Small Pack Antibodies
- Сортировать:
- Вид таблицей
-
Anti-Histone H3.3 K36I Mutant
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1450 ABE1450-25UL General descriptionHistone H3.3 (UniProt: P84243) is encoded by the H3F3A (also known as H3.3A, H3F3, PP781, H3F3B, H3.3B) gene (Gene ID: 3020) in human. It is a highly conserved variant form of Histone H3, which replaces conventional H3 in a wide range of nucleosomes in active genes. Histone H3.3 constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. H3.3 is associated with actively expressed genes in both animals and plants. It is predominantly enriched near transcription end sites (TES) of genes and positively associated with transcription. Histone H3 contains a main globular domain and a long N-terminal tail and is involved with the structure of the nucleosomes of the beads on a string structure. The N-terminal tail of histone H3 protrudes from the globular nucleosome core and can undergo several different types of epigenetic modifications that influence cellular processes. These modifications include the covalent attachment of methyl or acetyl groups to lysine and arginine amino acids and the phosphorylation of serine or threonine. For example, acetylation on Lys10 (H3K9ac; initial methionine removed) impairs methylation at Arg9 (H3R8me2s) and acetylation on Lys19 (H3K18ac) and Lys24 (H3K24ac) favors methylation at Arg18 (H3R17me). Phosphorylation at Ser11 (H3S10ph) by Aurora kinase B is crucial for chromosome condensation and cell-cycle progression during mitosis and meiosis. Phosphorylation at Ser11 by RPS6KA4 and RPS6KA5 is important during interphase because it enables the transcription of genes following external stimulation, like mitogens, stress, growth factors or UV irradiation and result in the activation of genes, such as c-Fos and c-Jun. Mutations in Histone H3.3 have been implicated in a high proportion of malignant pediatric brain cancers. The mutant H3.3 histone disrupts epigenetic post-translational modifications near genes involved in cancer processes and in brain function. K36I mutations in Histone H3 have been reported in pediatric undifferentiated sarcoma tumors. K36I mutation is shown to inhibit H3K36 methylation, which can lead to a genome-wide gain in H3K27 methylation that leads to redistribution of polycomb repressive complex 1 and de-repression of its target genes to block mesenchymal differentiation.
Specificity
This rabbit polyclonal antibody detects K36I mutant form of histone H3.3 and does not react with wild-type H3.3.ImmunogenKLH-conjugated linear peptide corresponding to 8 amino acids from the N-terminal region of human histone H3.3 with K36I mutation.
Epitope: unknownApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot specifically detected Histone H3.3 K36I Mutant in HEK293 cells transfected with H3.3 K36I mutant, but not the wild-type or K36M mutant (Courtesy of Dr. Peter Lewis, Rockefeller University).
Anti-Histone H3.3 K36I Mutant, Cat. No. ABE1450, is a highly specific rabbit polyclonal antibody that detects Histone H3.3 Mutant (K36I) and has been tested for use in Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HEK293 cells expressing Histone H3.3 K36I Mutant.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Histone H3.3 K36I Mutant in HEK293 cells expressing Histone H3.3 K36I Mutant.
Target description
~19 kDa observed; 15.33 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG NCBI accession no. NP_005315, UniProt accession no. P84243, shipped in ambient Gene Information human ... H3F3B(3021)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Histone H3.3 K9M
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE579 ABE579-25UL General descriptionHistone H3.3 (UniProt: P84243) is encoded by the H3F3A (also known as H3.3A, H3F3, PP781, H3F3B, H3.3B) gene (Gene ID: 3020) in human. It is a highly conserved variant form of Histone H3, which replaces conventional H3 in a wide range of nucleosomes in active genes. Histone H 3.3 constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. H3.3 is associated with actively expressed genes in both animals and plants. It is predominantly enriched near transcription end sites (TES) of genes and positively associated with transcription. Histone H3 contains a main globular domain and a long N-terminal tail and is involved with the structure of the nucleosomes of the beads on a string structure. The N-terminal tail of histone H3 protrudes from the globular nucleosome core and can undergo several different types of epigenetic modifications that influence cellular processes. These modifications include the covalent attachment of methyl or acetyl groups to lysine and arginine amino acids and the phosphorylation of serine or threonine. For example, acetylation on Lys10 (H3K9ac; initial methionine removed) impairs methylation at Arg9 (H3R8me2s) and acetylation on Lys19 (H3K18ac) and Lys24 (H3K24ac) favors methylation at Arg18 (H3R17me). Phosphorylation at Ser11 (H3S10ph) by Aurora kinase B is crucial for chromosome condensation and cell-cycle progression during mitosis and meiosis. Phosphorylation at Ser11 by RPS6KA4 and RPS6KA5 is important during interphase because it enables the transcription of genes following external stimulation, like mitogens, stress, growth factors or UV irradiation and result in the activation of genes, such as c-Fos and c-Jun. Mutations in Histone H3.3 have been implicated in a high proportion of malignant pediatric brain cancers. The mutant H3.3 histone disrupts epigenetic post-translational modifications near genes involved in cancer processes and in brain function. Lysine to methionine mutations in genes encoding histone H3 are believed to be responsible for subset of pediatric brain and bone cancers. K9M residues that can occupy the active site cavity of G9a methyltransferase and act as competitive inhibitor. G9a methyltransferase has been shown to be important in heterochromatin maintenance and transcriptional repression. K9M can lead to a reduction in global levels of H3K9me3 in cells. (Ref.: Jayaram, H et al. (2016). Proc. Natl. Acad. Sci. USA 113(22); 6182-6187).
Specificity
This rabbit polyclonal antibody detects K9M mutant form of histone H3.3 and does not react with wild-type H3.3.ImmunogenEpitope: N-terminus
KLH-conjugated linear peptide corresponding to 9 amino acids from the N-terminal region of human histone H3.3 with K9M mutation.ApplicationAnti-Histone H3.3 K9M, Cat. No. ABE579, is a highly specific rabbit polyclonal antibody that setects Histone H3.3 mutant K9M and has been tested for use in Western Blotting.
Western Blotting Analysis: A representative lot detected Histone H3.3 K9M in immunoblots of affinity-purified heterotypic mononucleosomes from lentivirus-transduced 293T cells expressing various epitope-tagged H3.3 transgenes (Jayaram, H., et. al. (2016). Proc Natl Acad Sci USA. 113(22):6182-7).
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected Histone H3.3 K9M in whole cell extract of mouse embryonic fibroblasts (MEF) or mouse embryonic stem cells (mESCs) expressing various H3.3 constructs (Courtesy of Dr. Peter Lewis, Rockefeller University).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HEK293 cells transfected with Histone H3.3 WT and Histone H3.3 K9M mutant.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Histone H3.3 K9M in HEK293 cells transfected with H3.3 K9M mutant. It did not detect wild-type Histone H3.3.
Target description
~19 kDa observed; 15.33 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG NCBI accession no. NP_002098,","NP_005315, UniProt accession no. P84243, shipped in ambient Gene Information human ... H3F3B(3021)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-HLA-DRB3
eCl@ss: 32160702
Кат. номер ABD113 ABD113-25UG General descriptionHLA class II histocompatibility antigen, DR beta 3 chain (UniProt: P79483; also known as MHC class II antigen DRB3) is encoded by the HLA-DRB3 gene (Gene ID: 3125) in human. DRB3 is a single-pass type I membrane protein; that is synthesized with a signal peptide of 29 amino acids that is subsequently cleaved to generate a mature form. It also contains an Ig0like C1 type domain (aa 126-214). It is a heterodimer of an alpha and a beta subunit; also referred as MHC class II molecule. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the endoplasmic reticulum (ER) to form a heterononamer. The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation. DRB3 binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells.
Specificity
This rabbit polyclonal antibody detects HLA class II histocompatibility antigen, DR beta 3 chain in human cells. It targets an epitope within 15 amino acids from the N-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids from the N-terminal half of human HLA class II histocompatibility antigen, DR beta 3 chain (HLA-DRB3).
Epitope: N-terminusApplicationThis rabbit polyclonal Anti-HLA-DRB3 Antibody, Cat. No. ABD113, is a rabbit polyclonal antibody tht detects HLA class II histocompatibility antigen, DR beta 3 chain (HLA-DRB3) and has been tested for use in Flow Cytometry and Western Blotting.
Flow Cytometry Analysis: 1 µg from a representative lot detected HLA-DRB3 in one million Raji cells.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in Raji cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected HLA-DRB3 in 10 µg of Raji cell lysate.
Target description
~32 kDa observed; 29.96 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_072049, UniProt accession no. P79483, shipped in ambient Gene Information human ... HLA-DRB3(3125)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-HLA-G Antibody, clone 4H84
eCl@ss: 32160702
Кат. номер MABF2169-25UG MABF2169-100UG General descriptionHLA class I histocompatibility antigen, alpha chain G (UniProt: P17693; also known as HLA G antigen, MHC class I antigen G) is encoded by the HLA-G (also known as HLA-6.0, HLAG) gene (Gene ID: 3135) in human. HLA-G is a single-pass type I membrane glycoprotein that serves as marker of extravillous cytotrophoblasts in placenta and plays a central role in molecule maternal tolerance of the semiallogeneic fetus. It is involved in the presentation of foreign antigens to the immune system. HLA-G is a heterodimer of an alpha chain and a beta chain. Severn different isoforms of HLA-G have been described that are produced by alternative splicing and their distribution is temporally affected during pregnancy in placenta and fetal tissues. HLA-G expression has been reported in renal cell carcinoma where it is exclusively restricted to tumor cells. Its expression is thought to be involved in the impairment of the anti-tumor immunity or resistance to immunotherapeutic agents. HLA-G is synthesized with a signal peptide (aa 1-24), which is subsequently cleaved off to generate the mature form, which contains an extracellular domain (aa 25-308), a transmembrane domain (aa 309-332), and a short cytoplasmic tail (aa 333-338).
Specificity
Clone 4H84 specifically detects human HLA-G. It recognizes an epitope with in 23 amino acids from the alpha1 region of all HLA-G isoforms.ImmunogenKLH-conjugated linear peptide corresponding to 23 amino acids from the N-terminal region of Human MHC class I antigen G. The immunogen sequence is conserved in all isoforms.ApplicationAnti-HLA-G, clone 4H84, Cat. No. MABF2169, is a mouse monoclonal antibody that detects HLA class I histocompatibility antigen, alpha chain G and has been tested for use in ELISA, Flow Cytometry, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected HLA-G in human spleen tissue sections.
Immunohistochemistry (Paraffin) Analysis: A representative lot detected HLA-G in Immunohistochemistry applications (Tabata, T., et. al. (2012). Am J Pathol. 181(5):1540-59; Menier, C., et. al. (2003). Hum Immunol. 64(3):315-26; Ibrahim, E.C., et. al. (2003). Am J Pathol. 162(2):501-8; Tabata, T., et. al. (2016). Cell Host Microbe. 20(2):155-66; McMaster, M., et. al. (1998). J Immunol. 160(12):5922-8).
Western Blotting Analysis: A representative lot detected HLA-G in Western Blotting applications (Paul, P., et. al. (1999). Cancer Res. 59(8):1954-60; McMaster, M., et. al. (1998). J Immunol. 160(12):5922-8).
ELISA Analysis: A representative lot detected HLA-G in ELISA applications (McMaster, M., et. al. (1998). J Immunol. 160(12):5922-8).
Flow Cytometry Analysis: A representative lot detected HLA-G in Flow Cytometry applications (Menier, C., et. al. (2003). Hum Immunol. 64(3):315-26).
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry (Paraffin) in human placenta tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected HLA-G in human placenta tissue sections.
Target description
38.22 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 4H84, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_002118.1, UniProt accession no. P17693, Gene Information human ... HLA-G(3135) Узнать цену -
Anti-hLYVE-1 Antibody, clone 8C
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS1929 MABS1929-25UG General descriptionLymphatic vessel endothelial hyaluronic acid receptor 1 (UniProt: Q9Y5Y7; LYVE-1, Cell surface retention sequence-binding protein 1, CRSBP-1,Extracellular link domain-containing protein 1,Hyaluronic acid receptor) is encoded by the LYVE1 (also known as CRSBP1, HAR, XLKD1,UNQ230/PRO263) gene (Gene ID: 10894) in human. LYVE-1 is a disulfide-linked, homodimeric, single-pass type I membrane protein that undergoes ligand-dependent internalization and recycling at the cell surface. It serves as a ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. It is mainly expressed in endothelial cells lining lymphatic vessels. It is expressed on both the luminal and basolateral surfaces of lymphatic endothelium. It is reported to mediate the uptake of intermediate and high molecular weight hyaluronan (HA) and serves as a low affinity receptor for HA-induced lymphoangiogenesis. It also controls the entry and/or migration of leukocytes in lymphatic vessels. The capacity of LYVE-1 to bind HA is based on a receptor distribution and organization of the glycosaminoglycans. (Ref.: Lawrence, W et al. (2016). J Biol Chem. 291(15): 8014 8030).
Specificity
Clone 8C detects Lymphatic vessel endothelial hyaluronic acid receptor 1. It targets an epitope within the ectodomain region.ImmunogenA recombinant fragment corresponding to the ectodomain (1-232) region of human LYVE-1.ApplicationImmunocytochemistry Analysis: A representative lot detected hLYVE-1 in Immunocytochemistry applications (Lawrance, W., et. al. (2016). J Biol Chem. hLYVE-1; Banerji, S., et. al. (1999). J Cell Biol. 144(4):789-801).
Western Blotting Analysis: A representative lot detected hLYVE-1 in Western Blotting applications (Banerji, S., et. al. (1999). J Cell Biol. 144(4):789-801; Banerji, S., et. al. (2016). J Biol Chem. 291(48):25004-25018).
Flow Cytometry Analysis: A representative lot detected hLYVE-1 in Flow Cytometry applications (Lawrance, W., et. al. (2016). J Biol Chem. hLYVE-1; Banerji, S., et. al. (2016). J Biol Chem. 291(48):25004-25018).
Anti-hLYVE-1, clone 8C, Cat. No. MABS1929, is a mouse monoclonal antibody that detects Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE1) and has been tested for use in Flow Cytometry, Immunocytochemistry, and Western Blotting.
Quality
Evaluated by Western Blotting in lysates from wild-type and LYVE-1 transfected HEK293T cells.
Western Blotting Analysis: 2 ug/mL of this antibody detected LYVE1 (Lymphatic vessel endothelial hyaluronic acid receptor 1) in lysate from wild-type and LYVE transfected HEK293T cells.
Target description
~60 kDa observed; 35.21 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 8C, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunocytochemistry: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_006682, UniProt accession no. Q9Y5Y7, shipped in ambient Gene Information human ... LYVE1(10894)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HMG-Lysine
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS2108-25UL ABS2108-100UL General descriptionAcetylation of lysine residues in proteins has emerged as an important mechanism in regulation and coordination of normal and pathophysiological cell metabolism. Lysine HMGylation is a newer post-translational protein modification that occurs under normal basal conditions. In murine models of HMG-CoA lyase deficiency, higher levels of protein lysine HMGylation has been observed. This rabbit polyclonal antibody specifically detects chemically modified proteins containing hydroxymethylglutaryl-lysine modifications, but not unmodified proteins. (Ref.: Wagner, GR et al. (2017). Cell Metabolism 25(4); 823-837).
Specificity
This rabbit polyclonal antibody detects BSA-conjugated 3-hydroxy-3-methyl-glutaryl (HMG)-Lysine. It recognizes BSA chemically modified to contain HMG-lysine modifications, but not unmodified BSA.ImmunogenEpitope: unknown
3-hydroxy-3-methyl-glutaryl (HMG)-Lysine conjugated to BSA.ApplicationResearch Category
Signaling
Western Blotting Analysis: A representative lot detected HMG-Lysine in Western Blotting applications (Wagner, G.R., et. al. (2017). Cell Metab. 25(4):823-837; Anderson, K.A., et. al. (2017). Cell Metab. 25(4):838-855.e15).
Western Blotting Analysis: A 1:500 dilution from a representative lot detected HMG-Lysine in HMG-BSA conjugate (Courtesy of Dr Kristin Anderson from Duke University).
Anti-HMG-Lysine, Cat. No. ABS2108, is a rabbit polyclonal antibody that detects hydroxymethylglutaryl-lysine conjugated proteins and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting with HMG-BSA conjugate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected HMG-Lysine in HMG-Lysine-BSA conjugate.
Target description
~75 kDa observed (BSA conjugate). Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in PBS with 0.1% sodium azide.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity (predicted by homology) all packaging antibody small pack of 25 μL application(s) western blot: suitable isotype IgG Узнать цену -
Anti-HMGB1 (HMG1) (C-terminal) antibody produced in rabbit
MDL number: MFCD02263062 NACRES: NA.41
Кат. номер H9539-200UL H9539-25UL General descriptionThe High Mobility Group (HMG1) is secreted by activated monocytes and macrophages. The gene is mapped to human chromosome 13q12.Immunogensynthetic peptide corresponding to amino acid 165-180 of human HMGB1, conjugated to KLH. The corresponding sequence is conserved in mouse and rat.ApplicationAnti-HMGB1 (HMG1) (C-terminal) antibody produced in rabbit has been used in ELISA and immunofluorescence.
Biochem/physiol Actions
In the nucleus, HMGB1 (high-mobility group protein B1) works as a nucleosome stabilizer and transcriptional regulator. It also exhibits chaperone-like activity and suppresses aggregation of polyglutamine. It has a role in inflammation and autophagy. HMGB1 can interact with toll-like receptor (TLR) 2 and 4, interleukin-1β, chemokine (C-X-C motif) ligand 12 (CXCL12) and pathogen-associated molecular pattern (PAMP) molecules. It also works as a damage-associated molecular pattern molecule (DAMP).
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month.
For extended storage, freeze in working aliquots.
Repeated freezing and thawing, or storage in “frostfree” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.Other NotesIn order to obtain the best results using various techniques and preparations, we recommend determining the optimal working dilutions by titration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 25 kDa species reactivity rat, human, mouse packaging antibody small pack of 25 µL application(s) immunoprecipitation (IP): 5-10 µg using HEK-293T cell lysates.","indirect immunofluorescence: suitable","western blot: 0.5-1 µg/mL using 3T3 or PC12 cell lysates. conjugate unconjugated UniProt accession no. P09429, shipped in dry ice storage temp. 20°C Gene Information human ... HMGB1(3146)
mouse ... Hmgb1(15289)
rat ... Hmgb1(25459)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HMGB2 (HMG2) antibody produced in rabbit
NACRES: NA.41
Кат. номер H9789-200UL H9789-25UL General descriptionThe high mobility group (HMG) proteins are subdivided into 3 families based on their functional sequence motif characteristic: the HMGB (formerly HMG-1/-2) family, the HMGN (formerly HMG-14/-17) and the HMGA (formerly HMG-I/Y/C) family. The HMGB protein family, including HMGB1, HMGB2, and HMGB3, are highly conserved (more than 80% amino acid identity), and indistinguishable in their biochemical properties. The high-mobility group box 2 (HMGB2) is a ~25 kDa protein of 209 amino acids that consists of two homologous HMG-boxes rich in basic amino acids and an acidic tail at the carboxy-terminus. HMGB2 is restricted mainly to lymphoid organs and testes, although it is widely expressed in embryogenesis.Immunogensynthetic peptide corresponding to amino acid 165-181 of human HMGB2, conjugated to KLH. The corresponding sequence is conserved in mouse and differs by one amino acid in rat.ApplicationYale Center for High Throughput Cell Biology IF-tested antibodies. Each antibody is tested by immunofluorescence against HUVEC cells using the Yale HTCB IF protocol,.
Anti-HMGB2 (HMG2) antibody produced in rabbit has been used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
The high-mobility group box 1 and 2 (HMGB 1 & 2) proteins participate in the regulation of chromatin structure as well as being involved in transcription regulation, DNA repair, recombination, differentiation and extracellular signalling.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, rat, human packaging antibody small pack of 25 µL application(s) immunoprecipitation (IP): 5-10 µg using HEK-293T cell lysates.","indirect immunofluorescence: 1-2 µg/mL using fixed PC12 cultured cells.","western blot: 2-4 µg/mL using PC12 whole cell lysates. conjugate unconjugated UniProt accession no. P26583, shipped in dry ice storage temp. 20°C Gene Information human ... HMGB2(3148)
mouse ... Hmgb2(97165)
rat ... Hmgb2(29395)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-hnRNP A1 Antibody, clone 9H10
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 4-1469-25UG 4-1469 General descriptionThe hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and associate with pre-mRNAs in the nucleus. These complexes are associated with pre-mRNA processing and other aspects of mRNA metabolism and transport. While all hnRNPs are present in the nucleus, data suggests they shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by hnRNP A1 has two repeats of quasi-RRM domains that bind to RNAs. This abundant core protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. The hnRNP A1 protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may have a role in splice site selection.
Specificity
This antibody recognizes hnRNP A1.ImmunogenRecombinant protein corresponding to human hnRNP A1.
Epitope: UnknownApplicationAnti-hnRNP A1 Antibody, clone 9H10 is a Mouse Monoclonal Antibody for detection of hnRNP A1 also known as Helix-destabilizing protein or Single-strand RNA-binding protein & has been validated in WB.
Research Category
Epigenetics & Nuclear Function
Research Sub Category
RNA Metabolism & Binding Proteins
Quality
Evaluated by Western Blot in HeLa nuclear extract.
Western Blot Analysis: 0.01 µg/ml of this antibody detected hnRNP A1 on 10 µg of HeLa nuclear extract.
Target description
~ 38 kDa
Physical form
Protein G Purified
Purified mouse monoclonal IgG2bκ in buffer containing 0.1 M Tris-Glycine (pH 7.4, 150 mM NaCl) with 0.05% sodium azide.
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
HeLa nuclear extractOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 9H10, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2b NCBI accession no. NP_002127, UniProt accession no. P09651, shipped in ambient Gene Information human ... HNRNPA1(3178) Узнать цену -
Anti-hnRNP-E1/E2 (N-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер R4155-25UL R4155-200UL General descriptionhnRNP-E1/E2 (heterogeneous nuclear ribonucleoproteins) belongs to hnRNP (heterogeneous ribonucleoprotein) family. It is also known as poly-C binding proteins (PCBP) 1 and 2. It is located on chromosome 2p13. PCBP1 gene has no intron and codes for a 356 amino acid poly (rC) binding protein 1, that is of 35kDa. It has three K-Homology (KH) domains and two nuclear localization signals.ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Biochem/physiol Actions
hnRNP-E1/E2 (heterogeneous nuclear ribonucleoproteins) participates in the development and progression of tumor. It is involved in several transcriptional and posttranscriptional events like mRNA transcription regulation, transportation, splicing, translation, and stabilization. It plays critical roles in cancer apoptosis, metastasis, invasion and malignant transformation. It may also participates in epithelial-mesenchymal transition (EMT).
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~37 kDa species reactivity human, rat, mouse packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoprecipitation (IP): 5-10 µg using K562 cell extract","western blot: 0.5-1 µg/mL using K562 cell extract conjugate unconjugated UniProt accession no. Q15365, shipped in dry ice storage temp. 20°C Gene Information human ... PCBP1(5093)
mouse ... Pcbp1(23983)
rat ... Pcbp1(500242)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HOXA3 antibody produced in rabbit
MDL number: MFCD02263083 NACRES: NA.41
Кат. номер H3791-25UL H3791-200UL General descriptionHomeobox A3 (HOXA3) transcription factor/protein belongs to the HOX family. The HOXA3 gene is mapped on the human chromosome at 7p15.2.
Specificity
Anti-HOXA3 specifically recognizes HOXA3.ApplicationAnti-HOXA3 antibody produced in rabbit may be used in:- proximity ligation assay
- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
Disruption of the homeobox A3 (HOXA3) gene results in embryonic lethality, which was rescued by placing HOXD3. HOXA3 gene expression is upregulated during neovascularization as a result of injury indicating that HOXA3 promotes angiogenesis. Mutations of the HOXA3 gene are associated with defects in thymus organogenesis and parathyroid development.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide
Storage and Stability
Store at 20 °C. For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze at 20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation. Discard working dilutions if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~60 kDa species reactivity mouse, human packaging antibody small pack of 25 µL concentration ~1.0 mL/mL application(s) immunoprecipitation (IP): 5-10 µg using lysates of HEK-293T cells expressing human HOXA3","indirect immunofluorescence: 2-5 µg/mL using paraformaldehyde fixed HEK-293T cells over expressing human HOXA3","western blot: 2-4 µg/mL using lysates of HEK-293T cells over expressing human HOXA3 conjugate unconjugated UniProt accession no. O43365, shipped in dry ice storage temp. 20°C Gene Information human ... HOXA3(3200)
mouse ... Hoxa3(15400)
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HOXB7 antibody produced in rabbit
Human Protein Atlas Number: HPA049940 Human Protein Atlas characterization data
Кат. номер HPA049940-100UL HPA049940-25UL General descriptionHomeobox B7 (HOXB7) is part of the HOX gene family and is expressed in embryonic tissues. The gene encoding it is localized on human chromosome 17q21.32.Immunogenhomeobox B7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Homeobox B7 (HOXB7) has a role in many cellular processes. It has been shown to be expressed in hepatocellular carcinoma. It may also have a role in cell migration and invasion in gastric cancer. This transcription factor is vital for tissue differentiation and embryogenesis.HOXB7 may be a potential drug target in various cancers. The protein has the capacity to induce the expression of genes associated with tumor invasion and angiogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85071,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI conjugate unconjugated UniProt accession no. P09629, shipped in wet ice storage temp. 20°C Gene Information human ... HOXB7(3217)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HOXB8 (N-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер H2916-25UL H2916-200UL General descriptionHomeobox B8 (HOXB8) protein is a part of the homeobox (HOX) containing complex. HOXB8 gene is expressed in the spinal cord during embryonic development. The HOXB8 gene is mapped on the human chromosome at 17q21.32.
Specificity
Anti-HOXB8 (N-terminal) recognizes human HOXB8 (also known as Hox-2D, Hox-2).ApplicationAnti-HOXB8 (N-terminal) antibody produced in rabbit may be used in immunoblotting.
Biochem/physiol Actions
Overexpression of the homeobox B8 (HOXB8) gene is determined as a cause for leukemia. The HOXB8 protein blocks the myeloid differentiation by a mechanism that requires interaction with preBcell leukemia homeobox (Pbx) protein.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~30 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) western blot: 1-2 µg/mL using lysates of HEK-293T cells over expressing human HOXB8 conjugate unconjugated UniProt accession no. P17481, shipped in dry ice storage temp. 20°C Gene Information human ... HOXB8(3218)
mouse ... Hoxb8(15416)
rat ... Hoxb8(24457)
Safety InformationWGK Germany 1 Узнать цену -
Anti-HOXD9 (Internal Region) antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200030-25UL SAB4200030-200UL General descriptionThere are 39 homeobox (HOX) genes in vertebrates. They are divided into four clusters (HOXA−HOXD), located on different chromosomes (7p15, 17q21.2, 12q13 and 2q31). Each cluster contains 9−11 member genes encoding relatively small gene products containing a highly conserved 60-amino-acid region (the homeobox), with DNA-binding activity that contributes to their activity as transcription factors. The HOX genes are evolutionarily conserved.ApplicationAnti-HOXD9 (Internal Region) antibody produced in rabbit has been used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
Homeobox (HOX) transcription factors control important development pathways involved embryo morphogenesis. HOX genes mainly participate in the formation of the body plan during embryonic development. Altered homeobox gene function or expression is implicated in the development of cancers such as leukemias or neoplasms of the breast, prostate, kidney, colon, skin, and brain. HOXD9 is involved in patterning of forelimb, axial skeleton and embryonic segmentation. It might promote cell migration, invasion and metastasis in hepatocellular carcinoma. HOXD9 was shown to be involved in the early stages of normal joint development and also in the pathologic process of arthritis.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~40 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoprecipitation (IP): 2.5-5 µg using lysates of HEK-293T cells over expressing human HOXD9","indirect immunofluorescence: 2-5 µg/mL using paraformaldehyde fixed HEK-293T cells over expressing human HOXD9","western blot: 1-2 µg/mL using lysates of HEK-293T cells over expressing human HOXD9 conjugate unconjugated UniProt accession no. P28356, shipped in dry ice storage temp. 20°C Gene Information human ... HOXD9(3235)
mouse ... Hoxd9(15438)
rat ... Hoxd9(688999)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HOXD9 antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200029-25UL SAB4200029-200UL General descriptionIn vertebrates, there are 39 homeobox (HOX) genes that are organized into four clusters (HOXA-HOXD), located on different chromosomes (7p15, 17q21.2, 12q13, and 2q31). Each cluster contains 9−11 member genes encoding relatively small gene products containing a highly conserved 60-amino-acid region (the homeobox), with DNA-binding activity that contributes to their activity as transcription factors.ApplicationAnti-HOXD9 antibody produced in rabbit has been used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
Homeobox (HOX) genes are evolutionarily conserved transcription factors, that control important development pathways involved in morphogenesis of the embryo. One of the major functions of HOX genes seems to be the formation of the body plan during embryonic development. In addition to roles in normal development, altered homeobox gene function or expression is implicated in the development of cancers such as leukemias or neoplasms of the breast, prostate, kidney, colon, skin and brain. HOXD9 is involved in the development processes such as patterning of forelimb, axial skeleton and embryonic segmentation. It might promote cell migration, invasion and metastasis in hepatocellular carcinoma. HOXD9 was shown to be involved in the early stages of normal joint development and also in the pathologic process of arthritis.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal mol wt antigen ~40 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoprecipitation (IP): 2.5-5 µg using lysates of HEK-293T cells over expressing human HOXD9","indirect immunofluorescence: 2.5-5 µg/mL using paraformaldehyde fixed HEK-293T cells over expressing human HOXD9","western blot: 0.5-1 µg/mL using lysates of HEK-293T cells over expressing human HOXD9 conjugate unconjugated UniProt accession no. P28356, shipped in dry ice storage temp. 20°C Gene Information human ... HOXD9(3235)
mouse ... Hoxd9(15438)
rat ... Hoxd9(688999)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HPa2 Antibody, clone DHIC2-2B4
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2045-100UG MABS2045-25UG General descriptionPancreas performs both the endocrine and the exocrine function. The bulk of pancreas is composed of exocrine cells that produce digestion enzymes which are released into ducts to be emptied into the duodenum. The endocrine pancreas is composed of islets of Langerhans that produce hormones. At least five distinct endocrine cell types have been identified in the endocrine pancreas, each producing a different hormone. Beta cells produce insulin, which is considered as an anabolic hormone and regulates blood glucose levels and is also involved in fat and protein synthesis. Alpha cells produce glucagon that acts when blood glucose levels are low. Ductal cells of pancreas form the epithelial lining of the branched tubes that deliver digestive enzymes into the duodenum. They also secrete bicarbonate to neutralize acidic contents coming in from stomach. Duct cells may contribute up to 10% of all pancreatic cells. Acinar cells function as a unit of the exocrine pancreas and they synthesize, store, and secrete digestive enzymes (lipase, alpha amylase, trypsin, and chymotrypsin), which under normal physiological conditions are activated only after reaching the duodenum. Premature activation of these enzymes within pancreatic acinar cells can lead to acute pancreatitis. Clone DHIC2-2B4 can be used to detect alpha cells in human pancreatic islets. (Ref.: Dorrell, C., et al. (2008). Stem Cell Research (2008). 1(3); 183-194; Grapin-Botton, A (2005). Int. J. Biochem. Cell Biol. 37(3); 504-510; Leung, PS (2006). Int. J. Biochem. Cell Biol. 38(7); 1024-1030).
Specificity
Clone DHIC2-2B4 specifically detects alpha cells in human pancreatic tissue sections.ImmunogenTrypsin-dissociated human pancreatic islet cells containing low levels of exocrine and ductal cells.ApplicationImmunohistochemistry Analysis: A representative lot detected HPa2 in Immunohistochemistry applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94).
Flow Cytometry Analysis: A representative lot detected HPa2 in Flow Cytometry applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94; Bramswig, N.C., et. al. (2013). J Clin Invest. 123(3):1275-84; Dorrell, C., et. al. (2016). Nat Commun. 7:11756).
Detects Alpha cells of human pancreatic islets using this mouse monoclonal Anti-HPa2, clone DHIC2-2B4, Cat. No. MABS2045, tested for use in Immunohistochemistry (Paraffin) and Flow Cytometry.
Quality
Evaluated by Immunohistochemistry (Paraffin) in alpha cells of human pancreatic tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected HPa2 in alpha cells of human pancreatic tissue sections.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone DHIC2-2B4, monoclonal species reactivity human packaging antibody small pack of 25 μg application(s) flow cytometry: suitable, immunohistochemistry: suitable (paraffin) isotype IgG1λ Узнать цену -
Anti-HPa3 Antibody, clone HIC3-2D12
eCl@ss: 32160702
Кат. номер MABS1998-25UG MABS1998-100UG General descriptionPancreas performs both the endocrine and the exocrine function. The bulk of pancreas is composed of exocrine cells that produce digestion enzymes which are released into ducts to be emptied into the duodenum. The endocrine pancreas is composed of islets of Langerhans that produce hormones. At least five distinct endocrine cell types have been identified in the endocrine pancreas, each producing a different hormone. Beta cells produce insulin, which is considered as an anabolic hormone and regulates blood glucose levels and is also involved in fat and protein synthesis. Alpha cells produce glucagon that acts when blood glucose levels are low. Ductal cells of pancreas form the epithelial lining of the branched tubes that deliver digestive enzymes into the duodenum. They also secrete bicarbonate to neutralize acidic contents coming in from stomach. Duct cells may contribute up to 10% of all pancreatic cells. Acinar cells function as a unit of the exocrine pancreas and they synthesize, store, and secrete digestive enzymes (lipase, alpha amylase, trypsin, and chymotrypsin), which under normal physiological conditions are activated only after reaching the duodenum. Premature activation of these enzymes within pancreatic acinar cells can lead to acute pancreatitis. Clone HIC-2D2 can be used to mark all non-beta endocrine cell types in human pancreatic tissue. (Ref.: Dorrell, C., et al. (2008). Stem Cell Research (2008). 1(3); 183-194; Grapin-Botton, A (2005). Int. J. Biochem. Cell Biol. 37(3); 504-510; Leung, PS (2006). Int. J. Biochem. Cell Biol. 38(7); 1024-1030).
Specificity
Clone HIC3-2D12 detects human pancreatic non-beta endocrine cells.ImmunogenHuman pancreatic islets enriched in non-beta endocine cells.ApplicationAnti-HPa3, clone HIC3-2D12, Cat. No. MABS1998, is a mouse monoclonal antibody that detects human pancreatic non-beta endocrine cells and has been tested for use in Flow Cytometry and Immunohistochemistry (Paraffin).
Research Category
Signaling
Flow Cytometry Analysis: A representative lot detected HPa3 in Flow Cytometry applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94; Bramswig, N.C., et. al. (2013). J Clin Invest. 123(3):1275-84; Dorrell, C., et. al. (2016). Nat Commun. 7:11756).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human pancreatic tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected HPa3 in human pancreatic tissue sections.
Physical form
Purified mouse monoclonal antibody IgM in PBS with 0.05% sodium azide.
Format: Purified
Purified by ion-exchange chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone HIC3-2D12, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunohistochemistry: suitable (paraffin) isotype IgM NCBI accession no. NP_004608.1, UniProt accession no. P48230, Узнать цену -
Anti-HPCAL1 Antibody, clone 1E10
eCl@ss: 32160702
Кат. номер MABC1139-25UG MABC1139-100UG General descriptionHippocalcin-like protein 1 (UniProt: P37235; also known as Calcium-binding protein BDR-1, HLP2, Visinin-like protein 3, VILIP-3) is encoded by the HPCAL1 (also known a BDR1) gene (Gene ID: 3241) in human. HPCAL1 is a lipid-anchor membrane protein of the visinin-like subfamily of neural calcium sensor and is involved in the calcium-dependent regulation of rhodopsin phosphorylation. It is structurally related to Ca2+-myristoyl switch proteins that contain four EF-hand motifs and a covalently attached N-terminal myristoyl group. HPCAL1 is also expressed in Purkinje cells of the cerebellum and hippocampus where it is believed to regulate synaptic plasticity relevant for learning and memory. Clone 1E10 specifically detects denatured HPCAL1 protein that is endogenously expressed in several pancreatic cell lines. (Ref.: Chen, Y., et al. (2014). Monoclonal Antibodies in Immunodiagnosis and Immunotherapy 33(1); 20-27; Li, C., et al. (2016). PLoS One 11(11); e0165921).
Specificity
Clone 1E10 specifically detects Hippocalcin-like protein 1 (HPCAL1) in human cells.ImmunogenPurified native and denatured human HPCAL1.ApplicationWestern Blotting Analysis: A representative lot detected HPCAL1 in Western Blotting applications (Chen, Y., et. al. (2014). Monoclon Antib Immunodiagn Immunother. 33(1):20-7).
Immunoprecipitation Analysis: A representative lot detected HPCAL1 in Immunoprecipitation applications (Chen, Y., et. al. (2014). Monoclon Antib Immunodiagn Immunother. 33(1):20-7).
Research Category
Apoptosis & Cancer
Detects Hippocalcin-like protein 1 using this mouse monoclonal Anti-HPCAL1, clone 1E10, Cat. No. MABC1139, tested for use in Western Blotting and Immunoprecipitation.
Quality
Evaluated by Western Blotting in Panc-1 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected HPCAL1 in Panc-1 cell lysate.
Target description
~22 kDa observed; 22.13 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 1E10, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2b NCBI accession no. NP_602293.1, UniProt accession no. P37235, Gene Information human ... HPCAL1(3241) Узнать цену -
Anti-HPCAL1 Antibody, clone 5A5
eCl@ss: 32160702
Кат. номер MABC1138-100UG MABC1138-25UG General descriptionHippocalcin-like protein 1 (UniProt: P37235; also known as Calcium-binding protein BDR-1, HLP2, Visinin-like protein 3, VILIP-3) is encoded by the HPCAL1 (also known a BDR1) gene (Gene ID: 3241) in human. HPCAL1 is a lipid-anchor membrane protein of the visinin-like subfamily of neural calcium sensor and is involved in the calcium-dependent regulation of rhodopsin phosphorylation. It is structurally related to Ca2+-myristoyl switch proteins that contain four EF-hand motifs and a covalently attached N-terminal myristoyl group. HPCAL1 is also expressed in Purkinje cells of the cerebellum and hippocampus where it is believed to regulate synaptic plasticity relevant for learning and memory. Clone 5A5 can detect HPCAL1 in formalin-fixed 293 cells and in pancreatic cell lines. (Ref.: Chen, Y., et al. (2014). Monoclonal Antibodies in Immunodiagnosis and Immunotherapy 33(1); 20-27; Li, C., et al. (2016). PLoS One 11(11); e0165921).
Specificity
Clone 5A5 specifically detects Hippocalcin-like protein 1 (HPCAL1) in human cells.ImmunogenNative and denatured human HPCAL1.ApplicationImmunocytochemistry Analysis: A representative lot detected HPCAL1 in Immunocytochemistry applications (Chen, Y., et. al. (2014). Monoclon Antib Immunodiagn Immunother. 33(1):20-7).
ELISA Analysis: A representative lot detected HPCAL1 in ELISA applications (Chen, Y., et. al. (2014). Monoclon Antib Immunodiagn Immunother. 33(1):20-7).
Immunohistochemistry (Paraffin) Analysis: A 1:50-250 Dilution from a representative lot detected HPCAL1 in human kidney and human cerebellum tissue sections.
Research Category
Apoptosis & Cancer
Detects Hippocalcin-like protein 1 using this mouse monoclonal Anti-HPCAL1, clone 5A5, Cat. No. MABC1138, tested for use in Western Blotting, Immunohistochemistry (Paraffin), ELISA and Immunocytochemistry.
Quality
Evaluated by Western Blotting in Panc-1 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected HPCAL1 in Panc-1 cell lysate.
Target description
~22 kDa observed; 22.13 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5A5, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_602293.1, UniProt accession no. P37235, Gene Information human ... HPCAL1(3241)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HPd2 Antibody, clone DHIC3-5H10
eCl@ss: 32160702
Кат. номер MABS2044-25UG MABS2044-100UG General descriptionPancreas performs both the endocrine and the exocrine function. The bulk of pancreas is composed of exocrine cells that produce digestion enzymes which are released into ducts to be emptied into the duodenum. The endocrine pancreas is composed of islets of Langerhans that produce hormones. At least five distinct endocrine cell types have been identified in the endocrine pancreas, each producing a different hormone. Beta cells produce insulin, which is considered as an anabolic hormone and regulates blood glucose levels and is also involved in fat and protein synthesis. Alpha cells produce glucagon that acts when blood glucose levels are low. Ductal cells of pancreas form the epithelial lining of the branched tubes that deliver digestive enzymes into the duodenum. They also secrete bicarbonate to neutralize acidic contents coming in from stomach. Duct cells may contribute up to 10% of all pancreatic cells. Acinar cells function as a unit of the exocrine pancreas and they synthesize, store, and secrete digestive enzymes (lipase, alpha amylase, trypsin, and chymotrypsin), which under normal physiological conditions are activated only after reaching the duodenum. Premature activation of these enzymes within pancreatic acinar cells can lead to acute pancreatitis. Clone DCHI3-5H10 can be used to detect duct cells in human pancreatic tissue. (Ref.: Dorrell, C., et al. (2008). Stem Cell Research (2008). 1(3); 183-194; Grapin-Botton, A (2005). Int. J. Biochem. Cell Biol. 37(3); 504-510; Leung, PS (2006). Int. J. Biochem. Cell Biol. 38(7); 1024-1030).
Specificity
Clone DCHI3-5H10 specifically detects human pancreatic duct cells.ImmunogenTrypsin-dissociated human pancreatic duct cells.ApplicationResearch Category
Signaling
Anti-HPd2, clone DHIC3-5H10, Cat. No. MABS2044, is a mouse monoclonal antibody that detects Duct2 cells of pancreas and has been tested for use in Immunofluorescence and Immunohistochemistry (Paraffin).
Immunofluorescence Analysis: A representative lot detected HPd2 in Immunofluorescence applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human pancreatic tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected HPd2 in human pancreatic tissue sections.
Physical form
Purified mouse monoclonal antibody IgM in PBS with 0.05% sodium azide.
Format: Purified
Purified by ion-exchange chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone DHIC3-5H10, monoclonal species reactivity human packaging antibody small pack of 25 μg application(s) immunofluorescence: suitable, immunohistochemistry: suitable (paraffin) isotype IgMκ
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HPd3 Antibody, clone DHIC5-4D9
eCl@ss: 32160702
Кат. номер MABS2040-100UG MABS2040-25UG General descriptionPancreas performs both the endocrine and the exocrine function. The bulk of pancreas is composed of exocrine cells that produce digestion enzymes which are released into ducts to be emptied into the duodenum. The endocrine pancreas is composed of islets of Langerhans that produce hormones. At least five distinct endocrine cell types have been identified in the endocrine pancreas, each producing a different hormone. Beta cells produce insulin, which is considered as an anabolic hormone and regulates blood glucose levels and is also involved in fat and protein synthesis. Alpha cells produce glucagon that acts when blood glucose levels are low. Ductal cells of pancreas form the epithelial lining of the branched tubes that deliver digestive enzymes into the duodenum. They also secrete bicarbonate to neutralize acidic contents coming in from stomach. Duct cells may contribute up to 10% of all pancreatic cells. Acinar cells function as a unit of the exocrine pancreas and they synthesize, store, and secrete digestive enzymes (lipase, alpha amylase, trypsin, and chymotrypsin), which under normal physiological conditions are activated only after reaching the duodenum. Premature activation of these enzymes within pancreatic acinar cells can lead to acute pancreatitis. Clone DHIC5-4D9 can be used to detect duct cells in human pancreas and liver tissue. (Ref.: Dorrell, C., et al. (2008). Stem Cell Research (2008). 1(3); 183-194; Grapin-Botton, A (2005). Int. J. Biochem. Cell Biol. 37(3); 504-510; Leung, PS (2006). Int. J. Biochem. Cell Biol. 38(7); 1024-1030).
Specificity
Clone DHIC5-4D9 detects human pancreatic and liver duct cells.ImmunogenHuman pancreas enriched in duct cells.ApplicationResearch Category
Signaling
Anti-HPd3, clone DHIC5-4D9, Cat. No. MABS2040, is a mouse monoclonal antibody that detects pancreatic and hepatic ductal cells and has been tested for use in Immunohistochemistry (Paraffin).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human pancreas and human liver tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected HPd3 in human pancreas and human liver tissue sections.
Physical form
Purified by ion-exchange chromatography
Purified mouse monoclonal antibody IgM in PBS with 0.05% sodium azide.
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone DHIC5-4D9, monoclonal species reactivity human packaging antibody small pack of 25 μg application(s) immunohistochemistry: suitable (paraffin) isotype IgMκ
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HPi2 Antibody, clone HIC1-2B4
eCl@ss: 32160702
Кат. номер MABS1999-25UG MABS1999-100UG General descriptionPancreas performs both the endocrine and the exocrine function. The bulk of pancreas is composed of exocrine cells that produce digestion enzymes which are released into ducts to be emptied into the duodenum. The endocrine pancreas is composed of islets of Langerhans that produce hormones. At least five distinct endocrine cell types have been identified in the endocrine pancreas, each producing a different hormone. Beta cells produce insulin, which is considered as an anabolic hormone and regulates blood glucose levels and is also involved in fat and protein synthesis. Alpha cells produce glucagon that acts when blood glucose levels are low. Ductal cells of pancreas form the epithelial lining of the branched tubes that deliver digestive enzymes into the duodenum. They also secrete bicarbonate to neutralize acidic contents coming in from stomach. Duct cells may contribute up to 10% of all pancreatic cells. Acinar cells function as a unit of the exocrine pancreas and they synthesize, store, and secrete digestive enzymes (lipase, alpha amylase, trypsin, and chymotrypsin), which under normal physiological conditions are activated only after reaching the duodenum. Premature activation of these enzymes within pancreatic acinar cells can lead to acute pancreatitis. Clone HIC-2B4 can be used to detect all endocrine cells in human pancreatic tissue. (Ref.: Dorrell, C., et al. (2008). Stem Cell Research (2008). 1(3); 183-194; Grapin-Botton, A (2005). Int. J. Biochem. Cell Biol. 37(3); 504-510; Leung, PS (2006). Int. J. Biochem. Cell Biol. 38(7); 1024-1030).
Specificity
Clone HIC1-2B4 detects human pancreatic enriched islet cells.ImmunogenHuman pancreatic enriched islet cells containing low levels of exocrine and ductal cells.ApplicationAnti-HPi2, clone HIC1-2B4, Cat. No. MABS1999, mouse monoclonal antibody that detects human pancreatic enriched islet cells. and has been tested for use in Flow Cytometry, Immunofluorescence, and Immunohistochemistry (Paraffin).
Flow Cytometry Analysis: A representative lot detected HPi2 in Flow Cytometry applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94; Dorrell, C., et. al. (2016). Nat Commun. 7:11756).
Immunofluorescence Analysis: A representative lot detected HPi2 in Immunofluorescence applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94).
Research Category
Signaling
Quality
Evaluated by Immunohistochemistry (Paraffin) in human pancreatic tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected HPi2 in human pancreatic tissue sections.
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone HIC1-2B4, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable (paraffin) isotype IgG2b NCBI accession no. NP_001013269.1, Узнать цену -
Anti-HPx1 Antibody, clone HIC0-3B3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2042-100UG MABS2042-25UG General descriptionPancreas performs both the endocrine and the exocrine function. The bulk of pancreas is composed of exocrine cells that produce digestion enzymes which are released into ducts to be emptied into the duodenum. The endocrine pancreas is composed of islets of Langerhans that produce hormones. At least five distinct endocrine cell types have been identified in the endocrine pancreas, each producing a different hormone. Beta cells produce insulin, which is considered as an anabolic hormone and regulates blood glucose levels and is also involved in fat and protein synthesis. Alpha cells produce glucagon that acts when blood glucose levels are low. Ductal cells of pancreas form the epithelial lining of the branched tubes that deliver digestive enzymes into the duodenum. They also secrete bicarbonate to neutralize acidic contents coming in from stomach. Duct cells may contribute up to 10% of all pancreatic cells. Acinar cells function as a unit of the exocrine pancreas and they synthesize, store, and secrete digestive enzymes (lipase, alpha amylase, trypsin, and chymotrypsin), which under normal physiological conditions are activated only after reaching the duodenum. Premature activation of these enzymes within pancreatic acinar cells can lead to acute pancreatitis. Clone HICO-3B3 can be used to detect exocrine cells in human pancreatic tissue. (Ref.: Dorrell, C., et al. (2008). Stem Cell Research (2008). 1(3); 183-194; Grapin-Botton, A (2005). Int. J. Biochem. Cell Biol. 37(3); 504-510; Leung, PS (2006). Int. J. Biochem. Cell Biol. 38(7); 1024-1030).
Specificity
Clone HICO-3B3 specifically detects human pancreas exocrine cells.ImmunogenHuman pancreatic enriched exocrine cells.ApplicationResearch Category
Signaling
Anti-HPx1, clone HIC0-3B3, Cat. No. MABS2042, is a mousse monoclonal antibody that detects human pancreas exocrine cells and has been tested for use in Flow Cytometry, Immunofluorescence, and Immunohistochemistry (Paraffin).
Immunofluorescence Analysis: A representative lot detected HPx1 in Immunofluorescnece applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94).
Flow Cytometry Analysis: A representative lot detected HPx1 in Flow Cytometry applications (Dorrell, C., et. al. (2008). Stem Cell Res. 1(3):183-94; Dorrell, C., et. al. (2016). Nat Commun. 7:11756).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human pancreatic tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected HPx1 in human pancreatic tissue sections.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone HICO-3B3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable (paraffin) isotype IgG1 NCBI accession no. NP_001493.2,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HSD17B10 Antibody, clone 5F3
eCl@ss: 32160702
Кат. номер MABN2416 MABN2416-25UG General description3-hydroxyacyl-CoA dehydrogenase type-2 (UniProt: Q99714; also known as 17-beta-hydroxysteroid dehydrogenase 10, 17-beta-HSD 10, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, 3-hydroxyacyl-CoA dehydrogenase type II, Endoplasmic reticulum-associated amyloid beta-peptide-binding protein, Mitochondrial ribonuclease P protein 2, Mitochondrial RNase P protein 2, Short chain dehydrogenase/ reductase family 5C member 1, Short-chain type dehydrogenase/reductase XH98G2, Type II HADH) is encoded by the HSD17B10 (also known as ERAB, HADH2, MRPP2, SCHAD, SDR5C1, XH98G2) gene (Gene ID: 3028) in human. 3-hydroxyacyl-CoA dehydrogenase type-2 is a part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5-ends. It functions in mitochondrial tRNA maturation. It catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. It catalyzes the third step in the beta-oxidation of fatty acids and also carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. With C21 steroids it exhibits 20-beta-OH and 21-OH dehydrogenase activities. May contribute to neuronal dysfunction associated with Alzheimer disease (AD) via interactions with intracellular amyloid-beta peptides. 3-hydroxyacyl-CoA dehydrogenase type-2 is ubiquitously expressed in normal tissues, but is overexpressed in neurons affected in AD.
Specificity
Clone 5F3 detects 3-hydroxyacyl-CoA dehydrogenase type-2 in human and murine cells.ImmunogenGST-tagged full length recombinant human 3-hydroxyacyl-CoA dehydrogenase type-2 protein (ERAB/HADH).ApplicationElectron Microscopy Analysis: A representative lot detected HSD17B10 in Electron Microscopy applications (Wen, G.Y., et. al. (2002). Brain Res. 954(1):115-22).
Immunocytochemistry Analysis: A representative lot detected HSD17B10 in Immunocytochemistry applications (Frackowiak, J., et. al. (2001). Brain Res. 907(1-2):44-53).
Western Blotting Analysis: A representative lot detected HSD17B10 in Western Blotting applications (Frackowiak, J., et. al. (2001). Brain Res. 907(1-2):44-53).
Immunohistochemistry Analysis: A 1:250-1:1,000 dilution from a representative lot detected HSD17B10 in human placenta and human breast cancer tissues.
Research Category
Neuroscience
Anti-HSD17B10 antibody, clone 5F3, Cat. No. MABN2416, is a highly specific mouse monoclonal antibody that targets HSD17B10 and has been tested for use in Electron Microscopy, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Western Blotting in HEK293T cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected HSD17B10 in 10 µg of HEK293T cell lysate.
Target description
~27 kDa observed; 26.92 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5F3, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) electron microscopy: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_004484.1, UniProt accession no. Q99714,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HSD3B1 Antibody, clone 4C1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2068-25UG MABS2068-100UG General description3 beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type 1 (UniProt: P14060; also known as 3 beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type I, 3-beta-HSD I, Trophoblast antigen FDO161G) is encoded by the HSD3B1 (also known as 3BH, HSDB3A) gene (Gene ID: 3283) in human. HSD3B1 is a single -pass membrane protein localized in mitochondria and endoplasmic reticulum. Its transmembrane region is localized to amino acids 288-308. It is a bifunctional enzyme that catalyzes the oxidative conversion of Delta 5-ene-3-beta-hydroxy steroid and causes oxidative conversion of ketosteroids. It plays a vital role in the biosynthesis of all classes of hormonal steroids. Humans have two HSD3B isozymes. HSD3B1 is mainly expressed in the placenta, mammary and, prostate glands, and other peripheral tissues including the skin and adipose tissue and HSD3B2 is expressed primarily in the adrenal and gonads. They exhibit about 93% sequence homology. (Ref.: Gomez-Sanchez, CE et al. (2017). Steroids 127; 56-61).
Specificity
Clone 4C1 detects 3-beta-HSD I (HSD3B1) in human tissues. It targets an epitope with in 14 amino acids from the N-terminal region.ImmunogenA KLH-conjugated linear peptide corresponding to 14 amino acids from the N-terminal region of human 3 beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type 1 (HSD3B1).
Epitope: N-terminusApplicationImmunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected HSD3B1 in human adrenal gland tissue sections.
ELISA Analysis : A representative lot detected HSD3B1 in ELISA applications (Gomez-Sanchez, C.E., et. al. (2017). Steroids. 127:56-61).
Western Blotting Analysis: 1 µg/mL from a representative lot detected HSD3B1 in human placenta tissue lysate in Western blotting applications.
Immunohistochemistry (Paraffin) Analysis: A representative lot detected HSD3B1 in Immunohistochemistry applications (Gomez-Sanchez, C.E., et. al. (2017). Steroids. 127:56-61).
Western Blotting Analysis: A representative lot detected HSD3B1 in Western Blotting applications (Gomez-Sanchez, C.E., et. al. (2017). Steroids. 127:56-61).
Research Category
Signaling
Anti-HSD3B1, clone 4C1, Cat. No. MABS2068, is a mouse monoclonal antibody that detects 3-beta-HSD I (HSD3B1) and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Immunohistochemistry (Paraffin) in human placenta tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected HSD3B1 in human placenta tissue sections.
Target description
~38 kDa observed; 42.25 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 4C1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2b NCBI accession no. NP_000853.1, UniProt accession no. P14060, Gene Information human ... HSD3B1(3283)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HSD3B2 Antibody, clone 6
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2067-25UG MABS2067-100UG General description3-beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type 2 (UniProt: P26439; also known as 3 beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type II, 3-beta-HSD II, 3-beta-HSD adrenal and gonadal type) is encoded by the HSD3B2 (also known as HSDB3B) gene (Gene ID: 3284) in human. (3-beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type 2 (UniProt: P26439; also known as 3 beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type II, 3-beta-HSD II, 3-beta-HSD adrenal and gonadal type) is encoded by the HSD3B2 (also known as HSDB3B) gene (Gene ID: 3284) in human. Humans have two HSD3B isozymes. HSD3B1 is mainly expressed in the placenta, mammary and, prostate glands, and other peripheral tissues including the skin and adipose tissue and HSD3B2 is expressed primarily in the adrenal and gonads. They exhibit about 93% sequence homology. 3-beta-HSD II is a single-pass membrane protein found on mitochondrial and endoplasmic reticulum membranes. It is expressed in adrenal gland, testis and ovary. It is a bifunctional enzyme that catalyzes the oxidative conversion of Delta 5-ene-3-beta-hydroxy steroid and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. Mutations in HSD3B2 gene are reported to cause adrenal hyperplasia that is characterized by androgen excess, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Mild HSD3B2 deficiency in hyperandrogenic females is associated with characteristic traits of polycystic ovary syndrome, such as insulin resistance and luteinizing hormone hypersecretion (Ref.: Gomez-Sanchez, CE et al. (2017). Steroids 127; 56-61).
Specificity
Clone 6 specifically detects HSDB32 in human tissue. it targets an epitope with in 14 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids from the N-terminal region of human 3-beta-hydroxysteroid dehydrogenase/Delta 54-isomerase type 2 (3-beta-HSD).ApplicationImmunohistochemistry (Paraffin) Analysis: A representative lot detected HSD3B2 in Immunohistochemistry appliations (Gomez-Sanchez, C.E., et al. (2017). Steroids. 127:56-61).
Western Blotting Analysis: Analysis: A representative lot detected HSD3B2 in Western Blotting appliations (Gomez-Sanchez, C.E., et al. (2017). Steroids. 127:56-61).
Immunohistochemistry (Paraffin) Analysis: A 1:50-250 dilution from a representative lot detected HSD3B2 in human adrenal gland and human placenta tissue sections.
ELISA Analysis: A representative lot detected HSD3B2 in ELISA appliations (Gomez-Sanchez, C.E., et al. (2017). Steroids. 127:56-61).
Research Category
Signaling
Anti-HSD3B2, clone 6, Cat. No. MABS2067, is a mouse monoclonal antibody that detects 3-beta-HSD II (HSD3B2) and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Western Blotting in human adrenal gland tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected HSD3B2 in human adrenal gland tissue lysate.
Target description
~40 kDa observed; 42.05 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 6, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2b NCBI accession no. NP_001159592.1, UniProt accession no. P26439, Узнать цену -
Anti-Hsp90 alpha Antibody, clone 1G6-D7
eCl@ss: 32160702
Кат. номер MABC1106-100UG MABC1106-25UG General descriptionHeat shock protein HSP 90-alpha (UniProt: P07900; also known as Heat shock 86 kDa, HSP 86, HSP86, Lipopolysaccharide-associated protein 2, LAP-2, LPS-associated protein 2, Renal carcinoma antigen NY-REN-38) is encoded by the HSP90AA1 (also known as HSP90A, HSPC1, HSPCA) gene (Gene ID: 3320) in human. HSP90 serves as a molecular chaperone that maintains the stability and functionality of numerous client proteins in an ATPase-dependent manner. It is known to interact dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle, and chaperone function. After the completion of the chaperoning process, properly folded client protein and co-chaperone leave HSP90 in an ADP-bound partially open conformation and finally, ADP is released from HSP90 which acquires an open conformation for the next cycle. HSP90 and its co-chaperones are also shown to modulate transcription at least at three different levels (a) by altering the steady-state levels of certain transcription factors in response to various physiological cues (b) modulating the activity of certain epigenetic modifiers, such as histone deacetylases, and (c) by participation in the eviction of histones from the promoter region of certain genes and thereby turn on gene expression. In its resting state, through the dimerization of its C-terminal domain, HSP90 forms a homodimer, which is defined as the open conformation. Upon ATP-binding, the N-terminal domain undergoes significant conformational changes and comes in contact to form an active closed conformation. Following the completion of its chaperoning activity, ATP molecule is hydrolyzed to ADP which then dissociates from HSP90 and directs the protein back to the resting state. This monoclonal antibody (clone 1G6-D7) is reported to inhibit both de novo tumor formation and expansion of already formed tumors in mice. (Ref.: Li, W., et al. (2012). Biochim. Biophys. Acta. 1823(3); 730 741; Zou, M., et al. (2017). Oncogene 36(15); 2160-2171).
Specificity
Clone 1G6-D7 is a mouse monoclonal antibody that detects HSP90 alpha and HSP90 beta in human cells. it targets an epitope within 9 amino acids from the internal region.ImmunogenA recombinant fragment corresponding to 115 amino acids from the F-5 region of human HSP90 alpha.ApplicationAnti-Hsp90 alpha, clone 1G6-D7, Cat. No. MABC1106, is a mouse monoclonal antibody that detects Hsp90 alpha, Hsp90 beta and has been tested for use in ELISA, Immunoprecipitation, Functional assay, Inhibition, and Western Blotting.
Immunoprecipitation Analysis: A representative lot immunoprecipitated Hsp90 alpha in Immunoprecipitation applications (Dong, H., et. al. (2016). Sci Rep. 6:20605).
ELISA Analysis: A representative lot detected Hsp90 alpha in ELISA applications (Zou, M., et. al. (2017). Oncogene. 36(15):2160-2171).
Affects Function Analysis: A representative lot blocked parental MDA-MB-231 cell invasion in a dose-dependent manner. (Zou, M., et. al. (2017). Oncogene. 36(15):2160-2171).
Western Blotting Analysis: A representative lot detected Hsp90 alpha in Western Blotting applications (Zou, M., et. al. (2017). Oncogene. 36(15):2160-2171).
Inhibits Activity/Function Analysis: A representative lot inhibited both de novo tumor formation and expansion of already formed tumors in mice. (Zou, M., et. al. (2017). Oncogene. 36(15):2160-2171).
Quality
Evaluated by Western Blotting in MDA-MB-231 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Hsp90 alpha in MDA-MB-231 cell lysate.
Target description
~90 kDa observed; 84.66 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1G6-D7, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","cell analysis: suitable (function assay)","immunoprecipitation (IP): suitable","inhibition assay: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001017963.2, UniProt accession no. P07900, Узнать цену -
Anti-HSP90 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-594 5-594-25UG 5-594-100UG
Specificity
Recognizes HSP90.ImmunogenFull-length protein purified from chicken brain; clone D7aApplicationThis Anti-HSP90 Antibody is validated for use in IP, WB for the detection of HSP90.
Quality
routinely evaluated by immunoblot on RIPA lysates from mouse 3T3/A31 fibroblasts or human A431 cells
Target description
90 kDa
Physical form
Protein G Purified immunoglobulin in 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4.
Format: PurifiedOther Notesfeature_concentration_valuePlease refer to lot specific datasheet.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone D7a, monoclonal species reactivity mouse, bovine, rabbit, human, pig, rat, chicken packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NM_005348, UniProt accession no. P07900, shipped in ambient Узнать цену -
Anti-HSP90 antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200812-25UL SAB4200812-100UL General descriptionHeat shock proteins 90 (HSP90) subunits α and β, also known as HSP90AA1 and HSP90AB1 respectively, belong to the heat shock proteins (HSPC) family of highly conserved chaperones proteins, which are classified according to their cellular localization and their expression pattern. These stress inducible proteins, which includes Hsp20, Hsp60, Hsp70, and Hsp90 are molecular chaperones that bind other proteins assisting their correct folding. Hsp90 is dispensable in bacteria but is essential, conserved and highly abundant in eukaryotes, even under nonstress conditions.
Specificity
Anti-HSP90 antibody specifically recognizes human, mouse and rat HSP90.ImmunogenSynthetic peptide corresponding to the C-terminal region of human HSP90, conjugated to KLHApplicationAnti-HSP90 antibody produced in rabbit has been used in various immunochemical techniques including immunoblotting (~90 kDa). Detection of the HSP90 band by Immunoblotting is specifically inhibited by the immunogen.
Biochem/physiol Actions
The heat shock proteins 90 (Hsp90) proteins facilitates various essential physiological processes such as cell survival, cell cycle control, hormone signaling, and apoptosis. Upregulated expression of Hsp90 is associated with the development of various pathological conditions, including several types of cancer, viral infection, inflammation, and neurodegenerative diseases.
Physical form
Solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt ~90 kDa species reactivity mouse, human, rat packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 1:125-1:250 using different cells extract conjugate (KLH) UniProt accession no. P07900, shipped in dry ice storage temp. 20°C Gene Information human ... HSP90AA1(3320)
mouse ... HSP90AA1(15519)
rat ... HSP90AA1(299331)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HsSAS-6 Antibody, clone 91.390.21 MABE1064-25UG
eCl@ss: 32160702 General descriptionSpindle assembly abnormal protein 6 homolog (UniProt: Q6UVJ0; also known as HsSAS-6) is encoded by the SASS6 (also known as SAS6) gene (Gene ID: 163786) in human. HsSAS-6 is a central scaffolding component of the centrioles that ensure their 9-fold symmetry. It functions to ensure that each centriole seeds the formation of a single procentriole per cell cycle. It is required for centrosome biogenesis and duplication and is essential for both for mother-centriole-dependent centriole duplication and deuterosome-dependent centriole amplification in multi-ciliated cells. It contains a 35 nM long coiled-coil domain that mediates homodimerization while the globular N-terminus links the dimers at an angle of 40 degrees to form the inner ring. Over-expression of SASS6 gene results in excess foci-bearing centriolar markers. Mutations in SASS6 are known to cause microcephaly 14 that is characterized by small head circumference, markedly reduced brain weight and disproportionately small cerebral cortex.
Specificity
Clone 91.390.21 detects HsSAS-6 protein in human cells. It targets an epitope with in 254 amino acids in the C-terminal half.ImmunogenHis-tagged recombinant fragment corresponding to 254 amino acids from the C-terminal half of human Spindle assembly abnormal protein 6 homolog (HsSAS-6).ApplicationDetect SASS6 using this mouse monoclonal Anti-HsSAS-6, clone 91.390.21, Cat. No. MABE1064-25UG, validated for use in Immunofluorescence, Immunoprecipitation and Western Blotting.
Research Category
Apoptosis & Cancer
Western Blotting Analysis: 1 µg/mL from a representative lot detected HsSAS-6 in 10 µg of HeLa cell lysate.
Western Blotting Analysis: A representative lot detected HsSAS-6 in RNAi in U2OS cell lysates (Courtesy of Professor Dr. Erich Nigg, Ph.D; Biozentrum, University of Basel, Switzerland).
Immunofluorescence Analysis: A representative lot detected HsSAS-6 in RNAi followed by immunofluorescence (Courtesy of Professor Dr. Erich Nigg, PhD; Biozentrum, University of Basel, Switzerland).
Immunofluorescence Analysis: A representative lot detected HsSAS-6 in Immunofluorescence applications (Kleylein-Sohn, J. et. al. (2007). Dev Cell. 13(2):190-202 ; Sonnen, K..,et. al. (2012). Biol Open 1(10):965-76; Arquint, C., et al. (2012). J Cell Sci. 125(Pt 5):1342-52 ).
Immunoprecipitation Analysis: A representative lot detected HsSAS-6 in RNAi followed by immunoprecipitation (Courtesy of Professor Dr. Erich Nigg, PhD; Biozentrum, University of Basel, Switzerland).
Quality
Evaluated by Western Blotting in U20S cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected HsSAS-6 in 10 µg of U2OS cell lysate.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2b UniProt accession no. Q6UVJ0,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Human CD11c (3.9) ColorWheel® Dye-Ready mAb CWA-1056-25UL
Specificity
Clone 3.9 is a mouse monoclonal antibody that detects Integrin alpha-X (CD11c). It targets an epitope within the I-domain from the N-terminal half.ImmunogenHuman monocytes and synovial cells.ApplicationAnti-Human CD11c (3.9) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Quality Control Testing:
Evaluated by Flow Cytometry in Human human peripheral blood mononuclear cells (PBMC).
Staining of one million human human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1056, Anti-Human CD11c (3.9) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or the equivalent amount of PE-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Integrin alpha-X (UniProt: P20702; also known as CD11 antigen-like family member C; Leu M5; Leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150-95; CD11c) is encoded by the ITGAX (also known as CD11C) gene (Gene ID: 3687) in human. CD11c is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-19), which is subsequently cleaved off to generate the mature form that contains a long extracellular domain (aa 20-1107), a transmembrane domain (aa 1108-1128), and a cytoplasmic domain (aa 1129-1163). CD11c is predominantly expressed in macrophages, monocytes, and granulocytes and along with integrin b2 it serves as a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. The aXb2 heterodimer binds many ligands, including collagen type 1, iC3b, fibrinogen, ICAM-1, and lipopolysaccharide. It is reported to mediate cell-cell interaction during inflammatory responses and is especially important in monocyte adhesion and chemotaxis. The I domains of CD11 are responsible for the binding of ligands and have a unique structure with 6-7 a-helixes and 6b sheets with interconnecting loops. In CD11c the loops on the I domain are involved in fibrinogen binding and loops a3-a4 and bD-a5 are reported to be more important for recognition of fibrinogen. (Ref.: Thomas Vorup-Jensen, T., et al. (2003). Proc. Natl. Acad. Sci. USA. 100(4); 1873-1878; Choi, J., and Nham, S-U. (2002). Biochem. Biophys. Res. Commun. 292(3); 756-760).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 3.9, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 127.38 kDa species reactivity human species reactivity (predicted by homology) nonhuman primates packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Unknown Protein ID accession no. NP_001273304.1, UniProt accession no. P20702, shipped in ambient storage temp. 2-8°C Gene Information human ... ITGAX;CD11C(3687) Узнать цену -
Anti-Human CD138 (MI15) ColorWheel® Dye-Ready mAb CWA-1044-25UL
Specificity
Clone MI15 is a mouse monoclonal antibody that detects Syndecan-1 (CD138). It targets an epitope within the extracellular domain.ImmunogenA mixture of U266 and XG-1 human myeloma cells.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in U266 cells.
Staining of one million human U266 cells was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1044, Anti-Human CD138 (MI15) ColorWheel Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or the equivalent amount of Cat. No. CWA-1013 Mouse IgG1 isotype control and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD138 (MI15) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Syndecan-1 (UniProt: P18827; also known as SYND1, CD138) is encoded by the SDC1 (also known as SDC) gene (Gene ID: 6382) in human. Syndecans are transmembrane proteoglycans (PGs) composed of a core protein to which growth factor binding glycosaminoglycan (GAG) side chains are attached. Four members of the Syndecan family have been studied and they include syndecan-1 that is mainly expressed in epithelial cells, syndecan-2 (fibroglycan, SDC2) is present on cells of mesenchymal origin, syndecan-3 (N-syndecan, SDC3) is found in neural tissue and cartilage, and syndecan-4 (amphiglycan, ryudocan, SDC4) is ubiquitously expressed. Syndecans are usually present on the cell surface, but they can also be released by the action of sheddases or accumulate in the cell nucleus and may also be present in body fluids. Syndecan-1 is a single-pass type I membrane protein that is produced with a signal peptide (aa 1-22), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 23-254), a transmembrane domain (aa 255-275), and a cytoplasmic domain (aa 276-310). It is a cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix. It plays a role in cell adhesion, motility, invasion, and intracellular signaling. Syndecan-1 is reported to perform these diverse functions by acting as a co-receptor for a variety of growth factor receptors or as a binding partner to integrins. Its shedding from cell surface is regulated by various matrix metalloproteinases (MMPs), including MMP-7, MMP-9, membrane-bound metalloproteinases (MT-MMP1), and by ADAM10 and ADAM17. (Ref.: Szatmari, T., and Dobra, K. (2013). Front. Oncol. 3: 310; Ramani, VC., et al. (2012). J. Biol. Chem. 287(13); 9952-9961).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone MI15, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 32.46 kDa species reactivity human species reactivity (predicted by homology) nonhuman primates, rat packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Extracellular domain Protein ID accession no. NP_001006947.2, UniProt accession no. P18827, shipped in ambient storage temp. 2-8°C Gene Information human ... SDC1;SDC(6382) Узнать цену -
Anti-Human CD15 (28) ColorWheel® Dye-Ready mAb CWA-1001-25UL
Specificity
Clone 28 is a mouse monoclonal antibody that detects human CD15.ImmunogenMonocytes separated from other peripheral leukocytes on fibronectin plates.ApplicationAnti-Human CD15 (28) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Quality Control Testing:
Evaluated by Flow Cytometry in human blood granulocytes .
Flow Cytometry Analysis: Staining of one million Whole human blood granulocytes was performed using 5 µl of a 1:1 mixture of Cat. No. CWA-1001, Anti-CD15 Antibody (28) Colorwheel® Mouse mAb and CW-PE Colorwheel® activated Phycoerythrin (PE) Dye or an equivalent amount of Mouse IgM isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Alpha-(1,3)-fucosyltransferase 4 (UniProt: P22083; also known as ELAM-1 ligand fucosyltransferase, Fucosyltransferase 4, Fucosyltransferase IV, Fuc-TIV, FucT-IV, Galactoside 3-L-fucosyltransferase, CD15) is encoded by the FUT4 (also known as ELFT, FCT3A) gene (Gene ID: 2526) in human. CD15 is a single-pass type II membrane protein of the glycosyltransferase 10 family. It contains a cytoplasmic domain (aa 1-147), a transmembrane domain (aa 148-172), and a lumenal domain (aa 173-530). It consists of a trisaccharide with the structure Gal-β(1-4)-(Fuc- (1-3))-GlcNAc and is related to another structure, sialyl-CD15 (NeuNAc- (2-3)-Gal-β(1-4)-(Fuc- (1-3))-GlcNAc; CD15s or sLex, where s refers to sialylated ), which differs only by the addition of a sialic acid linkage to the galactose in the core Lex trisaccharide. CD15 catalyzes alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens. It is shown to be a distinguishing marker for human myeloid cells, and it mediates neutrophil adhesion to dendritic cells. It is also involved in neutrophil functions, such as cell-cell interactions, phagocytosis, stimulation of degranulation, and respiratory burst. It is also considered as an important marker for neoplastic Reed Sternberg cells and can be useful for the diagnosis of Hodgkin s lymphoma. (Ref.: Gadhoum, SZ., and Sackstein, R (2008). Nat. Chem. Biol. 4(12); 751-757; Nakayama, F., et al. (2001).Glycobiol. Extracellular Matrices. 276(19); 16100-16106).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 28, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 59.08 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgM epitope sequence Unknown Protein ID accession no. NP_002024.1, UniProt accession no. P22083, shipped in ambient storage temp. 2-8°C Gene Information human ... FUT4(2526) Узнать цену -
Anti-Human CD16 (3G8) ColorWheel® Dye-Ready mAb CWA-1031-25UL
Specificity
Clone 3G8 is a mouse monoclonal antibody that detects human CD16.ImmunogenHuman neutrophilsApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis: Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1031, Anti-Human CD16 (3G8) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD16 (3G8) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Low affinity immunoglobulin gamma Fc region receptor III-A (UniProt: P08637; also known as CD16a antigen, Fc-gamma RIII-alpha, Fc-gamma RIII, Fc-gamma RIIIa, FcRIII, FcRIIIa, FcR-10, IgG Fc receptor III-2, CD16a) is encoded by the FCGR3A (also known as CD16A, FCG3, FCGR3, IGFR3) gene (Gene ID: 2214) in human. CD16 is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa1-16), which is subsequently cleaved off to produce the mature form that contains an extracellular domain (aa 17-208), a transmembrane domain (aa 209-229), and a cytoplasmic domain (aa 230-254). It contains high mannose- and complex-type oligosaccharides and its Glycosylation at Asn-180 is shown to be essential for high affinity binding to the Fc and for discrimination between fucosylated and afucosylated IgG glycoforms. It is expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes, and placental trophoblasts. CD16 serves as a receptor for the Fc region of IgG and binds complexed or aggregated IgG and also monomeric IgG. Phenylalanine 203 in CD16a determines the transmembrane domains and serine 203 in CD16b determines the GPI-anchoring. CD16 is reported to mediate antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis and cytokine production. Mutations in FCGR3A gene have been linked to immunodeficiency 20 that is characterized by functional deficiency of NK cells and makes subjects vulnerable to severe herpes viral infections.
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 3G8, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 29.09 kDa species reactivity human species reactivity (predicted by homology) nonhuman primates packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Unknown Protein ID accession no. NP_001373379.1, UniProt accession no. P08637, shipped in ambient storage temp. 2-8°C Gene Information human ... FCGR3A(2214) Узнать цену -
Anti-Human CD2 (TS1/8) ColorWheel® Dye-Ready mAb CWA-1027-25UL
Specificity
Clone TS1/8 is a mouse monoclonal antibody that detects human T-cell surface antigen CD2 (CD2).ImmunogenCytotoxic T lymphocytesApplicationAnti-Human CD2 (TS1/8) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Quality Control Testing:
Evaluated by Flow Cytometry in Human PBMCs.
Flow Cytometry Analysis: Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1027, Anti-Human CD2 (TS1/8) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® activated Phycoerythrin (PE) Dye or the equivalent amount of Phycoerythrin (PE)-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
T-cell surface antigen CD2 (UniProt: P06729; also known as Erythrocyte receptor LFA-2, LFA-3 receptor, Rosette receptor, T-cell surface antigen T11/Leu-5, CD2) is encoded by the CD2 (also known as SRBC) gene (Gene ID: 914) in human. CD2 is a transmembrane glycoprotein of the immunoglobulin superfamily expressed on the surface of T cells, NK cells, thymocytes, and dendritic cells. It is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-24), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 25-209), a transmembrane domain (aa 210-235), and a cytoplasmic domain (aa 236-351). In its extracellular domain, it contains an Ig-like V-type domain (aa 25-128) and an Ig-Like C2 type domain (aa 129-209). CD2 serves as a receptor for the lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. The membrane-proximal domain of its extracellular region connects the adhesion (membrane-distal) domain to the cell membrane and may be involved in CD2 clustering following T cell activation. The membrane-distal domain is responsible for CD58 binding. CD2 is also involved in human T cell development and activation. It plays an important role in the formation and organization of the immunological synapse that is formed between T cells and antigen-presenting cells upon cell-cell conjugation and associated intracellular signaling. Its expression is reported to be upregulated on memory T cells as well as activated T cells. (Ref.: Binder, C., et al. (2020). Front. Immunol. 11; 1090; Moingeon, P., et al. (1989). Immunol. Rev. 111; 111-144).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone TS1/8, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 39.49 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Unknown Protein ID accession no. NP_001315538.1 , UniProt accession no. P06729, shipped in ambient storage temp. 2-8°C Gene Information human ... CD2(914) Узнать цену -
Anti-Human CD20 (2H7) ColorWheel® Dye-Ready mAb CWA-1036-25UL
Specificity
Clone 2H7 is a mouse monoclonal antibody that detects CD20. It targets an epitope within 16 amino acids from the second extracellular domain.ImmunogenHuman tonsillar B cells.ApplicationAnti-Human CD20 (2H7) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Quality Control Testing:
Evaluated by Flow Cytometry in Raji cells with Fc block.
Staining of one million Human Raji cells with Fc block was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1036, Anti-Human CD20 (2H7) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or the equivalent amount of Cat. No. CWA-1010 Mouse IgG2b isotype control and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
B-lymphocyte antigen CD20 (UniProt: P11836; also known as B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD20) is encoded by the MS4A1 (also known as CD20) gene (Gene ID: 931) in human. CD20 is a multi-pass homotetrameric, non-glycosylated membrane protein that is expressed on the surface of normal and malignant B-lymphocytes. CD20 expression is reportedly initiated at the pre-B cell stage of development and remains present until terminal differentiation into a plasma cell at which time it is lost. It has three cytoplasmic domains, four transmembrane domains, and two extracellular domains. Its both N- and C-termini reside within the cytoplasm. CD20 plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. It functions as a store-operated calcium channel component. It undergoes phosphorylation by PKC on serine and threonine residues in resting cells and these phosphorylations are reported to be higher in proliferating malignant B cells than in resting cells. CD20 is considered as an important therapeutic target in the treatment of B cell malignancies and various antibodies have been developed that bind to different epitopes . (Ref.: Pavlasova, G., and Mraz, M. (2020). Haematologica. 105(6); 1494-1506; Klein, C., et al. (2013). MAbs. 5(1); 22 33).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 2H7, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 33.08 kDa species reactivity human species reactivity (predicted by homology) nonhuman primates packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG2b epitope sequence Extracellular domain Protein ID accession no. NP_690606.1, UniProt accession no. P11836, shipped in ambient storage temp. 2-8°C Gene Information human ... MS4A1;CD20(931) Узнать цену -
Anti-Human CD235a (HIR-2) ColorWheel® Dye-Ready mAb CWA-1028-25UL
Specificity
Clone HIR-2 is a mouse monoclonal antibody that detects human CD235a (Glycophorin-A). It targets an epitope within the N-terminal region.ImmunogenSynthetic peptide from the N-terminal region of human CD235a.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in K562 cell line.
Flow Cytometry Analysis: Staining of one million K562 cells was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1028, Anti-Human CD235a (HIR-2) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® activated Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgG2b isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD235a (HIR-2) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Glycophorin-A (UniProt: P02724; also known as MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha, CD235a) is encoded by the GYPA (also known as GPA) gene (Gene ID: 2993) in human. Glycophorins are heavily glycosylated sialoglycoproteins and four different types have been described in humans: Glycophorins: A (CD235a), B, C and D. CD235a is a homodimeric, single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-19), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 20-91), a transmembrane domain (aa 92-114), and a cytoplasmic domain (aa 115-150). The extracellular domain contains one N-linked and sixteen O-linked oligosaccharide chains terminating in sialic acid residues that display negative charges on the red cell surface. CD235a is a major intrinsic membrane protein of the erythrocyte. In its N-terminal glycosylated segment, it has MN blood group receptors that are under the control of an autosomal locus found on chromosome 4, with two alleles LM and LN. CD235a appears to be important for the function of solute carrier family 4 member 1 (SLC4A1) and may be involved in translocation of SLC4A1 to the plasma membrane. It also functions as a complement regulator and a receptor for bacteria, viruses, and Plasmodium falciparum. (Ref.: Jaskiewicz, J., et al. (2019). Parasites & Vectors. 12; Article 317; Hassoun, H., et al. (1998). Blood. 91(6); 46-51).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone HIR-2, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 16.33 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG2b epitope sequence N-terminal Protein ID accession no. NP_002090.4 , UniProt accession no. P02724, shipped in ambient storage temp. 2-8°C Gene Information human ... GYPA(2993) Узнать цену -
Anti-Human CD25 (BC96) ColorWheel® Dye-Ready mAb CWA-1021-25UL
Specificity
Clone BC96 is a mouse monoclonal antibody that detects human CD25 (Interleukin-2 receptor subunit a).ImmunogenHuman Interleukin-2 receptor a (CD25).ApplicationAnti-Human CD25 (BC96) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Quality Control Testing:
Evaluated by Flow Cytometry in PHA-stimulated human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis: Staining of one million 3-day phytohemagglutinin (PHA)-stimulated Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1021, Anti-Human CD25 (BC96) Colorwheel® Dye-Ready mAb or an equivalent amount of PE-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Interleukin-2 receptor subunit alpha (UniProt: P01589; also known as IL-2 receptor subunit alpha, IL-2-RA, IL-2R subunit alpha, IL2-RA, TAC antigen, p55, CD25) is encoded by the IL2RA gene (Gene ID: 3559) in human. The IL-2 receptor (IL-2R) is composed of three different subunit complexes, the - (CD25), β- (CD122) and -chains (CD132). By itself, CD25 is not sufficient to trigger the IL-2 signaling pathway because it is a low-affinity form of the IL-2 receptor (KD = 10-8 M) that is non-functional with respect to IL-2 internalization and signaling due to its short cytoplasmic tail. It is mainly involved in IL-2 binding thereby stabilizing a secondary binding site for the β-chain and recruiting -chain to the cell surface. CD25 is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 22-240), a transmembrane domain (aa 241-259), and a cytoplasmic domain (aa 260-272). CD25 is mainly expressed on activated T -cells where it serves as a receptor for Interleukin-2 and is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity that suppresses the activation and expansion of autoreactive T-cells. Mutations in IL2RA gene have been linked to the development of insulin-dependent Diabetes mellitus. (Ref.: Driesen, J., et al. (2008). Immunobiology. 213(9-10); 849-858).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone BC96, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 30.82 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Unknown Protein ID accession no. NP_000408.1, UniProt accession no. P01589, shipped in ambient storage temp. 2-8°C Gene Information mouse ... IL2RA(3559) Узнать цену -
Anti-Human CD27 (O323) ColorWheel® Dye-Ready mAb CWA-1020-25UL
General descriptionColorwheel® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Specificity
Clone O323 is a mouse monoclonal antibody that detects Human CD27.ImmunogenHuman CD27 antigen (Tumor necrosis factor receptor superfamily member 7).ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis (FC): Staining of one million mouse splenocytes was performed using 5 µL of 1:1 mixture of Cat. No. CWA-1003, Anti-Human CD23 (2G8) Colorwheel® Dye-Ready mAb and CWD-PE, Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or an equivalent amount of a PE-conjugated Rat IgG2a isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD27 (O323) ColorWheel® Dye-Ready mAb, Cat. No. CWA-1020, is a mouse monoclonal antibody that detects human CD27 and is tested for use in Flow Cytometry. This antibody is designed for use with ColorWheel® Antibody-Ready dyes
Target description
CD27 antigen (UniProt: P26842; also known as CD27L receptor, T-cell activation antigen CD27, T14, Tumor necrosis factor receptor superfamily member 7, CD27) is encoded by the CD27 (also known as TNFRS7) gene (Gene ID: 939) in human. CD27 is a homodimeric, single-pass type I membrane protein that is expressed mainly in T-cells but is also reported to present in NK cells and B-cell populations. It serves as a receptor for CD70/CD27L and plays a vital role in activation, differentiation, and survival of T-cells. It is synthesized with a signal peptide (aa 1-19), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 20-191), a transmembrane domain (aa 192-212), and cytoplasmic domain (aa 213-260). CD27 -/- mice are reported to display impaired CD4+ and CD8+ response to influenza virus. Mutations in CD27 gene are known to cause lymphoproliferative syndrome 2, an autosomal recessive immunodeficiency disorder associated with persistent symptomatic EBV viremia, hypogammagobulinemia, and T-cell dysfunction. (Ref.: Thiemann, M., et al. (2018). Front. Oncol. 8; 387; Hendricks, J., et al. (2000). Nat. Immunol. 1(5); 433-440).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone O323, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 29.14 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Unknown Protein ID accession no. NP_001233.2, UniProt accession no. P26842, shipped in ambient storage temp. 2-8°C Gene Information human ... CD27(939) Узнать цену -
Anti-Human CD29 (MEM-101A) ColorWheel® Dye-Ready mAb CWA-1062-25UL
General descriptionColorwheel® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Specificity
Clone MEM-101A is a mouse monoclonal antibody that detects Integrin b1 (CD29). It targets an epitope within the extracellular domain.ImmunogenRaji Burkitt′s lymphoma cells.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis (FC): Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1062, Anti-Human CD29 (MEM-101A) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD29 (MEM-101A) Colorwheel® Dye-Ready mAb, Cat. No. CWA-1062, is a mouse monoclonal antibody that detects CD29 and is tested for use in Flow Cytometry.
Target description
Integrin beta-1 (UniProt: P05556; also known as Fibronectin receptor subunit beta, Glycoprotein IIa, GPIIA, VLA-4 subunit beta, CD29 is encoded by the ITGB1 (also known as FNRB, MDF2, MSK12) gene (Gene ID: 3688) in human. Integrins are heterodimeric integral membrane proteins composed of a variable a subunit and a conserved b subunit that function in cell surface adhesion and signaling. They contain a large extracellular domain responsible for ligand binding, a single transmembrane domain, and a cytoplasmic domain. The exact combination of various a- and b-subunits dictates the binding specificity of integrins to different ECM components. Although both subunits are required for adhesion, the binding specificity primarily depends on the extracellular portion of the a-subunit. Integrin b1 is a single-pass type I membrane glycoprotein that associates with one of the a subunits to form receptor for fibronectin. It recognizes the sequence R-G-D in a wide array of ligands. Five isoforms of integrin b1 have been reported that are produced by alternative splicing. Integrin b1 is synthesized with a signal peptide (aa 1-20) that is subsequently cleaved off. The mature form has an extracellular domain (aa 21-728), a helical domain (aa 729-751) and a cytoplasmic region (aa 752-798). Isoform 1 of integrin b1 is widely expressed and other isoforms are generally co-expressed with a more restricted distribution. Isoform 2 is expressed in skin, liver, skeletal muscle, cardiac muscle, placenta, umbilical vein endothelial cells, neuroblastoma cells, lymphoma cells, hepatoma cells and astrocytoma cells. Isoform 3 and isoform 4 are expressed in muscle, kidney, liver, placenta, cervical epithelium, umbilical vein endothelial cells, fibroblast cells, embryonal kidney cells, platelets and several blood cell lines. Isoform 4 is selectively expressed in peripheral T-cells and isoform 5 is expressed specifically in striated muscle (skeletal and cardiac muscle). Isoform 2 is reported to interfere with isoform 1 resulting in a dominant negative effect on cell adhesion and migration (in vitro). (Ref.: Balcaz, A., et al. (1993). J. Cell Biol. 121(1); 171-178).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone MEM-101A, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 88.42 kDa species reactivity human species reactivity (predicted by homology) porcine, canine packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Extracellular domain Protein ID accession no. NP_596867.1, UniProt accession no. P05556, shipped in ambient storage temp. 2-8°C Gene Information human ... ITGB1(3688) Узнать цену -
Anti-Human CD3 (UCHT1) ColorWheel® Dye-Ready mAb CWA-1019-25UL
Specificity
Clone UCHT1 is a mouse monoclonal antibody that detects human T-cell surface glycoprotein CD3.ImmunogenHuman infant thymocytes and peripheral blood lymphocytes from a Szary Syndrome donor.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis (FC): Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of 1:1 mixture of Cat. No. CWA-1019, Anti-Human CD3 (UCHT1) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or an equivalent amount of a PE-conjugated Mouse IgG1 isotype control.
Anti-Human CD3 (UCHT1) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
T-cell surface glycoprotein CD3 epsilon chain (UniProt: P07766; also known as T-cell surface antigen T3/Leu-4 epsilon chain, CD3e) is encoded by the CD3E (also known as T3E) gene (Gene ID: 916) in human. CD3 is a single-pass type I membrane protein that is a part of the TCR-CD3 complex present on T-cells and plays an essential role in adaptive immune response. The TCR CD3 complex is formed through noncovalent association of TCR with a CD3 signalling apparatus consisting of the , , and subunits. It is synthesized with a signal peptide (aa 1-22), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 23-126), a transmembrane protein (aa 127-152), and a cytoplasmic domain (aa 153-207). The CD3 complex performs two major functions. Firstly, CD3 chains are required for intracellular signaling where tyrosines in its immunoreceptor tyrosine-based activation motif (ITAM) domain (aa 178-205) are phosphorylated by Lck. Secondly, the CD3 complex is involved in TCR surface expression. In the endoplasmic reticulum, the TCR heterodimer physically associate with the CD3 complex prior to moving to the Golgi for glycosylation and subsequently translocating to the T-cell surface. Mutations in CD3E gene are known to cause immunodeficiency 18 (IMD18) that is characterized by recurrent infections in infancy or early childhood with variable severity. (Ref.: Dong, D., et al. (2019). Nature. 573(7775); 546-552).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone UCHT1, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 23.15 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Unknown Protein ID accession no. NP_000723.1, UniProt accession no. P07766, shipped in ambient storage temp. 2-8°C Gene Information human ... CD3E(916) Узнать цену -
Anti-Human CD33 (WM53) ColorWheel® Dye-Ready mAb CWA-1004-25UL
Specificity
Clone WM53 is a mouse monoclonal antibody that detects human Myeloid cell surface antigen CD33. It targets an epitope within the V-Ig-like domain of isoform 1 (CD33M).ImmunogenAcute Myeloid Leukemia (AML) cells.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis: Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1004, Anti-CD33 Antibody (WM53) Colorwheel® Mouse mAb and Cat. No. CWD-PE Colorwheel® activated Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
This mouse monoclonal Anti-Human CD33 (WM53) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Myeloid cell surface antigen CD33 (UniProt: P20138; Sialic acid-binding Ig-like lectin 3, Siglec-3, gp67, CD33) is encoded by the CD33 (also known as SIGLEC3) gene (Gene ID: 945) in human. CD33 is a disulfide-linked homodimeric, single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-17), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 18-259), a transmembrane domain (aa 260-282), and a cytoplasmic domain (aa 283-364). In its extracellular region it contains one Ig-like V-type domain (aa 19-135) and a Ig-Like C2 type domain (aa 145-228). In its cytoplasmic domain it has two ITIM motifs (aa 338-343 and 356-361) that are involved in modulation of cellular responses. These motifs can be phosphorylated by Src-like kinases and phosphorylated ITIM motifs can bind to SH2 domains of several SH2-containing phosphatases. Phosphorylation of CD33 by LCK on tyrosine 340 is involved in its binding to PTPN6 and PTPN11. CD33 is mainly expressed in monocytic/myeloid lineage cells. Its expression is also observed on microglial cells in the brain. It plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state. It is present in a vast majority of subjects with Acute Myeloid Leukemia (AML), but is absent from pluripotent hematopoietic stem cells. Clone WM53 is reported to specifically detect CD33M isoform. It recognizes an epitope located in the Ig-like V type domain, which is only expressed in CD33M. (Ref.: Walter, RB., et al. (2012). Blood. 119(26); 6198-6208; Prez-Oliva, AB., et al. (2011). Glycobiology. 21(6); 757-770; Taylor, VC., et al. (1999). J. Biol. Chem. 274(17); 11505-11512).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone WM53, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 39.82 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG2a epitope sequence N-terminal half Protein ID accession no. NP_001763.3 , UniProt accession no. P20138, shipped in ambient storage temp. 2-8°C Gene Information human ... CD33(945) Узнать цену -
Anti-Human CD35 (E11) ColorWheel® Dye-Ready mAb CWA-1024-25UL
Specificity
Clone E11 is a mouse monoclonal antibody that detects human Complement receptor type 1 (CD35).ImmunogenAcute monocytic leukemia cells and normal human blood monocytes.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis: Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1024, Anti-CD35 Antibody (E11) Colorwheel® Mouse mAb and Cat. No. CWD-PE Colorwheel® activated Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD35 (E11) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Complement receptor type 1 (UniProt: P17927; also known as C3b/C4b receptor, CD35) is encoded by the CR1 (also known as C3BR) gene (Gene ID: 1378) in human. CD35 is a single-pass type I membrane glycoprotein of the receptors of complement activation (RCA) family. It is synthesized with a signal peptide (aa 1-42), which is subsequently cleaved off to generate the mature form that contains a long extracellular domain (aa 42-1971) , a transmembrane domain (aa 1972-1996), and a cytoplasmic domain (aa 1997-2039). It contains 30 Sushi domains. Its expression has been reported on erythrocytes, a subset of T-cells, mature B cells, follicular dendritic cells, monocytes, and granulocytes. It serves as a membrane immune adherence receptor that plays a critical role in the capture and clearance of complement -opsonized pathogens by erythrocytes and monocytes/macrophages. Its ligands include C3b, iC3b, and C4b fragments of C3 and C4 proteins. CD35 also acts as an inhibitor of spontaneous complement activation by impairing the formation and function of the alternative and classical pathways C3/C5 convertases, and by serving as a cofactor for the cleavage of C3b to iC3b, C3c, and C3d, C3g, and C4b, C4c, and C4d by factor I. It also plays a role in immune regulation by contributing, upon ligand binding, to the generation of regulatory T cells from activated helper T cells and inn maintaining a balance between normal and pathological B-cell activation. (Ref.: Mcsik-Valent, B., et al. (2019). Front. Immunol. 10; 1493; Kremlitzka, M., et al. (2013). Int. Immunol. 25(1); 25-33; Schifferli, JA., et al. (1988). J. Immunol. 140(3); 899-904).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone E11, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 223.66 kDa species reactivity human species reactivity (predicted by homology) nonhuman primates packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Extracellular domain Protein ID accession no. NP_002380.3, UniProt accession no. P17927, shipped in ambient storage temp. 2-8°C Gene Information human ... CR1(1378) Узнать цену -
Anti-Human CD36 (CB38) ColorWheel® Dye-Ready mAb CWA-1025-25UL
Specificity
Clone CB38 is a mouse monoclonal antibody that detects human platelet glycoprotein 4 (CD36).ImmunogenHuman myeloid cells.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis: Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1025, Anti-CD36 Antibody (CB38) Colorwheel® Mouse mAb and Cat. No. CWD-PE Colorwheel® activated Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgM isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD36 (CB38) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Platelet glycoprotein 4 (UniProt: P16671; also known as Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD36) is encoded by the CD36 (also known as GP3B, GP4) gene (Gene ID: 948) in human. CD36 is a multi-pass membrane glycoprotein that contains two cytoplasmic domains (aa 2-7 and 462-472), one extracellular domain (aa 30-439), and two transmembrane domains (aa 8-29 and 440-461). It acts as a receptor for a broad range of ligands that can be of proteinaceous nature like thrombospondin, fibronectin, collagen, and amyloid-beta or of lipidic nature, such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids and bacterial diacylated lipopeptides. They are generally multivalent and can engage multiple receptors simultaneously. The resulting formation of CD36 clusters initiates signal transduction and internalization of receptor-ligand complexes. Cellular responses to these ligands are involved in angiogenesis, inflammatory response, fatty acid metabolism, and dietary fat processing in the intestine. It binds long-chain fatty acids and facilitates their transport into cells. In taste receptor cells, CD36 is reported to mediate an increase in intracellular calcium levels by long-chain fatty acids, leading to the activation of the gustatory neurons. Upon binding of oxLDL or amyloid peptide 42, it interacts with the TLR4:TLR6 heterodimer and the complex is then internalized and triggers inflammatory response, leading to NF-kB-dependent production of several cytokines. Mutations in CD36 gene are associated with Platelet glycoprotein IV deficiency that is characterized by macrothrombocytopenia.
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone CB38, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 53.05 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgM epitope sequence Extracellular domain Protein ID accession no. NP_002380.3, UniProt accession no. P16671, shipped in ambient storage temp. 2-8°C Gene Information human ... CD36(948) Узнать цену -
Anti-Human CD4 (OKT4) ColorWheel® Dye-Ready mAb CWA-1009-25UL
Specificity
Clone OKT4 is a mouse monoclonal antibody that detects human T-cell surface glycoprotein CD4 (CD4).ImmunogenHuman T-cell surface glycoprotein CD4.ApplicationAnti-Human CD4 (OKT4) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Quality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis: Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1009, Anti-Human CD4 (OKT4) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgG2b isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
T-cell surface glycoprotein CD4 (UniProt: P01730; also known as T-cell surface antigen T4/Leu-3, CD4) is encoded by the CD4 gene (Gene ID: 920) inn human. CD4 is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-25), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 26-396), a transmembrane domain (aa 397-418), and a cytoplasmic domain (aa 419-458). CD4 is highly expressed in T-helper cells and its expression is also observed in macrophages, dendritic cells, and NK cells. It plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, it functions primarily as a coreceptor for MHC class II molecule:peptide complex. It is shown to interact simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells. In turn, it recruits LCK to the vicinity of the TCR-CD3 complex and then LCK initiates different intracellular signaling pathways by phosphorylating various substrates, which ultimately lead to lymphokine production, motility, adhesion, and activation of T-helper cells. The OKT4 antibody binds to the D3 domain of CD4 and can be used as a phenotypic marker for CD4 expression. (Ref.: Helling, B., et al. (2015). Immunol. Cell Biol. 93(4); 396-405; Healey, D., et al. (1990). J. Exp. Med. 172(4); 1233-1242).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone OKT4, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 51.11 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG2b epitope sequence Unknown Protein ID accession no. QDC22486.1, UniProt accession no. P01730, shipped in ambient storage temp. 2-8°C Gene Information human ... CD4(920) Узнать цену -
Anti-Human CD40 (G28.5) ColorWheel® Dye-Ready mAb CWA-1023-25UL
Specificity
Clone G28.5 is a mouse monoclonal antibody that detects human Tumor necrosis factor receptor superfamily member 5 (CD40). It targets an epitope with in D1/B2 domain in the extracellular region.ImmunogenHuman erythrocyte-rosette-negative tonsillar lymphocytes.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis: Staining of one million Human peripheral blood mononuclear cells (PBMC) gated for lymphocytes was performed using 5 µL of a 1:1 mixture of Cat. No. CWA-1023, Anti-CD40 Antibody (G28.5) Colorwheel® Mouse mAb and Cat. No. CWD-PE Colorwheel® activated Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Mouse IgG1 isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD40 (G28.5) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Tumor necrosis factor receptor superfamily member 5 (UniProt: P25942; also known as B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40) is encoded by the CD40 (also known as TNFRSF5) gene (Gene ID: 958) in human. CD40, a member of the TNFR super family, is a single-pass type I membrane protein that is synthesized with a signal peptide (aa 1-20 ), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 21-193), a transmembrane domain (aa 194-215), and a cytoplasmic domain (aa 216-277). It has multiple cysteine-rich repeats. CD40 is expressed in B-cells, monocytes, dendritic cells, thymic epithelium as well as on certain carcinomas. It serves as a receptor for CD40L that is transiently expressed on T-cells and some non-immune cells under inflammatory conditions. Upon engagement with its ligand, CD40 directly or indirectly recruits TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6 to its cytoplasmic domains. The canonical consensus binding sites for TRAF1, TRAF2, and TRAF3 are situated at the membrane distal domain of the intracellular tail of CD40 and is defined by the amino acid sequence PxQxT. CD40 transduces TRAF6 and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. Clone G28.5 is reported to bind to an epitope localized in D1/B2 domains in the extracellular cysteine rich region and is a potent activator of B-cells. Mutations in CD40 gene are known to cause immunodeficiency with hyper-IgM3 (HIGM3) that is characterized by normal or elevated serum IgM levels with absence of IgG, IgA, and IgE. This results in a profound susceptibility to bacterial infections. (Ref.: Elgueta, R., et al. (2009). Immunol. Rev. 229(1); 152-172; Malmborg Hager, AC., et al. (2003). Scand. J, Immunol. 57(6); 517-524).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone G28.5, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 30.62 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG1 epitope sequence Extracellular domain Protein ID accession no. AAH64518.1, UniProt accession no. P25942, shipped in ambient storage temp. 2-8°C Gene Information human ... CD40(958) Узнать цену -
Anti-Human CD44 (IM7) ColorWheel® Dye-Ready mAb CWA-1002-25UL
Specificity
Clone IM7 is a rat monoclonal antibody that detects CD44.ImmunogenDexamethasone-induced murine myeloid leukemia M1 cells.ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in mouse splenoctytes.
Flow Cytometry Analysis (FC): Staining of one million mouse splenocytes was performed using 5 µL of 1:1 mixture of Cat. No. CWA-1002, Anti-Human CD44 (IM7) Colorwheel® Dye-Ready mAb and and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or an equivalent amount of PE-conjugated Rat IgG2b isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD44 (IM7) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
CD44 antigen (UniProt: P15379; also known as CDw44, Epican, Extracellular matrix receptor III, ECMR-III, GP90 lymphocyte homing/adhesion receptor, HUTCH-I, Heparan sulfate proteoglycan, Hermes antigen, Hyaluronate receptor, Phagocytic glycoprotein 1, PGP-1, Phagocytic glycoprotein I, PGP-I, CD44) is encoded by the CD44 (also known as LHR, MDU2, MDU3, MIC4) gene (Gene ID: 12505) in murine species. CD44 is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-22), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 23-685), a transmembrane domain (aa 686-707), and a cytoplasmic domain (aa 707-778). It is expressed on all leukocytes, endothelial cells, hepatocytes, and mesenchymal cells. The main ligand for CD44 is Hyaluronic acid (HA) that is expressed by stromal and cancer cells. HA binds the CD44 ligand binding domain and induces conformational changes that allow binding of adaptor proteins or cytoskeletal elements to intracellular domains. This leads to the activation of various signaling pathways leading to cell proliferation, adhesion, migration, and invasion. Overexpression of CD44 has been reported in several cell types and it is considered as an ideal marker for cancer stem cells. (Ref.: Chen, C., et al. (2018). J. Hematol. Oncol. 11; Article 64).
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source rat antibody form purified antibody antibody product type primary antibodies clone IM7, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 85.62 kDa species reactivity human, mouse packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG2b epitope sequence Unknown Protein ID accession no. NP_000601.3, UniProt accession no. P16070, shipped in ambient storage temp. 2-8°C Gene Information human ... CD44(12505) Узнать цену -
Anti-Human CD45RA (HI100) ColorWheel® Dye-Ready mAb CWA-1000-25UL
Specificity
Clone HI100 is a mouse monoclonal antibody that detects human CD45RA.ImmunogenHuman Receptor-type tyrosine-protein phosphatase C (CD45RA).ApplicationQuality Control Testing:
Evaluated by Flow Cytometry in Human peripheral blood mononuclear cells (PBMC).
Flow Cytometry Analysis (FC): Staining of one million Human peripheral blood mononuclear cells (PBMC) was performed using 5 µL of 1:1 mixture of Cat. No. CWA-1000, Anti-Human CD45RA (HI100) Colorwheel® Dye-Ready mAb and Cat. No. CWD-PE Colorwheel® Antibody-Ready Phycoerythrin (PE) Dye or an equivalent amount of a PE-conjugated Mouse IgG2b isotype control.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Human CD4 (OKT4) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Target description
Receptor-type tyrosine-protein phosphatase C (UniProt: P08575; also known as EC:3.1.3.48, Leukocyte common antigen, L-CA, T200, CD45) is encoded by the PTPRC (also known as CD45) gene (Gene ID: 5788 in human. CD45 is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-25), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 26-577), a transmembrane domain (aa 578-598), and a cytoplasmic domain (aa 599-1306). It also contains two tyrosine phosphatase (PTPase) domains that are localized to amino acids 653-912 and 944-1228. The first PTPase domain has enzymatic activity, while the second PTPase domain interacts with and stabilizes the first domain and can affect the its substrate specificity. CD45 is shown to dephosphorylate Fyn and Lck at their C-terminal tyrosine residues and upregulate their kinase activity. It can also inhibit Fyn and Lck activities by dephosphorylating their regulatory autophosphorylation site. CD45 expression is observed in lymphocytes, eosinophils, monocytes, basophils, and neutrophils. Several isoforms of CD45 have been described that are generated through alternative splicing. It is shown to be essential for T-cell activation through the antigen receptor. It acts as a positive regulator of T-cell co-activation upon binding to DPP4. Isoform CD45RA is expressed on approximately 50% of all peripheral CD4+ and CD8+ T-cells and on a some B cells and monocytes. It functions to enhance signaling through both the T-cell receptor and B-cell receptor. Clone HI100 is widely used as a leukocyte marker for nave and activated T-cells where naive T cells are positive for CD45RA and activated T-cells are negative for CD45RA.
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone HI100, monoclonal product line ColorWheel® form lyophilized mol wt calculated mol wt 138.03 kDa species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG2b epitope sequence Extracellular domain Protein ID accession no. NP_002829.3, UniProt accession no. P08575, shipped in ambient storage temp. 2-8°C Gene Information human ... PTPRC(5788) Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
