 43.79, and 43.06 kDa for Meis1a, Meis2a, and Meis2b, respectively. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in PBS with 0.05% sodium azide and 50% glycerol.
Format: Purified
Protein A purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
antibody form	purified antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse
species reactivity (predicted by homology)	human (based on 100% sequence homology), salamander (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	ChIP: suitable","immunofluorescence: suitable","western blot: suitable
NCBI accession no.	NP_001129544,","NP_001153039,","NP_001180200,
UniProt accession no.	P97367-2,","P97367-3,","Q60954-1,

Spike glycoprotein (UniProt: K9N5Q8; also known as S glycoprotein, E2, Peplomer protein) is encoded by the S (also known as 3) gene (Gene ID: 14254594) in Middle East respiratory syndrome-related coronavirus (MERS-CoV). MERS-CoV is a positive-strand RNA virus of the betacoronavirus genus within the Coronaviridae family that causes severe respiratory syndrome in human. The mature MERS-CoV contains 4 structural proteins: Envelope (E), Membrane (M), Nucleocapsid (N), and the Spike protein (S). Spike protein is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-17), which is subsequently cleaved off to generate the mature form that can be cleaved into three subunits known as S1 (aa 18-751), S2 (aa 752-1353), and S2 (aa 888-163) by host cell furin or other cellular proteases. Spike protein has an extracellular domain (aa 18-1296), a transmembrane domain (aa 1297-1317), and a cytoplasmic domain (aa 1318-1353). S1 subunit attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. It interacts with host DPP4 to mediate viral entry. The S2 subunit mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Clone m336 binds to the receptor binding domain of spike protein that is localized in amino acids 360-601. It is shown to neutralized both pseudotyped and live MERS-CoV with high potency likely by competing with DPP4 for binding to the S glycoprotein. It does not exhibit reactivity with SARS-CoV2 spike protein. (Ref.: Ying, T., et al. (2014). J. Virol. 88(14); 7796-7805).
Specificity
Clone m336 is a recombinant human monoclonal antibody that detects spike protein in Middle East respiratory syndrome-related coronavirus (MERS-CoV). It targets an epitope within the receptor binding domain.

Anti-MERS-CoV RBD Antibody, clone m336

Generated with a large phage display library constructed by using cDNA of peripheral blood mononuclear cells (PBMC) from healthy volunteers and then panned using the RBD (360-601) of MERS-CoV.

Anti-MERS-CoV RBD, clone m336, Cat. No. MABF3060, is a human recombinant monoclonal antibody that detects of Spike glycoprotein of Middle East respiratory syndrome-related coronavirus and is tested for use in ELISA and Neutralizing.
Quality Control Testing
Evaluated by ELISA with recombinant receptor binding domain (RBD) from spike protein of MERS-CoV.
ELISA Analysis (ELISA): Various dilutions of this antibody detected recombinant receptor binding domain (RBD) from spike protein of MERS-CoV.
Tested Applications
Neutralizing: A representative lot neutralized MERS-CoV RBD in Neutralizing applications (Ying, T. et al. (2014). J Virol.;88(14):7796-805; Folegatti, P.M., et al. (2020). Lancet Infect Dis.;20(7):816-826).
ELISA Analysis: A representative lot detected MERS-CoV RBD in ELISA applications (Ying, T. et al. (2014). J Virol.;88(14):7796-805; Folegatti, P.M., et al. (2020). Lancet Infect Dis.;20(7):816-826).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified human recombinant monoclonal antibody IgG1 in PBS without preservatives.
Storage and Stability
Store at -10°C to -25°C. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Quality Level	200
biological source	human
antibody form	purified antibody
antibody product type	primary antibodies
clone	m336, monoclonal
mol wt	calculated mol wt 149.41 kDa
purified by	using Protein A
species reactivity	SARS coronavirus
packaging	antibody small pack of 100 µg
application(s)	ELISA: suitable","neutralization: suitable
isotype	IgG1
epitope sequence	Extracellular domain
conjugate	unconjugated
Protein ID accession no.	Unknown,
UniProt accession no.	K9N5Q8,
shipped in	dry ice
Gene Information	vaccinia virus ... S(37616432)

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Mesothelin (UniProt: Q13421; also known as CAK1 antigen, Pre-pro-megakaryocyte-potentiating factor, MSLN) is encoded by the MSLN (also known as MPF) gene (Gene ID: 10232) in human. Mesothelin is a glycophosphatidylinositol (GPI)-linked cell surface protein that normally expressed in lung and at lower levels in heart, placenta, and kidney. It is highly expressed in several types of malignant tumors and is associated with increased tumor aggressiveness and poor clinical outcome. Antibodies against mesothelin have been detected in patients with mesothelioma and ovarian cancer. Mesothelin plays a role in cellular adhesion. Mesothelin is synthesized with a signal peptide (aa 1-36) and a propeptide (aa 607-630) that are cleaved to produce mature mesothelin, which can be cleaved further by furin-like convertase to generate megakaryocyte-potentiating factor (aa 37-206) and the cleaved form of mesothelin (aa 296-606). Four isoforms of mesothelin have been described that are produced by alternative splicing. (Ref.: Inaguma, S., et al. (2017). Oncotarget. 8(16); 26744-26754; Onda, M., et al. (2005). Clin. Cancer Res, 11(16); 5840-5846).
Specificity
Clone MN-1 is a mouse monoclonal antibody, generated in mesothelin-deficient mice, which specifically detects human Mesothelin.

Anti-Mesothelin Antibody, clone MN-1

Plasmid cDNA corresponding to the mesothelin extracellular domain followed by a single boost with a recombinant human mesothelin-Fc fusion protein.

Anti-Mesothelin, clone MN-1 Antibody, Cat. No. MABC1140, is a mouse monoclonal antibody that detects Mesothelin and has been tested for use in ELISA, Flow Cytometry, Immunohistochemistry (Paraffin), and Western Blotting.
Research Category
Apoptosis & Cancer
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected Mesothelin in human uterus tissue sections.
Flow Cytometry Analysis: A representative lot detected Mesothelin in Flow Cytometry applications (Onda, M., et. al. (2005). Clin Cancer Res. 11(16):5840-6).
ELISA Analysis: A representative lot detected Mesothelin in ELISA applications (Onda, M., et. al. (2005). Clin Cancer Res. 11(16):5840-6).
Western Blotting Analysis: A representative lot detected Mesothelin in Western Blotting applications (Onda, M., et. al. (2005). Clin Cancer Res. 11(16):5840-6).
Immunohistochemistry (Paraffin) Analysis: A representative lot detected Mesothelin in Immunohistochemistry applications (Onda, M., et. al. (2005). Clin Cancer Res. 11(16):5840-6; Inaquma, S., et. al. (2017). Oncotarget. 8(16):26744-26754).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human fallopian tube tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected Mesothelin in human fallopian tube tissue sections.
Target description
68.99 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	MN-1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_037536.2,
UniProt accession no.	Q13421,
Gene Information	human ... MSLN(10232)

Glutamine methylation occurs on translation termination factors and ribosomal proteins. Protein methylation has been reported to affect various cellular processes including protein stability, protein-protein interaction, and protein localization. Methylation of histone is suggested as a platform to recruit and regulate other chromatin-related factors. Glutamine methylation is brought about by the action of protein glutamine methyltransferase HEMK2 that specifically requires a GQX3R motif for methylation activity. This antibody was tested for glutamine methylation in chromodomain helicase DNA-binding protein 5 (CHD5) that contains multiple PHD and chromo domains and is reported to function as a tumor suppressor.
Specificity
This rabbit polyclonal antibody detects methylglutamine in proteins.

Anti-Methyl-Glutamine

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated Gly-Gln (Me)-Gly tripeptide.

Anti-Methyl-Glutamine, Cat. No. ABS2185, is a rabbit polyclonal antibody that detects glutamine methylated proteins. It has been tested for use in Western Blotting.
Western Blotting Analysis: A 1:3,000 dilution from a representative lot detected Methyl-Glutamine in CHD5 unmethylated & CHD5 methylated recombinant lysate (Coutesy of, Dr. Kusevic, Dr. Kuditipudi and Dr. Jeltsch at University Stuttgart, Germany).
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected Methyl-Glutamine in in-vitro methylated CHD5, NUT, and eRF1 proteins (Kusevic, D., et. al. (2016). J Biol Chem. 291(12):6124-33).
Quality
Evaluated by Western Blotting in methylated recombinant chromodomain helicase DNA-binding 5 (CHD5) protein, but not in unmethylated recombinant CHD5.
Western Blotting Analysis: A 1:3,000 dilution of this antibody detected Methyl-Glutamine in methylated recombinant chromodomain helicase DNA-binding 5 (CHD5) protein, but not in unmethylated recombinant CHD5.
Target description
~51 kDa observed (for methylated CHD5). Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Antiserum was depleted by running over unmethylated protein column.
Rabbit polyclonal antiserum with 0.05% sodium azide.

Concentration: Please refer to lot specific datasheet.

biological source	rabbit
Quality Level	100,
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity (predicted by homology)	all
packaging	antibody small pack of 25 μL
application(s)	western blot: suitable
isotype	IgG
shipped in	ambient

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

peptide containing methylated lysine 20 of human Histone H4, conjugated to KLH.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Anti-methyl-Histone H4 (Me-Lys20)antibody, Mouse monoclonal

Quality Level	200,
biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	5E10-D8, monoclonal
form	buffered aqueous solution
mol wt	antigen ~14 kDa
species reactivity	human, mouse, rat
packaging	antibody small pack of 25 μL
concentration	~1.0 mg/mL
application(s)	immunohistochemistry: suitable, indirect immunofluorescence: 2.5-5.0 μg/mL using mouse 3T3 cells or rat NRK cells, western blot: 1.0-2.0 μg/mL using histones isolated from human HeLa cells.
isotype	IgG1
conjugate	unconjugated
shipped in	dry ice
storage temp.	−20°C
Gene Information	human ... HIST4H4(121504)

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

RNA-binding protein FUS (UniProt: also known as 75 kDa DNA-pairing protein, Oncogene FUS, Oncogene TLS, POMp75, Translocated in liposarcoma protein) is encoded by the FUS (also known as TLS) gene (Gene ID: 2521) in human. Fused in sarcoma/translocated in liposarcoma FUS/TLS is a multi-functional nuclear protein that binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in super helical double-stranded DNA. It is involved in a variety of cellular functions including transcription, protein translation, RNA splicing, and transport and may play a role in maintenance of genomic integrity. A chromosomal aberration involving FUS is shown to cause of acute myeloid leukemia (AML). Mutations in FUS gene have been linked to Amyotrophic lateral sclerosis 6, with or without frontotemporal dementia that affects upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. (Ref.: Lagier-Tourenne, C., et al. (2010). Hum. Mol. Genet. 19(1); R46-R64).
Specificity
Clone 9G6 detects methylated RNA-binding protein FUS in human cells. It targets an epitope with in 31 amino acids from the C-terminal region.

Anti-methylated TLS/FUS Antibody, clone 9G6

Ovalbumin-conjugated linear peptide corresponding to 31 amino acids from the C-terminal region corresponding to the RGG3 domain of FUS (with all arginines methylated).

Western Blotting Analysis: 0.05 ug/mL frrom a representative lot detected methylated TLS/FUS in 10 µg of HeLa cell lysate.
Western Blotting Analysis: 0.05 ug/mL frrom a representative lot detected methylated TLS/FUS in 10 µg of lysate from HeLa cells pretreated with AdOx. (Dormann, D., et al. (2012). The EMBO J. 31(22):4258-75)
Western Blotting Analysis: A representative lot detected methylated TLS/FUS in Western Blotting applications (Surez-Calvet, M., et. al. (2016). Acta Neuropathol. 131(4):587-604).
Anti-methylated TLS/FUS, clone 9G6, Cat. No. MABE463, is a highly specific rat monoclonal antibody that targets methylated RNA-binding protein FUS and has been tested in Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HepG2 cell lysate.
Western Blotting Analysis: 0.05 ug/mL of this antibody detected methylated TLS/FUS in 10 µg of HepG2 cell lysate.
Target description
~70 kDa observed; 53.43 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	9G6, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001164105,
UniProt accession no.	P35637,
Gene Information	human ... FUS(2521)

Flash Point F	does not flash
Flash Point C	does not flash

Acetylation of lysine residues is proteins has emerged as an important mechanism in regulation and coordination of normal and pathophysiological cell metabolism. Lysine 3-methylglutaryl is a newer post-translational protein modification that occurs under normal basal conditions. In murine models of HMG-CoA lyase deficiency, higher levels of protein lysine 3-MGylation are observed. This rabbit polyclonal antibody specifically detects chemically modified proteins containing 3-methylglutaryl lysine modifications, but not unmodified proteins. (Ref.: Wagner, GR et al. (2017). Cell Metabolism 25(4); 823-837).
Specificity
This rabbit polyclonal antibody detects 3-methylglutaryl (MG)-lysine conjugated to BSA.

Anti-methylglutaryl-lysine

eCl@ss:	32160702
NACRES:	NA.41

3-methylglutaryl (MG)-lysine conjugated to BSA.

Western Blotting Analysis: A representative lot detected methylglutaryl-lysine in Western Blotting applications (Wagner, G.R., et. al. (2017). Cell Metab. 25(4):823-837; Anderson, K.A., et. al. (2017). Cell Metab. 25(4):838-855.e15).
Anti-methylglutaryl-lysine, Cat. No. ABS2120, is a rabbit polyclonal antibody that detects 3-methylglutaryl-lysine conugated proteins and has been tested for use in Western Blotting.
Research Category
Signaling
Quality
Evaluated by Western Blotting with methyl glutaryl BSA conjugate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected 3-methylglutaryl (MG)-lysine in methyl glutaryl BSA conjugate.
Target description
~75 kDa observed (BSA conjugate). Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in PBS with 0.1% sodium azide.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity (predicted by homology)	all
packaging	antibody small pack of 25 μg
application(s)	western blot: suitable
isotype	IgG

Human Protein Atlas Number:

Anti-METTL14 antibody produced in rabbit

HPA038002 Human Protein Atlas characterization data

The gene METTL14 (methyltransferase like 14) is mapped to human chromosome 4q. It is a homologue of METTL3. The protein has an N-terminal α-helical motif (NHM), methyltransferase domain and a C-terminal motif.

methyltransferase like 14 recombinant protein epitope signature tag (PrEST)

Anti-METTL14 antibody produced in rabbit has been used in:

cross-linking and RNA immunoprecipitation (CLIP)
western blot
immunohistochemical analysis

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-METTL14 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Biochem/physiol Actions
METTL14 mutation reduces m6A methylation in ~70% of endometrial tumors.
METTL14 (methyltransferase like 14) is mainly responsible for m6A (N6-methyladenosine) RNA methylation. It forms a heterodimer with METTL3 and the complex catalyzes m6A RNA methylation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79779,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500
immunogen sequence	RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
conjugate	unconjugated
UniProt accession no.	Q9HCE5,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... METTL14(57721)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Mitochondrial fission factor (UniProt: Q9GZY8; also known as Mff) is encoded by the MFF (also known as C2orf33, AD030, AD033, GL004) gene (Gene ID: 56947) in human. Mff is a single-pass type IV membrane protein that is highly expressed in heart, kidney, liver, brain, muscle, and stomach. Mff is a homodimeric protein, but may also interact with other proteins. It plays a role in mitochondrial and peroxisomal fission and promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. It is also suggested to be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles. Mff has a cytoplasmic domain (aa 1-322), a helical domain (aa 323-340), and a mitochondrial intermembrane domain (aa 341-342). Mff is shown to be an essential factor for mitochondrial recruitment of Drp1 during mitochondrial fission in mammalian cells and its down-regulation inhibits mitochondrial recruitment of Drp1 and induces mitochondria elongation. Also, exogenous expression of Mff is shown to induce extensive mitochondrial fission. Mutations in MFF gene can cause a form of encephalopathy that is characterized by delayed psychomotor development, severe hypotonia with inability to walk, and microcephaly. (Ref.: Otera, H., et al. (2010). J. Cell Biol. 191 (6); 1141 1158; Gandre-Babbe, S., and van der Bliek, AM. (2008). Mol. Biol. Cell. 19(6): 2402-2412).
Specificity
This rabbit polyclonal antibody detects mitochondrial fission factor (Mff) in human cells.

Anti-Mff

eCl@ss:	32160702
NACRES:	NA.41

His-taged full length human recombinant mitochondrial fission factor (Mff).
Epitope: unknown

Anti-Mff, Cat. No. ABS2087, is a rabbit polyclonal antibody that detects Mitochondrial fission factor (Mff) and has been tested for use in Immunocytochemistry, Immunofluorescence, and Western Blotting.
Western Blotting Analysis: A representative lot detected Mff in Western Blotting applications (Mishra, P., et. al. (2015). Cell Metab. 22(6):1033-44).
Immunofluorescence Analysis: A representative lot detected Mff in Immunofluorescence applications (Mishra, P., et. al. (2015). Cell Metab. 22(6):1033-44).
Research Category
Signaling
Quality
Evaluated by Immunocytochemistry in HeLa cells with Mitotracker (TM).
Immunocytochemistry Analysis: A 1:2,000 dilution of this antibody detected Mff in HeLa cells with Mitotracker (TM).
Target description
38.47 kDa calculated.
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunocytochemistry: suitable","immunofluorescence: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_064579,
UniProt accession no.	Q9GZY8,
shipped in	ambient
Gene Information	human ... MFF(56947)

Flash Point F	does not flash
Flash Point C	does not flash

The M5/114.15.2 antibody reacts with mouse MHC Class II alloantigens I-Ab, I-Ad, I-Aq, I-Ed, and I-Ek, as well as being cross-reactive with mouse cells of H-2p and H-2r haplotype. MHC Class II is widely expressed by mouse immune cells bearing these alloantigens, including T and B cells, monocytes, macrophages, and dendritic cells. The antibody does not react with the following alloantigens: I-Af, I-Ak, I-As, or NOD H-2g7.The M5/114.15.2 antibody may be used for analysis of mouse cells expressing MHC Class II alloantigens as described. Please note that the M5/114.15.2 clone may also be referred to as M5/114 in the literature.

Anti-MHC class II (I-A/I-E), APC, clone M5/114 .15.2 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-MHC class II (I-A/I-E) Antibody, APC, clone M5/114 .15.2, Cat. No. MABF806 is validated for use in Flow Cytometry, for the detection of MHC class II (I-A/I-E).
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.06 µg from a representative lot detected MHC class II (I-A/I-E) in one million C57Bl/6 splenocytes.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	M5/114.15.2, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	Allophycocyanin conjugate
UniProt accession no.	P04441,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

The M5/114.15.2 antibody reacts with mouse MHC Class II alloantigens I-Ab, I-Ad, I-Aq, I-Ed, and I-Ek, as well as being cross-reactive with mouse cells of H-2p and H-2r haplotype. MHC Class II is widely expressed by mouse immune cells bearing these alloantigens, including T and B cells, monocytes, macrophages, and dendritic cells. The antibody does not react with the following alloantigens: I-Af, I-Ak, I-As, or NOD H-2g7The M5/114.15.2 antibody may be used for analysis of mouse cells expressing MHC Class II alloantigens as described. Please note that the M5/114.15.2 clone may also be referred to as M5/114 in the literature.

Anti-MHC class II (I-A/I-E), FITC, clone M5/114 .15.2 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
Anti-MHC class II (I-A/I-E), FITC, clone M5/114 .15.2 Antibody is an antibody against MHC class II for use in Flow Cytometry.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected MHC class II (I-A/I-E), FITC in one million C57Bl/6 splenocytes.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	M5/114.15.2, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	FITC conjugate
UniProt accession no.	P04441,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Immunogen information for this antibody is proprietary information.

Anti-MHC class II (I-A/I-E), redFluor® 710, clone M5/114 .15.2 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Anti-MHC class II (I-A/I-E), redFluor® 710, clone M5/114 .15.2 Antibody is an antibody against MHC class II for use in Flow Cytometry.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg from a representative lot detected MHC class II (I-A/I-E) in one million C57Bl/6 splenocytes.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	M5/114.15.2, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	redFluor^® 710
UniProt accession no.	P04441,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

The M5/114.15.2 antibody reacts with mouse MHC Class II alloantigens I-Ab, I-Ad, I-Aq, I-Ed, and I-Ek, as well as being cross-reactive with mouse cells of H-2p and H-2r haplotype. MHC Class II is widely expressed by mouse immune cells bearing these alloantigens, including T and B cells, monocytes, macrophages, and dendritic cells. The antibody does not react with the following alloantigens: I-Af, I-Ak, I-As, or NOD H-2g7The M5/114.15.2 antibody may be used for analysis of mouse cells expressing MHC Class II alloantigens as described. Please note that the M5/114.15.2 clone may also be referred to as M5/114 in the literature.

Anti-MHC class II (I-A/I-E), violetFluor® 450, clone M5/114 .15.2 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

This rat monoclonal Anti-MHC class II (I-A/I-E) Antibody, violetFluor® 450, clone M5/114 .15.2, Cat. No. MABF1413 is validated for use in Flow Cytometry, for the detection of MHC class II (I-A/I-E).
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected MHC class II (I-A/I-E) in one million C57Bl/6 splenocytes.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	M5/114.15.2, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	violetFluor^® 450
UniProt accession no.	P04441,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

MHC class I polypeptide-related sequence A/MHC class I polypeptide-related sequence B (UniProt: Q29983/Q29980; also known as MIC-A/MIC-B) is encoded by the MICA/MICB (also known as PERB11.1/PERB11.2) gene (Gene ID: 100507436/4277) in human. MIC-A and B are closely related single-pass type I membrane proteins that act as stress-induced self-antigen that are recognized by gamma-delta T cells and serve as ligands for the KLRK1/NKG2D receptor. They are recognized by cytotoxic gamma-delta T cells expressing the TCR variable region V delta1. Under normal conditions expression of MIC-A and B is restricted mainly to the intestinal epithelium. However, their expression has been reported in tumor cells. They are proteolytically cleaved and released from the cell surface of tumor cells which impairs KLRK1/NKG2D expression and T-cell activation. MIC-A and B can be induced by heat shock and by exposure to DNA damaging conditions. They are synthesized with a signal peptide (aa 1-23 and 1-22, respectively for MIC-A and MIC-B), which are cleaved off in the mature form. Their mature forms contain an extracellular domain (aa 24-304 and 23-309), a transmembrane domain (aa 308-328 and 310-330), and a cytoplasmic domain (aa 329-383 and 331-383), respectively. (Ref.: Groh, V., et al. (1999). Proc. Natl. Acad. Sci USA. 96 (12); 6879-6884).
Specificity
Clone 6D4 specifically stains MIC-A and MIC-B in human cells.

Anti-MIC-A MIC-B Antibody, clone 6D4

C1R cells expressing MICA.

Immunohistochemistry (Paraffin) Analysis: A representative lot detected MIC-A and MIC-B in Immunohistochemistry applications (Groh, V., et. al. (1999). Proc Natl Acad Sci U S A. 96(12):6879-84).
Flow Cytometry Analysis: A representative lot detected MIC-A and MIC-B in Flow Cytometry applications (Groh, V., et. al. (1999). Proc Natl Acad Sci U S A. 96(12):6879-84).
Inhibits Activity/Function Analysis: A representative lot inhibited cytotoxicity of ovary tumor-derived T cells against various cancer cell lines. (Groh, V., et. al. (1999). Proc Natl Acad Sci U S A. 96(12):6879-84).
Anti-MIC-A/MIC-B, Clone 6D4, Cat. No. MABF2160, is a mouse monoclonal antibody that detects MHC class I polypeptide-related sequence A/MHC class I polypeptide-related sequence B (MIC-A and MIC-B) and has been tested for use in Flow Cytometry, Immunohistochemistry (Paraffin), and Inhibition Activity/
Research Category
Inflammation & Immunology
Quality
Evaluated by Flow Cytometry in HeLa cells.
Flow Cytometry Analysis: 1 µg of this antibody detected MIC-A MIC-B in one million HeLa cells.
Target description
42.91 and 42.64 kDa calculated, respectively for MIC-A and MIC-B.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	6D4, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","inhibition assay: suitable
isotype	IgG2a
NCBI accession no.	NP_000238.1,","NP_005922.2,
UniProt accession no.	Q29980 (MICA MICB),","Q29983 (MICA MICA),

Beta-2-microglobulin (UniProt: P61769) is encoded by the B2M (also known as CDABP0092, HDCMA22P) gene (Gene ID: 567) in human. Beta-2-microglobulin is a component of the class I major histocompatibility complex (MHC) that is involved in the presentation of peptide antigens to the immune system. It is synthesized with a signal peptide of 20 amino acids, which is subsequently cleaved to generate the mature form. It also contains an Ig-like C1 type domain (aa 25-113). Beta-2-microglobulin lacks a transmembrane anchoring domain and is found in secreted as well as in complex. Serum beta-2-microglobulin levels are a reflection of cell turnover and its levels are shown to be elevated in fever, inflammation, and infection. Increased serum levels are also seen in B-cell malignancies and in renal failure and may indicate a worse prognosis for patients with early-stage Hodgkins lymphoma. Its levels may be elevated either due to higher rates of synthesis as observed in HIV infection and malignancy or due to impaired renal filtration due to renal insufficiency.
Specificity
Clone BBM.1 detects Beta-2-microglobulin in human.

Anti-Microglobulin beta2 Antibody, clone BBM.1

MOLT-4, a Human acute lymphoblastic leukemia cell line.

Anti-Microglobulin beta2, clone BBM.1, Cat. No. MABF1968, is a mouse monoclonal antibody that detects Microglobulin beta2 and has been tested for use in Flow Cytometry, Immunohistochemistry (Paraffin), Inhibition assays, and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected Microglobulin beta2 in Immunohistochemistry applications (Josson, S., et. al. (2011). Cancer Res. 71(7):2600-10).
Inhibition Analysis: A representative lot inhibited Microglobulin beta2 activity (Parham, P., et. al. (1983). J Biol Chem. 258(10):6179-86).
Flow Cytometry Analysis: A representative lot detected Microglobulin beta2 in Flow Cytometry applications (Drukker, M., et. al. (2012). Nat Biotechnol. 30(6):531-42).
Immunohistochemistry Analysis: A 1:50-1:1,000 dilution from a representative lot detected Microglobulin beta2 in human breast cancer and human tonsil tissues.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in MOLT-4 cell lysates
Western Blotting Analysis: 0.25 µg/mL of this antibody detected Microglobulin beta2 in 10 µg of MOLT-4 cell lysate.
Target description
~14 kDa observed; 13.72 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	BBM.1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","inhibition assay: suitable","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_004039,
UniProt accession no.	P61769,
shipped in	ambient

E3 ubiquitin-protein ligase Midline-1 (UniProt: O15344; also known as EC: 2.3.2.27, Midin, Putative transcription factor XPRF, RING finger protein 59, RING finger protein Midline-1, RING-type E3 ubiquitin transferase Midline-1, Tripartite motif-containing protein 18) is encoded by the MID1 (also known as FXY, RNF59, TRIM18, XPRF) gene (Gene ID: 4281) in human. Midlin is homodimeric protein with E3 ubiquitin ligase activity towards IGBP1, promoting its monoubiquitination that results in deprotection of the catalytic subunit of protein phosphatase PP2A and its subsequent degradation by polyubiquitination. It can also form heterodimer with MID2. It associates with microtubules throughout the cell cycle, co-localizing with cytoplasmic fibers in interphase and with the mitotic spindle and midbodies during mitosis and cytokinesis. It is highly expressed in fetal kidney, followed by brain and lung. Lower levels are observed in fetal liver. In the adult, it is most abundant in heart, placenta, and brain. Midlin has multiple zinc binding sites and possesses three zinc fingers (one RING type and two B box-type). Mutations in MID1 gene are reported to cause Opitz GBBB syndrome 1 that is characterized by reduced affinity for microtubules, hypertelorism, and genital-urinary defects.
Specificity
This rabbit polyclonal antibody detects E3 ubiquitin-protein ligase Midline-1 (MID1) in Human cells. It targets an epitope within 13 amino acids from the N-terminal region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MID1

Epitope: N-terminus
KLH-conjugated linear peptide corresponding to 13 amino acids from the N-terminal region of human E3 ubiquitin-protein ligase Midline-1.

Anti-MID1, Cat. No. ABN1374, is a highly specific rabbit polyclonal antibody that targets E3 ubiquitin-protein ligase Midline-1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected MID1 in human placenta and human cerebral cortex tissue sections.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MID1 in HeLa cell lysate.
Target description
~75 kDa observed; 75.25 kDa calculated.
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
species reactivity (predicted by homology)	bovine (based on 100% sequence homology), rat (based on 100% sequence homology), mouse (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
NCBI accession no.	NP_000372.1,
UniProt accession no.	O15344,
Gene Information	human ... MID1(4281)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Hepatitis C virus (HCV) is a small (~55 65 nm) in size), enveloped, positive-sense single-stranded RNA virus that is a causative factor for hepatitis C and hepatocellular carcinoma. HCV expresses several proteins that promote viral replication. Genome polyprotein of HCV is a core protein that packages viral RNA to form a viral nucleocapsid, and promotes virion budding. It also modulates viral translation initiation by interacting with HCV IRES and 40S ribosomal subunit. It prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways and by inducing human STAT1 degradation. Envelope (E1 and E2) glycoproteins of HCV form a heterodimer, which is involved in virus attachment to the host cell, virion internalization through clathrin-dependent endocytosis and fusion with host membrane. P7 protein, a heptameric ion channel protein, is essential for infectivity. HCV also contains NS2-3, which acts as a cysteine protease responsible for the autocatalytic cleavage of NS2-NS3. It undergoes self-inactivation following maturation. NS3 protein of HCV displays serine protease, NTPase, and RNA helicase activities. NS4B protein is shown to induce a specific membrane alteration that serves as a scaffold for the virus replication complex. NS5A protein is a component of the replication complex and is involved in RNA-binding. It is reported to mediate interferon resistance by interacting with and inhibiting human EIF2AK2/PKR. HCV also expresses a family of small proteins that are derived from the core gene and are known as minocores. These minicores lack the N-terminus, but contain the C-terminal portion of the mature p21 core protein. They are associated with higher risk of hepatocellular carcinoma, insulin resistance, and failure of interferon-based therapy.
Specificity
Clone Neo4 detects HCV core and minicore proteins in cells infected with HCV virus.

Anti-minicore HCV Antibody, clone Neo4

KLH-conjugated linear peptide corresponding to 18 amino acids from the N-terminal region of Hepatitis C virus (HCV) core protein.

Anti-minicore HCV, clone Neo4, Cat. No. MABF2057, is a mouse monoclonal antibody that detects intracellular and secreted HCV core and minicore proteins in HCV infected cells and has been tested for use in Immunofluorescence and Western Blotting.
Western Blotting Analysis: A representative lot detected minicore HCV in Western Blotting applications (Eng, F.J., et. al. (2018). Hepatol Commun. 2(1):21-28).
Immunofluorescence Analysis: A representative lot detected minicore HCV in Immunofluorescence applications (Eng, F.J., et. al. (2018). Hepatol Commun. 2(1):21-28).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in extracts of HEK293T cells transfected with plasmids expressing only HCV p21 core and 91 minicore proteins.
Western Blotting Analysis: 4 ug/mL of this antibody detected minicore HCV in extracts of HEK293T cells transfected with plasmids expressing only HCV p21 core and 91 minicore proteins.
Target description
~ 8 and 21 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	Neo4, monoclonal
species reactivity	virus
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","western blot: suitable
isotype	IgG1
UniProt accession no.	Q9WMX2,

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Mis12 complex is composed of four subunits, Protein MIS12 homolog, Polyamine-modulated factor 1, Kinetochore-associated protein DSN1 homolog, and Kinetochore-associated protein NSL1 homolog (UniProt: Q9H081, Q6P1K2, Q9H410, Q96IY1, respectively) that are encoded by genes known as MIS12 (Gene ID: 79003), PMF1 (Gene ID: 100527963), DSN1 (Gene ID: 79980), and NSL1 (also known as C1orf48, DC31, DC8, MIS14) (Gene ID: 25936) in human. The MIS12 complex is a protein interaction hub for outer kinetochore assembly. This complex acts as the primary microtubule-binding interface at kinetochores and provides a platform to recruit regulatory proteins. In human Mis12 complex subunits are shown to localize with centromere protein A (CENP-A) at inner kinetochores and internally to Ndc80 at outer kinetochores. Mis12 complex plays an essential role in chromosome segregation in vertebrates and contributes to mitotic kinetochore assembly. Reduced levels of Mis12 complex proteins are shown to result in chromosome alignment defects in both human and chicken cells, but spindle bipolarity is not disturbed. (Ref.: Kline SL et al (2006). J. Cell. Biol. 173(1): 9-17).
Specificity
This polyclonal antibody detects Mis12 complex in human. It will also detect individual subunits (Mis12, PMF1, Dsn1, Nsl1) in Western Blotting.

Anti-Mis12 Complex

eCl@ss:	32160702
NACRES:	NA.41

Four subunits from human Mis12 complex.
Epitope: unknown

Anti-Mis12 Complex Antibody, Cat. No. ABE2585, is a highly specific rabbit polyclonal antibody that targets Mis12 complex and has been tested in Immunocytochemistry, Immunofluorescence, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunocytochemistry Analysis: A 1:1,100 dilution from a representative lot detected Mis12 complex in HeLa cells.
Immunofluorescence Analysis: A representative lot detected Mis12 complex in HeLa cells (Rago, F., et. al. (2015). Curr Biol. 25(5):671-7).
Quality
Evaluated by Western Blotting in recombinant Mis12 complex.
Western Blotting Analysis: 2.2 µg/mL of this antibody detected Mis12 complex in 1 µL of recombinant Mis12 complex.
Target description
24.10, 23.34, 40.07, and 32.16 kDa calulated for Mis12, PMF1, DSN1, and NSL1, respectively. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in PBS without azide and with 50% glycerol.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.