Small Pack Antibodies
- Сортировать:
- Вид таблицей
-
Anti-Glutamate Receptor 1 Antibody, phosphoSer 831
eCl@ss: 32160702 NACRES: NA.41
Кат. номер AB5847 AB5847-25UL
Specificity
Recognizes Glutamate Receptor 1 [GluR1], phosphoSer831. The antibody recognizes a protein of ~100 kDa corresponding to GluR1 phosphorylated at Ser831 in rat hippocampal homogenate. Immunolabeling of the GluR1 protein is blocked by the immunogen peptide but not by the corresponding non-phosphopeptide. The immunogen sequence is 100% homologous in human and mouse.ImmunogenSynthetic peptide corresponding to amino acids surrounding the phosphoSer831 of rat GluR1.
Epitope: phosphoSer 831ApplicationDetect Glutamate Receptor 1 using this Anti-Glutamate Receptor 1 Antibody, phosphoSer 831 validated for use in WB.
Research Category
Neuroscience
Research Sub Category
Neurotransmitters & Receptors
Western blot and dot blots: 1:500-1:1000. The working dilution should be based on the tissue and the expected phosphorylation state.
Optimal working dilutions must be determined by the end user.
Target description
100 kDaLinkageReplaces: 05-823
Physical form
ImmunoAffinity Purified
Affinity Purified immunoglobulin. Liquid in 10 mM HEPES, pH 7.5, with 150 mM NaCl, 100 μg/mL BSA and 50% glycerol.
Storage and Stability
Maintain for 1 year at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Hippocampal neurons, rat brain tissue lysates or mouse brain tissue lysateOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat packaging antibody small pack of 25 µL Торговая марка Chemicon® application(s) western blot: suitable NCBI accession no. NM_000827.2, UniProt accession no. P42261, shipped in dry ice Gene Information human ... GRIA1(2890)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutamate Receptor 1 Antibody, phosphoSer 845
eCl@ss: 32160702 NACRES: NA.41
Кат. номер AB5849-25UL AB5849 General descriptionGlutamate receptor 1 (AMPA) belongs to the glutamate-gated ion channel and binds AMPA, glutamate and kainate. L-Glutamate is the major excitatory neurotransmitter in the mammalian CNS, acting through both ligand gated ion channels (ionotropic receptors; composed of subunits GluR1-4) and G-protein coupled (metabotropic) receptors. The AMPA glutamate receptors mediate fast synaptic transmission in the CNS.
Specificity
Recognizes Glutamate Receptor 1 [GluR1], phosphoSe845. The antibody recognizes a protein of 100 kDa corresponding to GluR1 phosphorylated at Ser845.ImmunogenSynthetic peptide corresponding to amino acids surrounding the phosphoSer845 of rat GluR1.
Epitope: phosphoSer 845ApplicationAnti-Glutamate Receptor 1 Antibody, phosphoSer 845 is an antibody against Glutamate Receptor 1 for use in WB.
Western blot: 1:1,000
Optimal working dilutions must be determined by the end user.
Research Category
Neuroscience
Research Sub Category
Neurotransmitters & Receptors
Target description
100 kDa
Physical form
ImmunoAffinity Purified
Affinity Purified immunoglobulin. Liquid in 10 mM HEPES, pH 7.5, with 150 mM NaCl, 100 μg/mL BSA and 50% glycerol.
Storage and Stability
Maintain for 1 year at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Human brain tissueOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat packaging antibody small pack of 25 µL Торговая марка Chemicon® application(s) western blot: suitable NCBI accession no. NM_000827.2, UniProt accession no. P42261, shipped in dry ice Gene Information human ... GRIA1(2890)
Safety InformationWGK Germany WGK 2 Узнать цену -
Anti-Glutamate Receptor NMDAR1 (NR1) (Splice Variant Insert C1) antibody produced in rabbit
MDL number: MFCD02096426 NACRES: NA.41
Кат. номер G0166-25UG-PW G0166-25UG Immunogensynthetic peptide representing the sequence of the C1 splice variant.ApplicationAnti-Glutamate Receptor NMDAR1 (NR1) (Splice Variant Insert C1) antibody is suitable for immunohistochemistry (frozen sections) at a dilution of 1:1000-1:2000 and western blot at 1:1000 dilution using rat and mouse tissue.
Biochem/physiol Actions
NMDA receptors (NMDAR) are glutamate-gated ion channels. It is sensitive to N-methyl-D-aspartate (NMDA) and consists of several homologous subunits (NMDAR1). NMDAR is highly expressed in the central nervous system and involved in excitatory synaptic transmission as well as synaptic plasticity. The activity of NMDA receptors are modulated by glycine. It exhibits high calcium permeability and unique voltage-dependent sensitivity to magnesium. It has been reported that phosphorylated NMDA receptors may regulate their function and play a role in many forms of synaptic plasticity such as long-term potentiation.
Physical form
Lyophilized powder from 5 mM ammonium bicarbonate, so some residual salt may be present
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form lyophilized powder mol wt antigen 100 kDa species reactivity rat, mouse packaging antibody small pack of 25 µg application(s) immunohistochemistry (frozen sections): 1:1000-1:2000","western blot: 1:1000 using rat and mouse tissue conjugate unconjugated UniProt accession no. P35439, storage temp. 2-8°C Gene Information mouse ... Grin1(14810)
rat ... Grin1(24408)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutamate Receptor NMDAR1 (NR1) (Splice Variant Insert N1) antibody produced in rabbit
MDL number: MFCD02096429 NACRES: NA.41
Кат. номер G0541-25UG-PW G0541-25UG Immunogensynthetic peptide representing the sequence of the N1 splice variant.ApplicationAnti-Glutamate Receptor NMDAR1 (NR1) (Splice Variant Insert N1) antibody is suitable for dot blot, immunohistochemistry and western blot at a dilution of 1:1000.
Biochem/physiol Actions
NMDA receptors (NMDAR) are glutamate-gated ion channels. It is sensitive to N-methyl-D-aspartate (NMDA) and consists of several homologous subunits (NMDAR1). NMDAR is highly expressed in the central nervous system and involved in excitatory synaptic transmission as well as synaptic plasticity. The activity of NMDA receptors are modulated by glycine. It exhibits high calcium permeability and unique voltage-dependent sensitivity to magnesium. It has been reported that phosphorylated NMDA receptors may regulate their function and play a role in many forms of synaptic plasticity such as long-term potentiation.
Physical form
Lyophilized powder from 5 mM ammonium bicarbonate (some residual salt may be present)
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form lyophilized powder mol wt antigen 100 kDa species reactivity rat packaging antibody small pack of 25 µg application(s) dot blot: 1:1000","immunohistochemistry: 1:1000","western blot: 1:1000 conjugate unconjugated UniProt accession no. P35439, storage temp. 2-8°C Gene Information rat ... Grin1(24408)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutamate Receptor NMDAR1 (NR1) antibody produced in rabbit
MDL number: MFCD00282329 NACRES: NA.41
Кат. номер G8913-.2ML G8913-25UL General descriptionNMDAR1 is a subunit of N-methyl D-aspartate (NMDA) receptor which is a subtype of glutamate-gated ion channels with high calcium permeability. NMDA receptors have unique voltage-dependent sensitivity to magnesium and are modified by glycine. It has a pivotal role in neuronal development, pathogenesis of acute and chronic neurodegenerative disorders, synaptic plasticity as well as memory acquisition and learning. Anti-glutamate receptor NMDAR1 (NR1) antibody can be used for studying the expression and function of NMDAR1 in different cell types and tissues as well as to compare its expression pattern with physiological functions or pathological conditions. Rabbit anti-glutamate receptor NMDAR1 (NR1) antibody reacts specifically with NMDAR1 (116kD) derived from rat brain.
N-methyl-D-aspartate receptors (NMDAR1) is mainly expressed in mammalian brain. The gene is located on human chromosome 9q34.3.Immunogensynthetic peptide corresponding to the C-terminal region of rat NMDAR1 (amino acids 918-938). This sequence is identical in mouse NR1, human NR1 (short and long forms), and rat NR1 isoforms NR1b, NR1c, and NR1f.ApplicationAnti-Glutamate Receptor NMDAR1 (NR1) antibody produced in rabbit has been used in endogenous calmodulin co-immunoprecipitation and immunoprecipitation.
Anti-glutamate receptor NMDAR1 (NR1) antibody can be used as a primary antibody in western blotting. It can also be used to identify NR1 from rat brain synaptosomal fraction by using immunoblotting.
Biochem/physiol Actions
N-methyl-D-aspartate receptor1 (NMDAR1) regulates excitatory synaptic transmission. Abnormal functioning of this receptor is associated with epilepsy and schizophrenia.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% BSA and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 116 kDa species reactivity rat, human, mouse packaging antibody small pack of 25 µL application(s) western blot: 1:2,000 using extract of a rat brain synaptosomal fraction. conjugate unconjugated UniProt accession no. Q05586, shipped in dry ice storage temp. 20°C Gene Information human ... GRIN1(2902)
mouse ... Grin1(14810)
rat ... Grin1(24408)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutamic Acid Decarboxylase 65/67 antibody produced in rabbit
MDL number: MFCD01322096 NACRES: NA.41
Кат. номер G5163-.2ML G5163-25UL General descriptionGAD 65 has been identified as an autoantigen in insulin dependent diabetes mellitus (IDDM) and stiff-man syndrome (SMS).
GAD is highly expressed in GABAergic neurons and pancreatic β cells. It is transiently expressed in non-GABAergic embryonic and adult neurons, indicating a role in development. It is also present in testis, oviduct, and ovary GAD exists as two isoforms, GAD 65 and GAD 67 (molecular masses of 65 and 67 kDa, respectively) that are encoded by two different genes.< The protein is initially localized to cytosol and then gets anchored to the membrane upon post translational modification. The GAD2 gene is mapped to human chromosome 10p12.1.
Specificity
Reacts specifically with GAD 65 and GAD 67 isoforms in extracts of rat brain and rat pancreas.
Reacts specifically with GAD 65 and GAD 67 isoforms from brain.Immunogensynthetic peptide corresponding to the C-terminal region of human GAD 67 (amino acids 579-594). The sequence is identical in human GAD 65 (amino acids 570-585), in rat, mouse, and pig GAD 65, in rat, pig, and cat GAD 67, and is highly conserved in GAD 67 of mouse origin (single amino acid substitution).ApplicationAnti-Glutamic Acid Decarboxylase 65/67 antibody produced in rabbit has also been used in Immunohistochemistry and Immunocytochemistry.
Anti-GAD 65/67 may be used for the detection and localization of GAD 65/67 isoforms by immunofluorescence and immunohistochemistry in rat retinal cells, human subthalamus neurons, and pancreatic β-cells of rat. The minimum working dilution that may be used is 1:10000. Detection by immunoblotting may be possible in brain cells of monkey, human, rat and gecko. at a minimum working dilution of 1:1000.
Biochem/physiol Actions
Glutamic acid decarboxylase (GAD) is the key enzyme that catalyses the conversion of L-glutamate to -aminobutyric acid (GABA). GABA is a principal inhibitory neurotransmitter and a paracrine signal molecule in pancreatic islet cells.<
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 65-67 kDa species reactivity feline, human, rat, mouse, pig packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:1,000 using tissue sections of rat pancreas","microarray: suitable","western blot: 1:10,000 using rat brain extract conjugate unconjugated UniProt accession no. Q05329, shipped in dry ice storage temp. 20°C Gene Information human ... GAD2(2572)
mouse ... Gad2(14417)
rat ... Gad2(24380)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutamine Synthetase antibody produced in rabbit
MDL number: MFCD01322097 NACRES: NA.41
Кат. номер G2781-25UL G2781-100UL G2781-.2ML General descriptionAnti-Glutamine Synthetase is produced in rabbit using a synthetic peptide corresponding to the C-terminus of mouse glutamine synthetase (GS) conjugated to keyhole limpet hemocyanin (KLH) as immunogen. This sequence is identical in human, bovine, rat, hamster and pig GS, and highly conserved in chicken GS. GS is found in mammals as an octamer of identical 45 kDa subunits. It is localized in glial cells of various species. It is present in the brain primarily in astrocytes and in the retina in Muller glial cells that support neurons using glutamate as a neurotransmitter. GS is found in several brain regions including hippocampus, cerebral cortex, neostriatum and cerebellar granular layer, corresponding to sites with high glutamate receptor density.
Specificity
Anti-Glutamine synthetase recognizes rat glutamine synthetase (GS) (45 kDa). Staining of GS in immunoblotting is specifically inhibited with the GS immunizing peptide (amino acids 357-373 with Nterminally added lysine).Immunogensynthetic peptide corresponding to the C-terminal region of mouse glutamine synthetase (GS) (amino acids 357-373. This sequence is identical in human, bovine, rat, hamster, and pig GS and highly conserved chicken
Gs (single amino acid substitution).ApplicationAnti-Glutamine Synthetase antibody has been used for the detection and localization of GS by immunoblotting and immunohistochemistry.
Immunoblotting: a minimum working antibody dilution of 1:10,000 is determined using a rat brain cytosolic fraction extract.
Immunohistochemistry: a minimum working antibody dilution of 1:10,000 is determined using formalin-fixed, paraffin-embedded sections of rat brain.
Biochem/physiol Actions
Glutamine synthetase (GS) catalyzes the amidation of glutamate to form glutamine. In the brain, GS is considered as a key enzyme, participating in recycling of the excitatory neurotransmitter glutamate released from neurons and termination of the neurotransmitter signal, as well as in ammonia detoxification. GS activity is a useful marker for astrocytes and an important differentiation feature in the retina. Upregulation of GS is a hallmark of reactive astrocytosis and GS activity level increases following spinal cord injury. The GS expression in astrocytes is diminished in brains affected by Alzheimer′s disease, particularly in the vicinity of senile plaques. GS is upregulated in a subset of human hepatocellular carcinomas, suggesting that its expression may be related to tumor recurrence, since tumors expressing GS are independent of the extracellular glutamine supply.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 45 kDa species reactivity rat packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:10,000 using rat brain sections","microarray: suitable","western blot: 1:10,000 using rat brain cytosolic fraction conjugate unconjugated UniProt accession no. P09606, storage temp. 20°C Gene Information human ... GLUL(2752)
mouse ... Glul(14645)
rat ... Glul(24957)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutaredoxin-2 (Grx2)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS2053 ABS2053-25UG General descriptionGlutaredoxin-2, mitochondrial (UniProt: Q9NS18) is encoded by the GLRX2 (also known as GRX2, CGI-133) gene (Gene ID: 51022) in human. Glutaredoxin-2 is a glutathione-dependent oxidoreductase that is widely expressed and facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Its active form is a monomer and it can dimerize to an inactive form where homodimers are linked by one 2Fe-2S cluster. The 2Fe-2S may serve as a redox sensor and the presence of one-electron oxidants or reductants can lead to the loss of the 2Fe-2S cluster and subsequent monomerization and activation of the enzyme. Glutaredoxin-2 acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. It can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Glutaredoxin-2 is known to efficiently catalyze both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression of glutaredoxin-2 decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.
Specificity
This rabbit polyclonal antibody detects mitochondrial isoform of glutatedoxin-2. It targets an epitope with in 16 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids from the C-terminal half of human Glutaredoxin-2 .
Epitope: unknownApplicationAnti-Glutaredoxin-2 (Grx2), Cat. No. ABS2053, is a rabbit polyclonal antibody that detects Glutaredoxin-2, mitochondrial, and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Glutaredoxin-2 (Grx2) in human cerebellum and human tonsil tissue.
Research Category
Signaling
Quality
Evaluated by Western Blotting in A549 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Glutaredoxin-2 (Grx2) in 10 µg of A549 cell lysate.
Target description
~17 kDa observed; 18.05 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) chimpanzee (based on 100% sequence homology), baboon (based on 100% sequence homology), monkey (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_001230328, UniProt accession no. Q9NS18, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutathione Peroxidase 4 Antibody, clone Mab63-1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1969 MABF1969-25UG General descriptionPhospholipid hydroperoxide glutathione peroxidase, cytosolic (UniProt: P36969-2; also known as PHGPx, Glutathione peroxidase 4, GPx-4, GSHPx-4) is encoded by the GPX4 gene (Gene ID: 2879) in human. Three functionally distinct isozymes of GPx4 have been described and are known as mGPx4 (mitochondrial), cGPx4 (cytosolic), and nGPx4 (nuclear). They originate from a single GPX4 gene.
The cytosolic isoform is ubiquitously expressed at moderate levels in most mammalian cells. On the other hand, mitochondrial and nuclear isoforms are overexpressed in spermatoid cells. Clone Mab63-1 specifically recognizes cGPx4 in human and its ortholog in mouse. However, it does not recognize rat GPx4. GPx4 is a considered to be a moonlighting protein that has been implicated in anti-oxidative defense, gene expression regulation, and programmed cell death, and as a structural protein in spermatogenesis. Homozygous GPx4-deficient mice are reported to die utero before E7.5. Similarly, homozygous mice expressing catalytically inactive GPx4 variants (Sec46Ala/Ser mutant) do not survive beyond the 7th day of embryogenesis. (Ref.: Borchert, A., et al (2010). Immunol. Lett. 133 (2); 85-93).
Specificity
Clone Mab63-1 specifically detects cytosolic Glutathione Peroxidase 4 in human and murine cells. it targets a minimum epitope of 6 amino acids from the N-terminal region.ImmunogenHis-tagged purified recombinant human cytosolic glutathione peroxidase 4.ApplicationAnti-Glutathione Peroxidase 4, clone Mab63-1, Cat. No. MABF1969, is a mouse monoclonal antibody that detects cytosolic glutathione peroxidase 4 and has been tested for use in Dot Blot, Electron Microscopy, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Glutathione Peroxidase 4 in human testis and mouse testis tissues.
Immunoprecipitation Analysis: A representative lot detected Glutathione Peroxidase 4 in Immunoprecipitation applications (Borchert, A., et. al. (2010). Immunol Lett. 133(2):85-93).
Immunohistochemistry Analysis: A representative lot detected Glutathione Peroxidase 4 in Immunohistochemistry applications (Borchert, A., et. al. (2010). Immunol Lett. 133(2):85-93; Brutsch, S.H., et. al. (2015). Antioxid Redox Signal. 22(4):281-93).
Western Blotting Analysis: A representative lot detected Glutathione Peroxidase 4 in Western Blotting applications (Brutsch, S.H., et. al. (2015). Antioxid Redox Signal. 22(4):281-93; Borchert, A., et. al. (2010). Immunol Lett. 133(2):85-93).
Dot Blot Analysis: A representative lot detected Glutathione Peroxidase 4 in Dot Blot applications (Borchert, A., et. al. (2010). Immunol Lett. 133(2):85-93).
Electron Microscopy Analysis: A representative lot detected Glutathione Peroxidase 4 in Electron Microscopy applications (Brutsch, S.H., et. al. (2016). J Biol Chem. 291(45):23578-23588).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in HEK293 cells transfected with Gpx4.
Western Blotting Analysis: 2 µg/mL of this antibody detected Glutathione Peroxidase 4 in lysate of HEK293 cells transfected with Gpx4.
Target description
~19 kDa observed; 19.53 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone Mab63-1, monoclonal purified by affinity chromatography species reactivity mouse, human packaging antibody small pack of 25 µg application(s) dot blot: suitable","electron microscopy: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_002076.2, UniProt accession no. P36969-2, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Glutathione S-transferase A5 (GSTA5)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN1347 ABN1347-25UL General descriptionGlutathione S-transferase A5 (UniProt: Q7RTV2; also known as EC: 2.5.1.18, GST class-alpha member 5, Glutathione S-transferase A5-5) is encoded by the GSTA5 gene (Gene ID: 221357) in human. Glutathione S-transferases are soluble proteins that catalyze the conjugation of reduced glutathione and a variety of electrophiles, including many known carcinogens and mutagens. Glutathione S-transferase A5 is a homodimeric cytoplasmic protein with two glutathione binding sites. The mammalian glutathione S-transferases are active in drug metabolism are classified into the alpha, mu and pi classes. Members of the alpha-class of glutathione S-transferases show substrate specificity for cumene hydroperoxide (CuOOH) and 7-chloro-4-nitrobenz-2-oxa-1, 3-diazole (NBD-C1). They exhibit a number of differences from the characteristic glutathione S-transferase structure. For example, in its domain II, it contains a short 3-residue beta-strand near the C-terminal segment and a longer alpha-7 helix.
Specificity
This rabbit polyclonal antibody detects Glutathione S-transferase A5 in Human Liver. It targets an epitope within 14 amino acids from the internal region.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids from the internal region of human Glutathione S-transferase A5.ApplicationAnti-Glutathione S-transferase A5 (GSTA5) Antibody, Cat. No. ABN1347, is a highly specific rabbit polyclonal antibody that detects human Glutathione S-transferase A5 and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected Glutathione S-transferase A5 (GSTA5) in human liver tissue.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in human liver tissue lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected Glutathione S-transferase A5 (GSTA5) in human liver tissue lysate.
Target description
~25 kDa observed; 25.72 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) monkey (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NM_153699.1, UniProt accession no. Q7RTV2,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glutathione-S-Transferase (GST) antibody produced in rabbit
NACRES: NA.46
Кат. номер G7781-25UL G7781-100UL G7781-.2ML G7781-.5ML General descriptionThe antibody is specific for native as well as denatured-reduced forms of glutathione-S-transferase from Schistosoma japonicum. Anti-GST may be used in various immunoassays to identify the expression of GST fusion proteins.
Anti-Glutathione-S-Transferase (GST) antibody produced in rabbit is specific for native as well as denatured-reduced forms of glutathione-S-transferase from Schistosoma japonicum. The soluble GST is encoded by eight different genes in humans namely, , µ, , , , , and on chromosome 6, 1, 22, 11, 14, 4, not known and 10 respectively.Immunogenrecombinant GST from Schistosoma japonicum expressed in E. coli.ApplicationAnti-Glutathione-S-Transferase (GST) antibody produced in rabbit has been used in immunoblotting.
Biochem/physiol Actions
Glutathione-S-transferase (GST) catalyzes the detoxication of electrophiles by glutathione conjugation. This enzyme provides protection against oxidative stress and toxic foreign chemicals. Polymorphism in GST gene is associated with the development of asthma and cutaneous basal cell carcinoma.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution packaging antibody small pack of 25 µL application(s) dot blot: suitable, indirect ELISA: 1:10,000, western blot: 1:2,000 using lysates of induced Escherichia coli expressing GST conjugate unconjugated shipped in dry ice storage temp. 20°C
Safety InformationPersonal Protective Equipment Eyeshields,, Faceshields,, Gloves,, type ABEK (EN14387) respirator filter, RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Glycosaminoglycan Antibody, skin specific Antibody, clone PG-4
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT819 MABT819-25UL General descriptionProteoglycans (PG), present in all tissues, are one of the best-studied classes of matrix molecules. Over 50 members of PG have been characterized and studied for their biological significance. PG consist of a protein core to which glycosaminoglycan chains are covalently linked. Glycosaminoglycans (GAGs) are natural heteropolysaccharides that are present in every mammalian tissue. They are composed of repeating disaccharide units that consist of either sulfated or non-sulfated monosaccharides. Their molecular size and the sulfation type vary based on tissue type. The major types of GAGs found in mammalian tissues are: hyaluronan, chondroitin sulfate, and dermatan sulfate, heparin and heparan sulfate, and keratan sulfate. GAG chains are covalently bound to serine residues of the PG protein core via a tetrasaccharide linkage, consisting of xylose, two galactose residues and glucuronic acid. This antibody, clone PG-4, recognizes antigen that is associated with extracellular matrices and surfaces of cultured human dermal fibroblasts and the surfaces of cultured human adult keratinocytes. This antibody recognize native epitopes located within glycosaminoglycan chains and is detects both chondroitin sulfate (Versican) and dermatan sulfate (Decorin and Biglycan) proteoglycans. Treatment of PG with chondroitinases is reported to abolish its immunoreactivity for all antigens. (Ref.: Afratis, N et al. (2012). FEBS Journal 279 (7); 1177-1197; Sorrell, JM et al. (1999). Histochem. J. 31 (8); 549-558).
Specificity
Clone PG4 detects glycosaminoglycan in skin cells.ImmunogenCrude membrane fractions from adult human dermal fibroblasts from breast skin.ApplicationResearch Category
Cell Structure
Western Blotting Analysis: A representative lot detected Glycosaminoglycan in Western Blotting applications (Sorrell, J.M., et. al. (1999). Histochem J. 31(8):549-58).
ELISA Analysis: A representative lot detected Glycosaminoglycan in ELISA applications (Sorrell, J.M., et. al. (1999). Histochem J. 31(8):549-58).
Immunohistochemistry Analysis: A representative lot detected Glycosaminoglycan in Immunohistochemistry applications (Sorrell, J.M., et. al. (1999). Histochem J. 31(8):549-58).
Anti-Glycosaminoglycan, skin specific, clone PG-4, Cat. No. MABT819, is a mouse monoclonal antibody that detects glycosaminoglycan and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Immunohistochemistry (Paraffin) in human skin tissue.
Immunohistochemistry Analysis: A 1:250 dilution of this antibody detected Glycosaminoglycan in human skin tissue.
Target description
~60 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgM in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone PG-4, monoclonal species reactivity shark, human, chicken packaging antibody small pack of 25 μL application(s) ELISA: suitable, immunohistochemistry: suitable (paraffin), western blot: suitable isotype IgMκ shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Glypican-1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABT1385 ABT1385-25UL General descriptionGlypican-1 (UniProt: P35053; also known as GPC1, HSPG M12) is encoded by the Gpc1 gene (GeneID: 58920) in rat. Glypican-1 is attaches to the plasma membrane via glycosylphosphatidylinositol (GPI) anchors. It is a cell surface proteoglycan that bears heparan sulfate and may act as a catalyst in increasing the rate of conversion of prion protein PRPN(C) to PRNP(Sc) via associating with both forms of PRPN, targeting them to lipid rafts and facilitating their interaction. Glypican-1 is required for proper skeletal muscle differentiation. It sequesters FGF2 in lipid rafts and blocks its binding to FGF receptors. Glypican-1 is specifically enriched on cancer-cell-derived exosomes and levels of glypican-1 positive exosomes correlate with tumor burden and the survival of pre- and post-surgical patients. Glypican-1 expression, both mRNA and protein, is upregulated in human pancreatic cancers cells and adjacent fibroblasts. (Ref.: Melo, SA et al. 2015. Nature. 523(7559):177-82; Kleeff, J et al. 1998. J. Clin. Invest. 102(9), 1662 1673).
Specificity
This rabbit polyclonal antibody detects Glypican-1 in Rat C6 glioma cells.ImmunogenGST-tagged recombinant fragment corresponding to the first 423 amino acids of rat Glypican-1.
Epitope: unknownApplicationResearch Category
Cell Structure
Anti-Glypican-1 Antibody, Cat. No. ABT1385 is a rabbit polyclonal antibody that detects Glypican-1 and is tested for use in Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Western Blotting Analysis: A representative lot detected Glypican-1 in rat brain homogenates and rat C6 glioma cells treated with heparitinase (Liang, Y., et. al. (1997). J Cell Biol. 139(4):851-64).
Immunocytochemistry Analysis: A representative lot detected Glypican-1 in rat C6 glioma cells (Liang, Y., et. al. (1997). J Cell Biol. 139(4):851-64).
Immunohistochemistry Analysis: A representative lot detected Glypican-1 in rat spinal cord and brain (Liang, Y., et. al. (1997). J Cell Biol. 139(4):851-64).
Quality
Evaluated by Immunocytochemistry in Rat C6 glioma cells.
Immunocytochemistry Analysis: A 1:100 dilution of this antibody detected Glypican-1 in Rat C6 glioma cells.
Target description
61.73 kDa calculated.
Physical form
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity rat packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_110455, UniProt accession no. P35053,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GM130 Antibody, clone 4A3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT1363 MABT1363-25UL General descriptionGolgin subfamily A member 2 (UniProt: Q62839; also known as 130 kDa cis-Golgi matrix protein, GM130) is encoded by the Golga2 gene (Gene ID: 64528) in rat. GM130 is a peripheral membrane component of the cis-Golgi stack that acts as a membrane skeleton to maintain the structure of the Golgi apparatus, and as a vesicle tether that facilitates vesicle fusion to the Golgi membrane. GM130 is a homotetramer with a flexible rod-like structure. It has a nuclear localization sequence (aa 26-49) that mediates interaction with importin-alpha and recruits it to the Golgi membrane and liberates TPX2. GM130 promotes the mitotic spindle pole assembly by activating TPX2 to nucleate microtubules around the Golgi and capture them to couple mitotic membranes to the spindle. Phosphorylation of GM130 at Ser37 by CDK1 at the onset of mitosis inhibits its interaction with p115/USO1, which prevents its tethering of COPI vesicles and thereby inhibits transport through the Golgi apparatus during mitosis.
Specificity
Clone 4A3 detected Golgin subfamily A member 2 (GM130) in human liver cancer and human intestine sections.ImmunogenA full length recombinant human Golgin subfamily A member 2 (GM130).ApplicationResearch Category
Cell Structure
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected GM130 in human liver cancer tissue.
Western Blotting Analysis: A representative lot detected GM130 in Western Blotting applications (Diao, A., et. al. (2003) J Cell Biol. 160(2):201-12).
Immunocytochemistry Analysis: A representative lot detected GM130 in Immunocytochemistry applications (Seemann, J., et. al. (2002). Science. 295(5556):848-51; Diao, A., et. al. (2003) J Cell Biol. 160(2):201-12).
Immunohistochemistry Analysis: A representative lot detected GM130 in Immunohistochemistry applications (Seemann, J., et. al. (2002). Science. 295(5556):848-51).
Immunoprecipitation Analysis: A representative lot detected GM130 in Immunoprecipitation applications (Diao, A., et. al. (2003) J Cell Biol. 160(2):201-12; Diao, A., et. al. (2008) J Cell Biol. 283(11):6957-67).
Anti-GM130, clone 4A3, Cat. No. MABT1363, is a mouse monoclonal antibody that detects Golgin subfamily A member 2. (GM130) and is tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Immunohistochemistry in human small intestine tissue.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected GM130 in human small intestine tissue sections.
Target description
112.87 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 4A3, monoclonal species reactivity rat, human packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2b NCBI accession no. NP_072118.2, UniProt accession no. Q62839,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Goat/sheep IgG antibody, Mouse monoclonal
NACRES: NA.46
Кат. номер SAB4200804-25UL SAB4200804-100UL General descriptionGoat and sheep antibodies are widely used as primary antibodies against many antigens in various assay techniques in research and clinical practices. Polyclonal second antibodies to goat and sheep may suffer from a lack of unique specificity to goat or sheep IgGs, and may cross react with other IgGs from human, mouse, rat or rabbit origin. As a result, an extensive adsorbing stage has to be integrated in the manufacturing process of most polyclonal antibodies. The use of a monoclonal antibody specific to goat or sheep IgG which is devoid of any binding capacity to human and many other species, can therefore serve as an essential tool and a useful control in many tests and applications.
Monoclonal Anti-Goat/sheep IgG (mouse IgG1 isotype) is derived from the GT-34 hybridoma, produced by the fusion of mouse myeloma cells and splenocytes from a mouse immunized with purified goat immunoglobulins (IgGs). Immunoglobulin G (IgG) belongs to the immunoglobulin family and is a widely expressed serum antibody. An immunoglobulin has two heavy chain and two light chain connected by disulfide bond. It mainly helps in immune defense. It is a glycoprotein. IgG is a major class of immunoglobulin. Goat IgG has two subclasses- IgG1 and IgG2.
Specificity
Monoclonal Anti-Goat/sheep recognizes an epitope located on the heavy chain of goat IgG1 and IgG2. The antibody shows strong cross-reactivity with sheep IgG and weak cross-reactivity with bovine IgG. No cross-reactivity is observed with IgG derived from human, monkey, guinea pig, rat, horse, fish, donkey, dog, chicken, pig, mouse, rabbit or cat origin. The antibody is recommended to use in various immunological techniques, including ELISA, Immunoblotting, immunofluorescence and Immunohistochemistry.Immunogenpurified goat immunoglobulins (IgGs).
Biochem/physiol Actions
Immunoglobulin G (IgG) participates in hypersensitivity type II and type III.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.Other NotesThis product is for R&D use only, not for drug, household, or other uses.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone GT-34, monoclonal form buffered aqueous solution species reactivity sheep, goat packaging antibody small pack of 25 μL concentration ~1 mg/mL application(s) indirect ELISA: 0.25-0.5 μg/mL using 5μg/ml Goat IgG for coating. isotype IgG1 shipped in dry ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Golgi Zone Antibody, clone 371-4
Кат. номер MAB1271-I-25UG MAB1271-I-100UG General descriptionGolgi apparatus protein 1 (UniProt: Q92896; also known as CFR-1, Cysteine-rich fibroblast growth factor receptor, E-selectin ligand 1, ESL-1, Golgi sialoglycoprotein MG-160) is encoded by the GLG1 (also known as CFR1, ESL1, MG160) gene (Gene ID: 2734) in human. The Golgi apparatus plays a major role in transport, processing, and sorting of thousands of macromolecules in eukaryotic cells. It is readily recognizable because of its stacked membrane-coated cavities known as dictyosomes. The Golgi complex consists of a stack of flattened, membrane-bound sacs known as cisternae, with three functional regions: the cis face, medial region and trans face and each of these regions contain various enzymes to selectively modify the macromolecules that pass through this complex. The Golgi complex is localized in the vicinity of the nucleus and is usually very large in secretory cells, where it fills most of the cytoplasm. Clone 371-4 selectively recognizes the Golgi complex in human cells. It produces a diffuse staining pattern of the Golgi zone in normal and malignant cells.
Specificity
Clone 371-4 is a mouse monoclonal antibody that detects Golgi apparatus.ImmunogenSU-DHL-1 human large cell lymphoma cells.ApplicationAnti-Golgi Zone, clone 371-4, Cat. No. MAB1271-I, is a mouse monoclonal antibody that detects Golgi apparatus protein 1 and is tested for use in Immunocytochemistry.
Quality Control Testing
Evaluated by Immunocytochemistry in HeLa cells.
Immunocytochemistry Analysis: A 1:500 dilution of this antibody detected Golgi apparatus protein 1 in HeLa cells.
Tested Application
Immunocytochemistry Analysis: A 1:500 dilution of this antibody detected Golgi apparatus protein 1 in A431cells.
Immunocytochemistry Analysis: A representative lot detected Golgi Zone in Immunocytochemistry applications (Endo, Y., et al. (2007). Cancer Sci.;98(10):1633-7; Strehlow, A.N., et al. (2007). Hum Mol Genet.;16(4):391-409; Oiso, S., et al. (2009). J Neurochem.;109(1):158-67; Leite, C., et al. (2014). PLoS One.;9(10):e111059).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 371-4, monoclonal mol wt calculated mol wt 134.55 kDa purified by using protein G species reactivity human species reactivity (predicted by homology) monkey packaging antibody small pack of 100 µg application(s) immunocytochemistry: suitable isotype IgG1 epitope sequence Unknown conjugate unconjugated Protein ID accession no. NP_001139138, UniProt accession no. Q92896, shipped in 2-8°C Gene Information human ... GLG1(2734) Узнать цену -
Anti-GOLM1 Antibody, clone 6A2
eCl@ss: 32160702
Кат. номер MABC1117-25UG MABC1117-100UG General descriptionGolgi membrane protein 1 (UniProt: Q8NBJ4; also known as Golgi membrane protein GP73, Golgi phosphoprotein 2) is encoded by the GOLM1 (also known as C9orf155, GOLPH2, PSEC0242, UNQ686/PRO1326) gene (Gene ID: 51280) in human. GP73 is a single-pass type II membrane protein that cycles via the cell surface and endosomes upon lumenal pH disruption. It is constitutively expressed in cells of epithelial lineage. It is highly expressed in colon, prostate, trachea, and stomach. In normal liver it is expressed at low level, but the expression is significantly increased in response to viral (HBV, HCV) infections, but not in diseases of non-viral origin. Its levels are also shown to be elevated in hepatocellular carcinoma (HCC) and in invasive breast cancer. GP73 is reported to promote HCC invasion by activation of matrix metalloproteinase-13 (MMP-13). Two isoforms of GP73 have been described that are produced by alternative initiation. (Ref.: Zhanga, A., and Caob, B. (2012). J. Biomed. Res. 26(6); 467-473; Donizy, P., et al. (2016). Int. J. Mol. Sci. 17(10); 1619.
Specificity
Clone 6A2 specifically detects human Golgi membrane protein 1. It targets an epitope with in the lumenal domain.ImmunogenHis-tagged recombinant fragment corresponding to 360 amino acids from the lumenal region of human Golgi membrane protein 1.ApplicationAnti-GOLM1, clone 6A2, Cat. No. MABC1117, is a mouse monoclonal antibody that detects Golgi membrane protein 1 and has been tested for use in ELISA, Immunohistochemistry (Paraffin), Immunoprecipitation, and Wrstern Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected GOLM1 in human liver cancer tissue sections.
Enzyme Immunoassay Analysis: A representative lot detected GOLM1 in ELISA applications (Zhang, A., et. al. (2012). J Biomed Res. 26(6):467-73).
Immunohistochemistry (Paraffin) Analysis: A representative lot detected GOLM1 in Immunohistochemistry applications (Zhang, A., et. al. (2012). J Biomed Res. 26(6):467-73).
Immunoprecipitation Analysis: A representative lot immunoprecipitated GOLM1 in Immunoprecipitation applications (Zhang, A., et. al. (2012). J Biomed Res. 26(6):467-73).
Western Blotting Analysis: A representative lot detected GOLM1 in Western Blotting applications (Zhang, A., et. al. (2012). J Biomed Res. 26(6):467-73).
Research Category
Apoptosis & Cancer
Quality
Evaluated by Immunohistochemistry (Paraffin) in human prostate cancer tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected GOLM1 in human prostate cancer tissue sections.
Target description
45.33 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 6A2, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_808800.1, UniProt accession no. Q8NBJ4,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Green Fluorescent Protein Antibody, original GFP only, clone 264-449-2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MAB2510 MAB2510-25UG MAB2510-100UG General descriptionThe Green Fluorescent Protein (GFP) from the jellyfish Aequorea victoria is used as a fluorescent indicator for monitoring gene expression in a variety of cellular systems, including living organisms and fixed tissues. Unlike other bioluminescent reporters, GFP fluoresces in the absence of substrates, cofactors, or other intrinsic or extrinsic proteins. Purified GFP is a 27 kDa monomer consisting of 238 amino acids and emits green light (emission maximum at 509 nm) when excited with blue or UV light.
Specificity
Directed against a bacterially-expressed fusion protein. Also reacts with red-shifted GFP-variant. Does not react with enhanced GFP.Immunogenhighly-purified native GFP
Epitope: original GFP onlyApplicationImmunocytochemistry
Immunoblotting: 1:1000
Immunoprecipitation
Optimal working dilutions and protocols must be determined by the end user.
Anti-Green Fluorescent Protein Antibody, original GFP only, clone 264-449-2 is an antibody against Green Fluorescent Protein for use in IP, WB & IC.
Research Category
Epitope Tags & General Use
Research Sub Category
Epitope Tags
Quality
Tested
Physical form
Purified immunoglobulin. Liquid in 0.02M Phosphate buffer, 0.25M NaCl, pH 7.6 with 0.1% sodium azide.
Format: Purified
Storage and Stability
Store at 2-8°C for up to 12 months.
During shipment, small volumes of product will occasionally become entrapped in the seal of the product vial. For products with volumes of 200µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the containers cap.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 264-449-2, monoclonal species reactivity (predicted by homology) all packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 UniProt accession no. P42212, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Growth Associated Protein 43 Antibody, phosphoSer 41 AB5401-25UL
eCl@ss: 32160702 NACRES: NA.41 General descriptionGAP-43, a common marker of differentiating neurons, is expressed at elevated levels by developing or regenerating neurons during axon growth. While GAP-43 is an integral membrane protein associated with the cytoplasmic surface of axonal growth cones (and synapses), it is absent from dendritic growth cones. In adult brain, GAP-43 is found in high concentration in presynaptic areas where memory formation is thought to occur, such as frontal cortex, limbic system and hippocampus. Phosphorylation of GAP-43 by PKC (at Ser41 on human, mouse, rat, and bovine GAP-43 or Ser42 on chicken and Xenopus GAP-43) is specifically correlated with certain forms of synaptic plasticity.
Specificity
GAP-43 phosphoSer41. The labeling of the GAP-43 protein (~43kDa) in Western blots of rat brain is blocked by the phosphopeptide but not by the dephosphopeptide. In some tissues the antibody may recognize a lower molecular weight band. This band is also detected by a pan GAP-43 antibody.ImmunogenEpitope: phosphoSer 41
Synthetic peptide corresponding to amino acids surrounding the phosphoSer41 of rat GAP-43. This is the site phosphorylated by protein kinase C.ApplicationThis Anti-Growth Associated Protein 43 Antibody, phosphoSer 41 is validated for use in WB for the detection of Growth Associated Protein 43.
Western blot: 1:1,000 (43KDa band).
Optimal working dilutions must be determined by the end user.
Research Category
Neuroscience
Research Sub Category
Neuroregenerative Medicine
Signaling Neuroscience
Physical form
Affinity purified immunoglobulin. Liquid in 10 mM HEPES (pH 7.5), 150 mM NaCl with 100 mg/mL BSA and 50% glycerol.
Storage and Stability
Maintain at -20°C in undiluted for up to 6 months after date of receipt. Avoid repeated freeze/thaw cycles. Do not store in a self defrosting freezer.
Analysis Note
Control
Synthetic peptide corresponding to amino acids surrounding the phosphoSer41 of rat GAP-43.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat packaging antibody small pack of 25 µL Торговая марка Chemicon® application(s) western blot: suitable NCBI accession no. NM_002045.2, UniProt accession no. P17677, shipped in dry ice Gene Information human ... GAP43(2596) Узнать цену -
Anti-GSDMD (126-138) antibody produced in rabbit
NACRES: NA.41
Кат. номер G7422-200UL G7422-25UL General descriptionGasdermin D (GSDMD) is also known as DFNA5L or gasdermin domain-containing 1 (GSDMDC1), belongs to the gasdermin protein family of epithelial proliferation regulators. GSDMD is expressed in upper gastrointestinal epithelium differentiating cells.Immunogensynthetic peptide corresponding to amino acids 126-138 of human GSDMDApplicationAnti-GSDMD antibody produced in rabbit is suitable for western blot analysis at a working dilution of 1:500-1:2000.
Yale Center for High Throughput Cell Biology IF-tested antibodies. Each antibody is tested by immunofluorescence against HUVEC cells using the Yale HTCB IF protocol. To learn more about us and Yale Center for High Throughput Cell Biology partnership, visit sigma.com/htcb-if,.
Anti-GSDMD (126-138) antibody produced in rabbit has been used in:- immunoblotting
- CASP4/11 assay
- cytokine enzyme?linked immunosorbent assay
Biochem/physiol Actions
The absence of Gasdermin D (GSDMD), completely blocked LPS electroporation-triggered pyroptosis in studies performed on GSDMD siRNA knockdown or GSDMD knockout (both human HeLa cells and iBMDM mouse cells). It was also reported that caspase-4/11 specifically cleaves GSDMD after Asp275, results in gasdermin-N domain that bears intrinsic pyroptosis inducing activity. Furthermore, GSDMD-mediated pyroptosis participates in mature interleukin 1β (IL-1β) release without distressing its maturation.
GSDMD (gasdermin D) have been suggested to function in the regulation of epithelial apoptosis. GSDMD is expressed in differentiating cells. It may act as a tumor suppressor.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~55 kDa species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1:250-1:500 using human HEK-293T cells over-expressing human recombinant. GSDMDC1. conjugate unconjugated Featured Industry Research Pathology UniProt accession no. P57764, shipped in dry ice storage temp. 20°C Gene Information human ... GSDMD(79792)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GSK3B antibody produced in rabbit
MDL number: MFCD01633410 Human Protein Atlas Number: HPA028017 Human Protein Atlas characterization data
Кат. номер HPA028017-100UL HPA028017-25UL Immunogenglycogen synthase kinase 3 beta recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78016,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS conjugate unconjugated UniProt accession no. P49841, shipped in wet ice storage temp. 20°C Gene Information human ... GSK3B(2932)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-GTF2I antibody produced in rabbit
Human Protein Atlas Number: HPA026638 Human Protein Atlas characterization data
Кат. номер HPA026638-100UL HPA026638-25UL ImmunogenGeneral transcription factor II-I recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86905,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence FVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEVTQPRTNTPVKEDWNVRIT conjugate unconjugated UniProt accession no. P78347, shipped in wet ice storage temp. 20°C Gene Information human ... GTF2I(2969)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Guanylate Cyclase 2E Antibody, clone 8A5
eCl@ss: 32160702
Кат. номер MABN2436 MABN2436-25UG General descriptionGuanylyl cyclase GC-E (UniProt: P52785; also known as EC: 4.6.1.2, Guanylate cyclase 2E, GC-2E) is encoded by the Gucy2e (also known as Guc2e) gene (Gene ID: 14919) in murine species. GC-2E is a single-pass type I membrane protein that plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the re-synthesis of cGMP required for recovery of the dark state after phototransduction. Following photoexcitation, cGMP in photoreceptors is first hydrolyzed by a light-activated phosphodiesterase (PDE6) and then replenished by a retinal membrane guanylyl cyclase. It is synthesized with a 50 amino acid signal peptide that is cleaved to generate the mature enzyme. It consists of an extracellular domain (aa 51-469), a helical domain (aa 470-490) and a cytoplasmic domain (aa 491-1108).
Specificity
Clone 8A5 detects Guanylate cyclase-1 in Bovine, Human, and murine species. It targets an epitope within 48 amino acids from the C-terminal end.ImmunogenGST-tagged recombinant fragment corresponding to 48 amino acids from the C-terminal end of human Guanylate cyclase-1.
Epitope: C-terminusApplicationAnti-Guanylate Cyclase-2E, clone 8A5, Cat. No. MABN2436, is a highly specific mouse monoclonal antibody that targets retinal Guanylyl cyclase (RETGC-1; GC-2E) and has been used in Immunofluorescence and Western Blotting.
Research Category
Neuroscience
Immunofluorescence Analysis: A representative lot detected Guanylate Cyclase-1 in mouse retina tissues (Courtesy of Dr. Robert Molday, Ph.D., University of British Columbia, Canada).
Immunofluorescence Analysis: A representative lot detected Guanylate Cyclase-1 in Immunofluorescence applications (Molday, L.L., et. al. (2013). Hum Mol Genet. 22(19):3894-905).
Western Blotting Analysis: 10 ug/mL of a representative lot detected Guanylate Cyclase-1 in mouse retina tissue lysates (Courtesy of Dr. Robert Molday, Ph.D., University of British Columbia, Canada).
Western Blotting Analysis: A representative lot detected Guanylate Cyclase-1 in Western Blotting applications (Peshenko, I.V., et. al. (2011). Biochemistry. 50(44):9511-9; Molday, L.L., et. al. (2013). Hum Mol Genet. 22(19):3894-905)
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG1 .
Target description
~120 kDa observed; 120.06 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 8A5, monoclonal species reactivity human, mouse, bovine packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_032218, UniProt accession no. P52785, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Guanylyl Cyclase 1 antibody produced in rabbit
MDL number: MFCD03455075 NACRES: NA.41
Кат. номер G4280-.2ML G4280-25UL General descriptionThe enzyme consists of α and β subunits of ~80kDa and ~70kDa respectively. Both the units are required for catalytic activity. The N-terminal domains of the subunits are essential for the stimulation of the enzyme by NO. Dimerization is mediated by the central portion of GC. The C-terminus domain of both subunits forms the catalytic domain.Immunogensynthetic peptide corresponding to amino acid residues 673-690 of rat soluble Guanylyl cyclase α1, conjugated to KLH with glutaraldehyde. The corresponding human sequence differs by 2 amino acids.ApplicationAnti-Guanylyl Cyclase 1 antibody produced in rabbit is suitable for immunohistochemistry at a working dilution of 1:100 using trypsin-treated human, bovine and mouse heart tissue and immunoprecipitation at 5-10µg concentration using 60-120µg of a cytosolic fraction of rat brain. It is also suitable for western blot analysis using cytosolic fraction of rat brain at a working dilution of 1:10,000.
It was used as a primary antibody for immunohistochemical:- localization of 1 subunits of sGC (soluble guanylate cyclase) in the guinea pig gastrointestinal tract
- detection of expression of sGC in the vasculature of rat skeletal muscle
- localization of the functional subunit of NO receptors, sGC1 in guinea pig caecum
Biochem/physiol Actions
Guanylyl cyclase (GC) catalyzes the conversion of guanosine-5-triphosphate (GTP) to cyclic guanosine-3,5-monophosphate (cGMP) and pyrophosphate. This reaction requires Mg2+ or Mn2+.
Guanylyl cyclase (GC) catalyzes the conversion of guanosine-5-triphosphate (GTP) to cyclic guanosine-3,5-monophosphate (cGMP) and pyrophosphate. This reaction requires Mg2+ or Mn2+.†† The enzyme (GC) is a major physiological receptor for nitric oxide (NO), an important intra- and intercellular membrane-permeant signaling molecule. Gaseous NO binds to Fe2+ in the prosthetic heme group of the enzyme. NO binding is followed by disruption of the 1 subunit histidine105 bond to iron and activation of the enzyme. GC forms a complex with NO and cGMP and regulates smooth muscle relaxation, inflammation, platelet adhesion and aggregation, pulmonary physiology and neuronal function. It is an important target for NO-releasing and non-NO-releasing activator drugs in human cardiovascular therapy.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt ~80 kDa species reactivity bovine, mouse, human, rat packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:100 using trypsin-treated human, bovine and mouse heart tissue, immunoprecipitation (IP): 5-10 µg using 60-120 µg of a cytosolic fraction of rat brain, western blot: 1:10,000 using cytosolic fraction of rat brain conjugate unconjugated shipped in dry ice storage temp. 20°C Gene Information human ... GUCY1A3(2982)
mouse ... Gucy1a3(60596)
rat ... Gucy1a3(497757)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HAP1 Antibody, clone 1B6
eCl@ss: 32160702
Кат. номер MABN2456-25UL MABN2456-100UL General descriptionHuntingtin-associated protein 1 (UniProt: P54256; also known as HAP1) is encoded by the Hap1 gene (Gene ID: 29430) in rat. HAP1 is a huntingtin-associated protein that is enriched in the brain. It specifically associates with HTT/huntingtin and this binding is enhanced by an expanded polyglutamine repeats within HTT that affects HAP1 interaction properties. Both HTT and HAP1 are reported to be involved in intracellular trafficking and HAP1 is proposed to link HTT to motor proteins and/or transport cargos. HAP1 localizes to large nonmembrane-bound cytoplasmic bodies (stigmoid bodies) in various types of neurons. The formation of stigmoid bodies is regulated by the ratio of isoform A to isoform B of HAP1. HAP1 plays a role in vesicular transport within neurons that involves microtubule-associated transporters and is shown to be attenuated by association with mutant HTT. In rodents, two HAP1 isoforms (HAP1A and HAP1B) have been described that differ in their carboxy terminal. However, humans contain only the HAP1A isoform. In murine models, targeted disruption of the HAP1 gene results in significantly depressed feeding behavior and premature postnatal death. Pups with Hap1 -/- show decreased feeding, malnutrition, dehydration, and premature death. (Ref.: Tang, TS et al., (2003). Neuron 39 (2); 227-239; Chan, EY., et al. (2002). Hum. Mol. Gen. 11(8); 945-959).
Specificity
Clone 1B6 detects both HAP1A and HAP1B proteins in mouse and rat brain. It targets an epitope from the internal region.ImmunogenEpitope: cytoplasmic domain
GST-tagged recombinant fragment corresponding to 137 amino acids from the internal region of rat Huntingtin-associated protein 1 (HAP1).ApplicationImmunocytochemistry Analysis: A representative lot detected HAP1 in Immunocytochemistry applications (Fujinaga, R., et. al. (2011). Exp. Cell Res. 317(12):1689-700).
Immunoprecipitation Analysis: A representative lot immunoprecipitated HAP1 in Immunoprecipitation applications (Fujinaga, R., et. al. (2011). Exp. Cell Res. 317(12):1689-700).
Western Blotting Analysis: A representative lot detected HAP1 in Western Blotting applications (Chan, E.Y., et. al (2002). Hum Mol Genet. 11(8):945-59; Tang, T.S., et. al. (2003). Neuron. 39(2):227-39; Torre, E.R., et. al. (2003). J Neurosci Methods. 125(1-2):27-32).
Anti-HAP1, clone 1B6, Cat. No. MABN2456, is a highly specific mouse monoclonal antibody that targets Huntingtin-associated protein 1 and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in brain tissue lysate from P1 Balb/c mouse.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected HAP1 in brain tissue lysate from day one post-natal (P1) Balb/c mouse.
Target description
~90 kDa observed; 70.21 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1B6, monoclonal species reactivity mouse, rat packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_077047.1, UniProt accession no. P54256, Узнать цену -
Anti-Haptoglobin antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200781-100UL SAB4200781-25UL General descriptionHaptoglobin, also known as HP, is a serum 2-glycoprotein that exists as a tetramer, composed of two smaller identical alpha () chains and two larger identical beta () chains. The -chains are linked to each other by a disulfide bond and each -chain is similarly linked to an -chain.
Monoclonal Anti-Haptoglobin specifically recognizes the three types of human haptoglobin (types 1-1, 2-1, and 2-2) The antibody recognizes both purified and haptoglobin in human serum, and shows no crossreactivity with human IgG, transferrin, C-reactive protein, -1-acid glycoprotein, albumin, hemoglobin, or bovine, goat and sheep serum haptoglobin.Immunogenpurified haptoglobin from pooled human plasmaApplicationThe antibody is recommended to use in various immunological techniques, including ELISA, dot blot, immunoprecipitation, and immunoblot . The antibody reacts against native and denatured (non-reduced) human haptoglobin but does not recognize the haptoglobin under reducing conditions.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide as preservative.Other NotesThis product is for R&D use only, not for drug, household, or other uses.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone HG-36, monoclonal form buffered aqueous solution species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) ELISA: 0.2-0.4 µg/mL using 10 µg/ml human haptoglobin for coating","dot blot: suitable","immunoblotting: suitable","immunoprecipitation (IP): suitable isotype IgG1 UniProt accession no. P00738, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HCN4 Antibody, clone PG2-1A4
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABN1871 MABN1871-25UL General descriptionPotassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 (UniProt: O70507; also known as Brain cyclic nucleotide-gated channel 3, BCNG-3, HCN4) is encoded by the Hcn4 (also known as Bcng3) gene in murine species. HCN4 is a homo- or hetero-tetrameric multi-pass membrane protein that is detected in a subset of elongated cells in taste buds. It acts as a hyperpolarization-activated ion channel with very slow activation and inactivation. It exhibits weak selectivity for potassium over sodium ions. HCN4 is reported to contribute to the native pacemaker currents in heart that regulates the rhythm of heart beat. It may also contribute to the native pacemaker currents in neurons. HCN4 is activated by cAMP and cAMP binding causes a conformation change that leads to the assembly of an active tetramer and induces channel opening. This channel may mediate responses to sour stimuli.
Specificity
Clone PG2-1A4 detects murine Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 (HCN4). It targets an epitope within 70 amino acids from the C-terminal region.ImmunogenGST-tagged recombinant fragment corresponding to 70 amino acids from the C-terminal region of murine Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 (HCN4).ApplicationImmunofluorescence Analysis: A representative lot detected HCN4 in Immunofluorescence applications (Cichy, A., et. al. (2015). J Neurosci. 35(9):4025-39).
Immunohistochemistry Analysis: A 1:100-500 dilution from a representative lot detected HCN4 in Mouse (C57BL/6) retina tissues (Courtesy of Prof. Dr. Frank Muller, Institute of Complex Systems, Cellular Biophysics (ICS-4), Forschungszentrum Julich, Germany).
Electron Microscopy Analysis: A representative lot detected HCN4 in Electron Microscopy applications (Mataruga, A., et. al. (2007). J Comp Neurol. 502(6):1123-37).
Immunohistochemistry Analysis: A representative lot detected HCN4 in Immunohistochemistry applications (Cichy, A., et. al. (2015). J Neurosci. 35(9):4025-39; Mataruga, A., et. al. (2007). J Comp Neurol. 502(6):1123-37).
Western Blotting Analysis: A representative lot detected HCN4 in Western Blotting applications (Muller, F., et. al. (2003). Eur J Neruosci. 17(10):2084-96).
Anti-HCN4, clone PG2-1A4 Antibody, Cat. No. MABN1871, is a highly specific rat monoclonal antibody that targets murine HCN4 and has been tested for use in immunofluorescence, Immunohistochemistry, Electron Microscopy, and Western Blotting.
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG2a.
Target description
127.41 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone PG2-1A4, monoclonal species reactivity mouse packaging antibody small pack of 25 µL application(s) electron microscopy: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable isotype IgG2a UniProt accession no. O70507, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HD-polyAla Ct
eCl@ss: 32160702
Кат. номер ABN1672-25UL ABN1672-100UL General descriptionHuntington disease (HD) is a progressive neurodegenerative disorder is caused by a CAG,CTG expansion in the HTT gene that results in the production of a mutant huntingtin protein (HTT) with polymeric expansions that accumulate in human brain with HD. PolyAla is a sense repeat-associated non-ATG (RAN) translation protein that accumulates in various brain regions with some toxic effects leading to microglial activation and neuronal loss. HD-RAN polyAla toxicity is shown to be lower compared to that of polyGln. The transfection of cells with polyAla construct can express high polyAla levels, but have lower toxicity. HD-polyAla RAN proteins are reported to accumulate in cells expressing CAG repeats that are equal to or greater than 52 but not at repeats less than 45. HD-RAN proteins are abundant in regions of the brain that are most affected by HD and these regions display pathologic features of HD, such as caspase-3 activity and microglial activation. HD-Ran protein accumulation and aggregation in HD brains are shown to be length dependent.
Specificity
This rabbit polyclonal antibody specifically detects RAN proteins with PolyAla.ImmunogenA synthetic peptides from the C-terminal regions of the predicted 21 polyAla frame of HD in the CAG direction.ApplicationImmunohistochemistry Analysis: A representative lot detected HD-polyAla Ct in Immunohistochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Western Blotting Analysis: A representative lot detected HD-polyAla Ct in Western Blotting applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Immunocytochemistry Analysis: A representative lot detected HD-polyAla Ct in Immunocytochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected HD-polyAla Ct in pcDNA3.1 (Ctrl) & HEK293T-HD-polyAla-Ct.
Anti-HD-polyAla Ct, Cat. No. ABN1672, is a highly specific rabbit polyclonal antibody that targets HD-polyAla Ct and has been tested in Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in HEK293T cells transfected with HD-polyAla-Ct.
Western Blotting Analysis (WB): A 1:1,000 dilution of this antibody detected PolyAla in HEK293T cells transfected with HD-polyAla-Ct.
Target description
~15 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form serum antibody product type primary antibodies clone polyclonal species reactivity mouse, human packaging antibody small pack of 25 μL application(s) immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable isotype IgG
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HD-polyCys-Ct
eCl@ss: 32160702
Кат. номер ABN1671-25UL ABN1671-100UL General descriptionHuntington disease (HD) is a progressive neurodegenerative disorder is caused by a CAG,CTG expansion in the HTT gene that results in the production of a mutant huntingtin protein (HTT) with polymeric expansions that accumulate in human brain with HD. PolyCys is an antisense repeat-associated non-ATG (RAN) translation protein that accumulate in various brain regions with toxic effects leading to microglial activation and neuronal loss. HD-RAN polyCys toxicity is shown to be comparable to that of polyGln. HD-RAN proteins are abundant in regions of the brain that are most affected by HD and these regions display pathologic features of HD, such as caspase-3 activity and microglial activation. HD-Ran protein accumulation and aggregation in HD brains are shown to be length dependent.
Specificity
This rabbit polyclonal antibody specifically detects RAN proteins with PolyCys.ImmunogenA synthetic peptide corresponding to the C-terminus of the predicted polyCys frame of HD in the CTG direction (alpha-HD-Cys-Ct).ApplicationImmunocytochemistry Analysis: A representative lot detected HD-polyCys-Ct in Immunocytochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Western Blotting Analysis: A representative lot detected HD-polyCys-Ct in Western Blotting applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Western Blotting Analysis: A 1:750 dilution form a representative lot detected HD-polyCys-Ct in HEK293T cells transfected with HD-polyCys-Ct.
Immunohistochemistry Analysis: A representative lot detected HD-polyCys-Ct in Immunohistochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Research Category
Neuroscience
Anti-HD-polyCys-Ct, Cat. No. ABN1671, is a highly specific rabbit polyclonal antibody that targets HD-polyCys-Ct and has been tested for use in Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Quality
Evaluated by Western Blotting in HEK293Tcells transfected with HD-PolyCys-Ct.
Western Blotting Analysis (WB): A 1:1,000 dilution of this antibody detected in PolyCys in HEK293T cells transfected with HD-polyCys-Ct, but not in control cells.
Target description
~50 kda observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form serum antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 μL application(s) immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable isotype IgG Узнать цену -
Anti-HD-polyLeu-Ct
eCl@ss: 32160702
Кат. номер ABN1670-25UL ABN1670-100UL General descriptionHuntington disease (HD) is a progressive neurodegenerative disorder is caused by a CAG,CTG expansion in the HTT gene that results in the production of a mutant huntingtin protein (HTT) with polymeric expansions that accumulate in human brain with HD. PolyLeu is an antisense repeat-associated non-ATG (RAN) translation protein that accumulate in various brain regions with toxic effects leading to microglial activation and neuronal loss. HD-RAN polyLeu toxicity is shown to be comparable to that of polyGln. HD-RAN proteins are abundant in regions of the brain that are most affected by HD and these regions display pathologic features of HD, such as caspase-3 activity and microglial activation. HD-Ran protein accumulation and aggregation in HD brains are shown to be length dependent.
Specificity
This rabbit polyclonal antibody specifically detects RAN proteins with PolyLeu-HD.ImmunogenA synthetic peptide corresponding to the C-terminal region of the predicted polyLeu frames of HD in the CTG direction (HD-Leu-Ct).
Epitope: unknownApplicationAnti-HD-polyLeu-Ct, Cat. No. ABN1670, is a highly specific rabbit polyclonal antibody that targets HD-polyLeu-Ct and has been tested for use in Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Research Category
Neuroscience
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected HD-polyLeu-Ct in HEK293T cells transfected with HD-polyLeu-Ct.
Immunocytochemistry Analysis: A representative lot detected HD-polyLeu-Ct in Immunocytochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Western Blotting Analysis: A representative lot detected HD-polyLeu-Ct in Western Blotting applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Immunohistochemistry Analysis: A representative lot detected HD-polyLeu-Ct in Immunohistochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Quality
Evaluated by Western Blotting in HEK293T cells transfected with HD-polyLeu-Ct.
Western Blotting Analysis (WB): A 1:2,000 dilution of this antibody detected PolyLeu in HEK293T cells transfected with HD-polyLeu-Ct, but not in control cells.
Target description
~21 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form serum antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 μL application(s) immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable isotype IgG Узнать цену -
Anti-HD-polySer-Ct
eCl@ss: 32160702
Кат. номер ABN1673-25UL ABN1673-100UL General descriptionHuntington disease (HD) is a progressive neurodegenerative disorder is caused by a CAG,CTG expansion in the HTT gene that results in the production of a mutant huntingtin protein (HTT) with polymeric expansions that accumulate in human brain with HD. PolySer is a sense repeat-associated non-ATG (RAN) translation protein that accumulates in various brain regions with toxic effects leading to microglial activation and neuronal loss. HD-RAN polySer toxicity is shown to be comparable to that of polyGln. Aggregation of polySer RAN proteins is shown in cells expressing longer repeats greater than 52, which are typically associated with earlier disease onset and in more severe juvenile HD. HD-RAN proteins are abundant in regions of the brain that are most affected by HD and these regions display pathologic features of HD, such as caspase-3 activity and microglial activation. HD-Ran protein accumulation and aggregation in HD brains are shown to be length dependent.
Specificity
This rabbit polyclonal antibody specifically detects RAN proteins with PolySer.ImmunogenA synthetic peptides from the C-terminal regions of the predicted 21 polySer frames of HD in the CAG direction.
Epitope: unknownApplicationWestern Blotting Analysis: A 1:500 dilution from a representative lot detected HD-polySer-Ct in HEK293T cells transfected with HD-polySer-Ct.
Western Blotting Analysis: A representative lot detected HD-polySer-Ct in Western Blotting applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Immunocytochemistry Analysis: A representative lot detected HD-polySer-Ct in Immunocytochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Immunohistochemistry Analysis: A representative lot detected HD-polySer-Ct in Immunohistochemistry applications (Banez-Coronel, M., et. al. (2015). Neuron. 88(4):667-77).
Anti-HD-polySer-Ct, Cat. No. ABN1673, is a highly specific rabbit polyclonal antibody that targets HD-polySer-Ct and has been tested for use in Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in HEK293T cells transfected with HD-polySer-Ct.
Western Blotting Analysis (WB): A 1:1,000 dilution of this antibody detected PolySer in HEK293T cells transfected with HD-polySer-Ct.
Target description
~27 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form serum antibody product type primary antibodies clone polyclonal species reactivity mouse, human packaging antibody small pack of 25 μL application(s) immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable isotype IgG
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDAC1 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 6-720 6-720-25UG 6-720-100UG General descriptionMammalian HADC1 (also designated HD1), HDAC2 (also designated mammalian RPD3) and HDAC3, all are related to the yeast transcriptional regulator Rpd3p, are identified as histone deacetylases. The deacetylation of histones is associated with transcriptional silencing.
Specificity
Oher species cross-reactivity not tested.
Recognizes and is specific for HDAC1, Mr 65 kDa. May detects a non-specific protein at ~35 kDa.Immunogen6X-His-tagged fragment representing amino acids 53-482 of mouse histone deacetylase 1 (HDAC1).ApplicationImmunoprecipitation:
5 µg of a previous lot immunoprecipitated HDAC1 from 500 µg of 3T3/A31 RIPA lysate.
Immunocytochemistry:
This antibody has been reported to immunostain HDAC1 in 1% paraformaldehyde fixed, 0.1% Triton X-100 permeabilized 3T3 cells.
HDAC Activity:
This antibody has been reported to immunoprecipitate active HDAC.
Research Sub Category
Histones
Use Anti-HDAC1 Antibody (Rabbit Polyclonal Antibody) validated in EA, ICC, IP, WB to detect HDAC1 also known as histone deacetylase 1.
Research Category
Epigenetics & Nuclear Function
Quality
Routinely evaluated by western blot on RIPA lysates from 3T3/A31 cells.
Western Blot Analysis:
0.5-2 µg/mL of this lot detected HDAC1 in RIPA lysates from 3T3/A31 cells.
Target description
65 kDa
Physical form
Purified rabbit polyclonal IgG in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, containing 0.05% sodium azide. Frozen at -20ºC.
Format: Purified
Protein A chromatography
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations:
Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Analysis Note
Control
NIH/3T3 cell extract
Included Positive Antigen Control: Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol per 100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone polyclonal species reactivity human, mouse, rat packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) activity assay: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_004955, UniProt accession no. Q13547, shipped in ambient Узнать цену -
Anti-HDAC2 Antibody, clone 3F3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-814 5-814-25UG 5-814-100UG General descriptionHistone deacetylase 2 (HDAC2), or transcriptional regulator homolog RPD3 L1, is highly homologous to the yeast transcription factor RPD3 (reduced potassium dependency 3) gene. As in yeast, human HDA2 is likely to be involved in regulating chromatin structure during transcription. It has been implicated to associate with YY1, a mammalian zinc-finger transcription factor, which negatively regulates transcription by tethering RPD3 to DNA as a cofactor. This process is highly conserved from yeast to human.
Specificity
Recognizes HDAC2, MW ~60 kDa.
Predicted to cross-react with rat based on sequence homology.ImmunogenKLH-conjugated, synthetic peptide (CEKTDTKGTKSEQLSNP) corresponding to amino acids 473-488 of human HDAC2 (Accession # NP_001518) containing a N-terminal cysteineApplicationAnti-HDAC2 Antibody, clone 3F3 is a Mouse Monoclonal Antibody for detection of HDAC2 also known as YY1-associated factor 1, histone deacetylase 2 & has been validated in ICC, IP & WB.
Research Sub Category
Histones
Research Category
Epigenetics & Nuclear Function
Immunocytochemistry:
This antibody has been reported by an independent laboratory to show positive immunostaining for HDAC2 in NIH/3T3 and U2OS cells fixed with paraformaldehyde.
Immunoprecipitation and HDAC Assay:
3 µL of a previous lot was used to immunoprecipitate HDAC activity from HeLa nuclear extract, which was then measured using the HDAC Assay Kit (Fluorometric Detection) (Catalog # 17-356). An independent laboratory has also demonstrated positive immunoprecipitation /HDAC assay results using NIH/3T3 cells.
Quality
Evaluated by western blot on nuclear extracts from HeLa cells.
Western Blot Analysis:
0.5-2 µg/mL of this antibody detected HDAC2 in nuclear extracts from HeLa cells.
Target description
~60 kDaLinkageReplaces: 04-229
Physical form
Protein G Purified
Purified mouse monoclonal IgG in buffer containing 70% storage buffer (0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide) and 30% glycerol. Store at -20°C.
Format: Purified
Storage and Stability
Stable for 1 year at -20ºC from date of receipt.
Analysis Note
Control
Included Positive Antigen Control: Catalog # 12-309, HeLa nuclear extract. Add an equal volume of Laemmli reducing sample buffer to 10 µL of extract and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 3F3, monoclonal species reactivity rat, mouse, human, bovine, hamster packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001518, UniProt accession no. Q92769, shipped in dry ice Gene Information human ... HDAC2(3066) Узнать цену -
Anti-Hemocyanin (KLH) antibody produced in rabbit
MDL number: MFCD00162375
Кат. номер H0892-25UL H0892-1ML General descriptionHemocyanin is a large, multi-subunit respiratory protein present in arthropods and mollucs. They circulate extracellularly in hemolymph. Hemocyanins do not contain iron but bind oxygen at an active site containing copper atoms ligated by protein side chains.ApplicationAnti-Hemocyanin (KLH) antibody produced in rabbit has been used in:- immunocytochemistry{58
- }immunohistochemistry
- immunofluorescent staining
- immunoblotting
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunocytochemistry (1 paper),
Biochem/physiol Actions
Keyhole limpet hemocyanin has been used traditionally as a protein carrier for hapten-carrier conjugates in immunochemistry. Keyhole limpet hemocyanin (KLH) has been regarded as a superior carrier. Affinity isolated antibody to hemocyanin may be used as a control reagent for the preparation and immunization of hapten-carrier conjugates.
Physical form
Solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution species reactivity keyhole limpet packaging antibody small pack of 25 μL application(s) indirect ELISA: 1:20,000 conjugate unconjugated shipped in dry ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Heparanase-1
eCl@ss: 32160702
Кат. номер ABC1687-25UG ABC1687-100UG General descriptionHeparanase (UniProt: Q9Y251; also known as EC: 3.2.1.166, Endo-glucuronidase, Heparanase-1, Hpa1) is encoded by the HPSE (also known as HEP, HPA, HPA1, HPR1, HPSE1, HSE1) gene (Gene ID: 10855) in human. Heparanase is a heterodimeric, glycosylated, endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans and participates in extracellular matrix (ECM) degradation and remodeling. It is known to selectively cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. It is also shown to cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. Heparanase is highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver, and tumor tissues. Heparanase is synthesized with a signal peptide (aa 1-35) and a propeptide chain (110-157), which are cleaved off to produce the heterodimeric mature form of 8 kDa and 50 kDa subunits. This active 8/50 kDa heterodimer is resistant to degradation. Heparanase is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Heparanase activity is inhibited by EDTA and laminarian sulfate. Four isoforms of heparanase have been described that are produced by alternative splicing.
Specificity
This rabbit polyclonal antibody detects human Heparanase-1. It targets an epitope with in 13 amino acids from the C-terminal half of larger subunit (50 kDa).ImmunogenKLH-conjugated linear peptide corresponding to 13 amino acids from the C-terminal half of larger subunit (50 kDa)of human Heparanase-1.ApplicationAnti-Heparanase-1, Cat. No. ABC1687, is a rabbit polyclonal antibody that detects Heparanase-1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected Heparanase-1 in human spleen and human placenta tissue sections.
Western Blotting Analysis: 1 µg/mL from a representative lot detected Heparanase-1 in human spleen tissue lysate.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in NIH/3T3 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Heparanase-1 in NIH/3T3 cell lysate.
Target description
~59 kDa observed; 61.15 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human, mouse packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_001092010, UniProt accession no. Q9Y251, Узнать цену -
Anti-Herpes Simplex Virus Glycoprotein D Antibody, clone LP14
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1975 MABF1975-25UL General descriptionHerpes Simplex Virus envelope Glycoprotein D (UniProt: Q69091) is also known as gD. The envelope of herpes simplex virus (HSV) is complex and contains at least 10 virus-encoded glycoproteins, some of which mediate virus entry into the host cell. HSV virus enters the cell by first fusing its envelope with a membrane of the host cell. Five viral envelope glycoproteins are reported to be involved in this entry process. Binding of glycoprotein D of HSV to a cell surface receptor is required to trigger membrane fusion during entry into host cells. Glycoproteins C and B promote attachment by interacting with cell surface proteoglycans and then glycoprotein D binds to the herpes virus entry mediator (HVEM) receptor that initiates a process that ultimately leads to glycoprotein B-mediated membrane fusion. Glycoprotein D is synthesized with a signal peptide (aa 1-25) that is subsequently cleaved off. It is a homodimeric protein that contains two zinc-binding sites (aa 64 and 264). The ectodomain region of glycoprotein D contains three sites for the addition of N-linked oligosaccharides (N-CHO) and six cysteine residues arranged into three disulfide bonds. During virion morphogenesis, glycoprotein D probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. (Ref.: Whitbeck JC et al. (1997). J. Virol. 71(8); p. 6083 6093; Nicola, AV et al. (1998). J Virol. 72(5): 3595-3601; Giovine, PD et al. (2011). PLos Pathog. 7(9); e1002277).
Specificity
Clone LP14 detects glycoprotein D of Herpes Simplex virus.ImmunogenWhole Herpex Simplex Virus 2 (HSV-2).ApplicationAnti-Herpes Simplex Virus Glycoprotein D, clone LP14, Cat. No. MABF1975, is a mouse monoclonal antibody that detects Glycoprotein D of Herpes Simplex Virus and has been tested for use in Inhibition, Immunocytochemistry, and Western Blotting.
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected Herpes Simplex Virus Glycoprotein D in lysates from VERO cells transfected with HSV-1.
Western Blotting Analysis: A representative lot detected Herpes Simplex Virus Glycoprotein D in Western Blotting applications (Lau, S.Y., et. al. (2015). Viruses. 7(3):915-38; Zenner, H.L., et. al. (2011). J Virol. 85(16):8012-21; Pawliczek, T., et. al. (2009). J Virol. 83(21):11254-64).
Western Blotting Analysis: A representative lot detected Herpes Simplex Virus Glycoprotein D in Western Blotting applications (Ren, Y., et. al. (2012). J Gen Virol. 93(Pt 2):319-29).
Immunocytochemistry Analysis: A representative lot detected Herpes Simplex Virus Glycoprotein D in Immunocytochemistry applications (Lau, S.Y., et. al. (2015). Viruses. 7(3):915-38).
Inhibition Analysis: A representative lot inhibited the fusion of cells infected with HSV-1. (Minson, A.C., et. al. (1986). J Gen Virol. 67(6); 1001-1013.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in HEK293T cell lysate transfected with HSV gD.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected Herpes Simplex Virus Glycoprotein D in HEK293T cell lysate transfected with HSV gD.
Target description
~50 and 55 kDa observed; 43.35 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone LP14, monoclonal species reactivity virus species reactivity (predicted by homology) all packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","inhibition assay: suitable","western blot: suitable isotype IgG2a NCBI accession no. YP_009137141.1, UniProt accession no. Q69091, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Heterochromatin Protein-1 Antibody, clone 4C12.1
eCl@ss: 32160702
Кат. номер MABE666 MABE666-25UG General descriptionChromobox protein homolog 5 (UniProt: P45973; also known as Antigen p25, Heterochromatin protein 1 homolog alpha, HP1 alpha) is encoded by the CBX5 (also known as HP1A) gene (Gene ID: 23468) in human. Chromobox protein homolog 5 is a component of centromeric and pericentromeric heterochromatin that associates with chromosomes during mitosis. Chromobox protein homolog 5 associates specifically with chromatin during metaphase and anaphase. It recognizes and binds histone H3 tails methylated at Lys9 (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when Tyr41 of histone H3 is phosphorylated. It can interact with lamin-B receptor (LBR) and this interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. It is also involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.ImmunogenGST/His-tagged recombinant fraction corresponding to 68 amino acids from the internal region of human Heterochromatin protein 1 homolog alpha.ApplicationAnti-Heterochromatin Protein-1 , clone 4C12.1, Cat. No. MABE666, is a highly specific mouse monoclonal antibody that targets Heterochromatin Protein-1 alpha and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:50-250 dilution from a representative lot detected Heterochromatin Protein-1 in human tonsil, human pancreas, and human uterus tissues.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in NIH/3T3 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Heterochromatin Protein-1 in 10 µg of NIH/3T3 cell lysate.
Target description
~23 kDa observed; 22.22 kDa calculated. Uncharacterized bands may be observed in some lysate(s).LinkageReplaces: MAB3584
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 4C12.1, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_001120793, UniProt accession no. P45973, shipped in ambient Gene Information human ... CBX5(23468)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-HIF-1-alpha Antibody, hydroxyproline (Pro402)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 7-1585 7-1585-25UG 7-1585-100UG General descriptionCell growth and viability is compromised by oxygen deprivation (hypoxia). Hypoxia-inducible factors, including HIF-1α, HIF-1β (also designated Arnt 1), EPAS-1 (also designated HIF-2α) and HIF-3α, induce glycolysis, erythropoiesis and angiogenesis in order to restore oxygen homeostasis. Hypoxia-inducible factors are members of the Per-Arnt-Sim (PAS) domain transcription factor family. In response to hypoxia, HIF-1α is upregulated and forms a heterodimer with HIF-1β to form the HIF-1 complex. The HIF-1 complex recognizes and binds to the hypoxia responsive element (HRE) of hypoxia-inducible genes, thereby activating transcription. Hypoxia-inducible expression of some genes such as Glut-1, p53, p21 or Bcl-2, is HIF-1α dependent, whereas expression of others, such as p27, GADD 153 or HO-1, is HIF-1α independent. EPAS-1 and HIF-3α have also been shown to form heterodimeric complexes with Arnt 1 in response to hypoxia.
Specificity
This antibody recognizes HIF-1-alpha at the ODD region.ImmunogenEpitope: ODD region
KLH-conjugated linear peptide corresponding to the ODD region of human HIF-1-alpha.ApplicationResearch Sub Category
Transcription Factors
Use Anti-HIF-1-alpha Antibody, hydroxyproline (Pro402) (Rabbit Polyclonal Antibody) validated in WB to detect HIF-1-alpha also known as Hypoxia-inducible factor 1-alpha, HIF1-alpha.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blot in FeCl2 treated HIF-1-alpha recombinant proteins.
Western Blot Analysis: 1 µg/mL of this antibody detected HIF-1-alpha on 10 µg of FeCl2 treated HIF-1-alpha recombinant proteins.
Target description
~120 kDa observed using Gal4-tagged recombinant protein. 92 kDa calculated for native protein.LinkageReplaces: 04-1006
Physical form
Purified rabbit polyclonal in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Affinity purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
FeCl2 treated HIF-1-alpha recombinant proteinsOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) zebrafish (based on 100% sequence homology), rat (based on 100% sequence homology), bovine (based on 100% sequence homology), mouse (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable NCBI accession no. NP_001521, UniProt accession no. Q16665, shipped in ambient Gene Information human ... HIF1A(3091) Узнать цену -
Anti-Histone acetyltransferase KAT2A
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1418 ABE1418-25UG General descriptionHistone acetyltransferase KAT2A (UniProt: Q92830; also known as EC 2.3.1.48, General control of amino acid synthesis protein 5-like 2, Histone acetyltransferase GCN5, HsGCN5, Lysine acetyltransferase 2A, STAF97) is encoded by the KAT2A (also known as GCN5, GCN5L2, HGCN5) gene (Gene ID: 2648) in human. Histone acetyltransferases (HATs) are transcription co-activators recruited by transcriptional activators to target gene promoters, where they enhance the transcription activity by acetylating lysine residues within the N-terminal regions of histones. KAT2A has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. It is also shown to acetylate non-histone proteins, such as CEBPB. It is also responsible for the acetylation of histone H3 at the gamma-H2A.X harboring nucleosomes at the site of DNA damage, thus establishing a cross-talk between the two histone modifications. It is expressed in all tissues and high expression is observed in ovary. Two isoforms of KAT2A have been described that are produced by alternative splicing. It has three acetyl CoA-binding sites (aa 579-581; 586-592, and 617-620) and an N-acetyltransferase domain (aa 503-656) and a bromo domain (aa 745-815). Histone acetyltransferase KAT2A plays important roles in multiple stages of T cell functions, including development, clonal expansion, and differentiation. Loss of its activity is shown to impair T cell proliferation, IL-2 production, and Th1/Th17, but not Th2 and regulatory T cell differentiation. In case of HIV-1 infection, it is recruited by the viral protein Tat and regulates Tats transactivating activity and may help inducing chromatin remodeling of proviral genes. (Ref.: (Ref.: Gao, B et al. (2017). J. Immunol. 198(10); 3927-3938).
Specificity
This rabbit polyclonal antibody detects Histone acetyltransferase KAT2A in human cells. It targets an epitope within 15 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal half of human Histone acetyltransferase KAT2A.
Epitope: C-terminusApplicationAnti-Histone acetyltransferase KAT2A, Cat. No. ABE1418, is a highly specific rabbit polyclonal antibody that detects KAT2A (GCN5) and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Histone acetyltransferase KAT2A in human pancreas, cerebral cortex, and tonsil tissue sections.
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Histone acetyltransferase KAT2A in 10 µg of A431 cell lysate.
Target description
~94 kDa observed; 93.93 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), rat (based on 100% sequence homology), chicken (based on 100% sequence homology), bovine (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_066564.2, UniProt accession no. Q92830, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Histone Deacetylase 1 (HDAC1) antibody produced in rabbit
MDL number: MFCD01633420 NACRES: NA.41
Кат. номер H3284-100UL H3284-25UL H3284-.2ML General descriptionHistone acetylation is a dynamic process whose levels are determined by the net activities of HATs and the competing enzymes histone deacetylases (HDACs). Both activities are associated with the nuclear matrix. Six or seven different mammalian HDACs have been described. HDAC1, HDAC2 and HDAC3 are similar to yeast Rpd3 protein, while HDAC4, HDAC5 and HDAC6 are similar to yeast Hda1 protein. Histone deacetylases activities were often, but not always, associated with transcriptional repression and nucleosomal condensations. HDAC1, HDAC2 and several other HDACs are the catalytic subunits of different multiprotein regulatory complexes.
Acetylation is a histone modification in which epsilon amino group of conserve lysine residue is modified with enzymes known as histone acetyltransferases (HATs). HATs are present in two forms nuclear and cytoplasmic. Histone deacetylases are competating enzymes of HATs and are often associated with transcriptional repression and nucleosome condensation. Anti-Histone Deacetylase 1 (HDAC1) antibody can be used in chromatin immunoprecipitation. . This antibody can also be used in double immunofloresence labeling. Anti-Histone Deacetylase 1 (HDAC1) antibody specifically recognizes histone deacetylase 1and reacts specifically with HDAC1 of human, rat and mouse.
Histone deacetylase 1 (HDAC1) is located in the nucleus. It belongs to class I of histone deacetylases. HDAC1 is located on human chromosome 1p35.
Specificity
Anti-Histone Deacetylase 1 specifically recognizes histone deacetylase 1 by immunoblotting and immunoprecipitation (65 kDa). An additional band of lower molecular weight may be detected in some cell line extracts by immunoblotting. Staining of HDAC1 by immunoblotting is specifically inhibited with the immunizing peptide. The antibody is also useful for the detection of HDAC1 by immunohistochemistry. The epitope(s) recognized by the antibody is resistant to routine formalin-fixation and paraffin-embedding, unless there is a protease digestion. The antibody reacts with HDAC1 of human, rat and mouse origin.Immunogensynthetic peptide corresponding to amino acids 466-482 of human and mouse HDAC1.ApplicationAnti-Histone Deacetylase 1 (HDAC1) antibody has been used in immunohistochemical staining and chromatin immunoprecipitation (ChIP) analyses.
Anti-Histone Deacetylase 1 (HDAC1) antibody can be used in immunoblotting; immunoprecipitation and immunohistochemistry. It is also useful in chromatin immunoprecipitation.
Anti-Histone Deacetylase 1 is suitable for immunoblotting; immunoprecipitation and immunohistochemistry. (IHC)
Immunoblotting: a minimum working dilution of 1:20,000 is determined using a nuclear extract of HeLa human epithelioid carcinoma cell line.
Immunoblotting: a minimum working dilution of 1:2,000 is determined using a whole extract of PC-12 rat pheochromocytoma cell line.
Immunoprecipitation: a recommended working volume of 5-10 ml is determined using a whole lysate of NIH 3T3 cells.
Indirect immunoperoxidase staining: a minimum working dilution of 1:500 is determined using protease-digested, formalin-fixed, paraffin-embedded human lymph node sections.
Biochem/physiol Actions
Histone deacetylase 1 (HDAC1) prevents the infection of influenza A virus (IAV). The protein plays important roles in DNA repair, splicing, regulation of gene expression and cell division. Overexpression of this gene can be seen in cancers like breast, renal cell cancer, and classical Hodgkin′s lymphoma.
Physical form
Solution in 0.01 M phosphate bufffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 65 kDa species reactivity human, mouse packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:500 using human lymph node sections","immunoprecipitation (IP): 5-10 µL using whole lysate of NIH3T3 cells","microarray: suitable","western blot: 1:20,000 using nuclear extract from HeLa human epithelioid carcinoma cells conjugate unconjugated UniProt accession no. Q13547, shipped in dry ice storage temp. 20°C Gene Information human ... HDAC1(3065)
mouse ... Hdac1(433759)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone Deacetylase 2 (HDAC2) antibody, Mouse monoclonal
MDL number: MFCD02096544 NACRES: NA.41
Кат. номер H2663-200UL H2663-100UL H2663-25UL General descriptionAnti-Histone Deacetylase 2 (HDAC2) antibody, Mouse monoclonal (mouse IgG2b isotype) is derived from the HDAC2-62 hybridoma produced by the fusion of mouse myeloma cells (NS1) and splenocytes from BALB/c mice immunized with a synthetic peptide corresponding to the C-terminal region of human histone deacetylase 2 (amino acid residues with N-terminal added cysteine) conjugated to maleimide-activated KLH. Histone deacetylase 2 (HDAC2) is the catalytic subunits of different multiprotein regulatory complexes.
Specificity
Monoclonal Anti-Histone Deacetylase 2 (HDAC2) recognizes human, bovine, dog, rat, mouse, and chicken HDAC2 (approx. 55 kDa). The antibody epitope resides within amino acids 471-488 of human HDAC2.ApplicationAnti-Histone Deacetylase 2 (HDAC2) antibody, Mouse monoclonal has been used in:- co-immunoprecipitation
- chromatin immunoprecipitation (ChIP)
- western blot
- immunohistochemistry
- enzyme linked immunosorbent assays (ELISA)
Packaging
200 μL in glass insert
Biochem/physiol Actions
Histone Deacetylases including HDAC′s 1-10 facilitate transcriptional repression and nucleosome condensation. Abnormal recruitment of HDACs by various oncoproteins may occur in certain neoplastic diseases. Inhibition of HDAC2 activity by valproic acid induces proteasomal degradation of HDAC2.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone HDAC2-62, monoclonal form buffered aqueous solution mol wt antigen ~55 kDa species reactivity rat, canine, human, chicken, mouse, bovine packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable","immunoprecipitation (IP): suitable","indirect ELISA: suitable","microarray: suitable","western blot: 0.25-0.5 µg/mL using total cell extracts from NIH3T3 cells isotype IgG2b conjugate unconjugated UniProt accession no. Q92769, shipped in dry ice storage temp. 20°C Gene Information human ... HDAC2(3066)
mouse ... Hdac2(15182)
rat ... Hdac2(84577)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone Deacetylase 3 (HDAC3) antibody produced in rabbit
MDL number: MFCD02096545 NACRES: NA.41
Кат. номер H3034-25UL H3034-100UL H3034-.2ML General descriptionHistone deacetylase 3 (HDAC3) is an epigenetic modifier and is expressed in various tissues. It belongs to the class I subfamily of histone deacetylases. The HDAC3 gene is mapped on to human chromosome 5q31.3.
Specificity
Anti-Histone Deacetylase 3 specifically recognises histone deacetylase 3 by immunoblotting and immunoprecipitation (50 kDa). An additional band of lower molecular weight may be detected in some cell line extracts by immunoblotting. Staining of HDAC3 by immunoblotting is specifically inhibited with the immunizing peptide. The product is also useful for the detection of HDAC3 by immunohistochemistry. The epitope(s) recognized by the antibody is resistant to routine formalin-fixation and paraffin-embedding. The antibody reacts with HDAC3 of human, rat, and mouse origin.Immunogensynthetic peptide corresponding to amino acids 411-428 of human and chicken HDAC3.ApplicationAnti-Histone Deacetylase 3 (HDAC3) antibody produced in rabbit has been used in:- immunohistochemistry
- western blotting
- immunoprecipitation
Biochem/physiol Actions
Histone acetylation is a dynamic process whose levels are determined by the net activities of HATs and the competing enzymes histone deacetylases (HDACs). Both activities are associated with the nuclear matrix. Six or seven different mammalian HDACs have been described. HDAC1, HDAC2 and HDAC3 are similar to yeast Rpd3 protein, while HDAC4, HDAC5 and HDAC6 are similar to yeast Hda1 protein. Histone deacetylases activities were often, but not always, associated with transcriptional repression and nucleosomal condensations. HDAC1, HDAC2 and several other HDACs are the catalytic subunits of different multiprotein regulatory complexes.
Histone deacetylase 3 (HDAC3) acts as a transcriptional modulator of inflammatory genes. It deacetylates lysine residues of histones. HDAC3 associates with nuclear receptor co-repressor (NCoR) or silencing mediator of retinoic and thyroid receptors (SMRTs) and activates the complex. This protein participates in interleukin-1 expression and inflammatory responses.
Physical form
Solution in 0.01 M phosphate bufffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 50 kDa species reactivity human, rat, mouse packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:500 using human lymph node sections","immunoprecipitation (IP): 1:2,500 using whole lysate of NIH3T3 cells","microarray: suitable","western blot: 1:10,000 using nuclear extract from HeLa human epithelioid carcinoma cells","western blot: 1:2,000 using whole extract of PC-12 rat pheochromocytoma cell line conjugate unconjugated UniProt accession no. O15379, shipped in dry ice storage temp. 20°C Gene Information human ... HDAC3(8841)
mouse ... Hdac3(15183)
rat ... Hdac3(84578)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone H1 Antibody, clone 1G6
eCl@ss: 32160702
Кат. номер MABE1885-25UG MABE1885-100UG General descriptionHistone H1 (UniProt: P02255; also known as H1) is encoded by the His 1 gene (Gene ID: 318854) in Drosophila species. Histone H1 is a linker histone that is involved in the organization and maintenance of chromatin higher order structure and plays an active role in the control of DNA replication and cell proliferation. The linker histone H1 family members are a key component of chromatin and bind to the nucleosomal core particle around the DNA entry and exit sites. Histone H1 is essential for the condensation of nucleosome chains into higher-order structures. In metazoans, H1 histones are smaller in size with about 200 amino acids. They have a short N-terminal tail, a central globular domain, and a long basic C-terminal tail. The central globular domain is shown to be highly conserved among all H1 subtypes. Manipulating levels of H1 histone can lead to both up- and down-regulation of specific genes. Depletion of H1 results in a massively altered chromosome structure with loss of chromosome banding. In Drosophila, a 20% reduction in H1 content leads to cessation of growth beyond the larval stage. Histone H1 undergoes phosphorylation mainly in the tail region, especially the C-terminal tail, where several {(S/T)-P-X-(K/R)} motifs are located that are recognized by cyclin-dependent kinases (CDKs). Phosphorylation levels are reported to be lowest during the G1 phase of the cell cycle and increase during S phase and reach maximum levels in mitosis. (Ref.: Hergeth, SP., and Schneider, R (2015). EMBO Rep. 16(11); 1439-1453).
Specificity
Clone 1G6 is a mouse monoclonal antibody that detects Histone H1 in Drosophila species.ImmunogenGST-tagged recombinant fragment corresponding to 148 amino acids from the C-terminal half of Drosophila Histone H1.ApplicationAnti-Histone H1, clone 1G6 Antibody, Cat. No. MABE1885, is a highly specific mouse monoclonal antibody that targets Drosophila Histone H1 and has been tested for use in Chromatin Immunoprecipitation (ChIP), ChIP-seq, Immunoprecipitation, and Western Blotting.
ChIP-seq Analysis: A representative lot detected Histone H1 in ChIP-seq applications (Iwasaki, Y.W., et. al. (2016). Mol Cell. 63(3):408-19).
Immunoprecipitation Analysis: A representative lot immunoprecipitated Histone H1 in Immunoprecipitation applications (Iwasaki, Y.W., et. al. (2016). Mol Cell. 63(3):408-19).
Chromatin Immunoprecipitation Analysis (ChIP): A representative lot immunoprecipitated Histone H1 in Chromatin Immunoprecipitation applications (Iwasaki, Y.W., et. al. (2016). Mol Cell. 63(3):408-19).
Quality
Evaluated by Western Blotting in Drosophila S2 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Histone H1 in Drosophila S2 cell lysate.
Target description
~35 kDa observed; 26.36 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1G6, monoclonal species reactivity Drosophila packaging antibody small pack of 25 µg application(s) ChIP: suitable (ChIP-seq)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001027286, UniProt accession no. P02255, Узнать цену -
Anti-Histone H1o/H5 Antibody, clone 3H9
eCl@ss: 32160702
Кат. номер 5-629-I 5-629-I-25UL General descriptionHistone H1/H5 (UniProt: P02259) are linker histones that are involved in the organization and maintenance of chromatin higher order structure and they play an active role in the control of DNA replication and cell proliferation. Linker histones are essential for chromatin filament formation, and they play key roles in the regulation of gene expression. Histone H1o is a histone H5-like protein found in mammalian species. It is present in the linker region of chromatin and replaces H1 there. Up to one third of the H1 can be replaced in some tissues. Histone H5 performs the same function as H1, being necessary for the condensation of nucleosome chains into higher order structures, and replaces histone H1 in certain cells. Histone H5 is found in erythroid cells in avian species. Histone H5 consists of a central globular domain (GH5) that is essential for nucleosome binding and is flanked by basic N- and C-terminal tails. It is reported that binding of either histone H5 or GH5 to nucleosomes protects an additional 20 bp of linker DNA from micrococcal nuclease digestion. Globular domain of linker histone H5 (GH5) contains three distinct DNA-binding sites, through which GH5 contacts the DNA at the nucleosome dyad and the linker DNA strands entering and exiting the nucleosome. (Ref.: Segers, A et al (1991). J. Biol. Chem. 266(3); 1502-1508; Fan, L., and Roberts, VA (2006). Proc. Natl. Acad. Sci. USA. 113 (22); 8384 8389; Smith, BH and Jones, EW (1980). Nucleic Acids Res. 8(24); 6069-6079).
Specificity
Clone 3H9 detects Histone H1o/H5 in human and chicken species. it targets an epitope within 46 amino acids from the N-terminal region.ImmunogenNative histone H5 protein purified from chicken erythrocytes.ApplicationWestern Blotting Analysis: A representative lot detected Histone H1o/H5 in Western Blotting applications (Torres, C.M., et. al. (2016). Science. 353(6307)).
Chromatin Immunoprecipitation Analysis: A representative lot detected Histone H1o/H5 in Chromatin Immunoprecipitation applications (Torres, C.M., et. al. (2016). Science. 353(6307)).
Flow Cytometry Analysis: A representative lot detected Histone H1o/H5 in Flow Cytometry applications (Torres, C.M., et. al. (2016). Science. 353(6307)).
Immunocytochemistry Analysis: A representative lot detected Histone H1o/H5 in Immunocytochemistry applications (Torres, C.M., et. al. (2016). Science. 353(6307)).
Immunofluorescence Analysis: A representative lot detected Histone H1o/H5 in Immunofluorescence applications (Torres, C.M., et. al. (2016). Science. 353(6307)).
Anti-Histone H1o/H5, clone 3H9 , Cat. No. 05-629-I, is a highly specific mouse monoclonal antibody that targets Histone H5 and has been tested in Chromatin Immunoprecipitation (ChIP), Flow Cytometry, Immunocytochemistry, Immunofluorescence, and Western Blotting.
Quality
Evaluated by Western Blotting in HeLa cells acid extract.
Western Blotting Analysis: A 1:20,000 dilution of this antibody detected Histone H1o in 10 µg of HeLa cells acid extract.
Target description
~30 kDa observed; 20.73 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Mouse monoclonal antibody in ascites without preservatives.Other NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form ascites fluid antibody product type primary antibodies clone 3H9, monoclonal species reactivity chicken, human packaging antibody small pack of 25 µL application(s) ChIP: suitable (ChIP-chip)","flow cytometry: suitable","immunocytochemistry: suitable","immunofluorescence: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_001038138, UniProt accession no. P02259, Узнать цену -
Anti-Histone H2A.Z Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 7-594-25UL 7-594 7-594-100UL
Specificity
Broad species cross-reactivity is expected
C-terminus of histone H2A.ZImmunogenpeptide containing the sequence SLIGKKGQQ, corres-ponding to the C-terminus of human histone H2A.ZApplicationResearch Sub Category
Histones
Research Category
Epigenetics & Nuclear Function
Detect Histone H2A.Z also known as H2AZ histone with Anti-Histone H2A.Z Antibody (Rabbit Polyclonal Antibody), that has been demonstrated to work in WB.
Quality
routinely evaluated by immunoblot on acid extracted proteins from HeLa cells and recombinant Histone H2A.Z (Catalog #14-597), no cross-reactivity with Histone H2A
Target description
16kDa
Physical form
0.05% sodium azide before the addition of glycerol to 30%
Serum
Storage and Stability
2 years at -20°CLegal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) western blot: suitable isotype IgG UniProt accession no. P0C0S5, shipped in ambient Gene Information human ... H2AFZ(3015) Узнать цену -
Anti-Histone H3 antibody produced in rabbit
MDL number: MFCD01322157 NACRES: NA.41
Кат. номер H0164-200UL H0164-25UL General descriptionHistone proteins are known to stabilize and regulate the nuclear DNA. Core histones, H2A, H2B, H3 and H4 aid the packaging of eukaryotic nuclear DNA into repeating nucleosome units while the linker histone, H1, binds to DNA between the nucleosomes. A diverse and elaborate array of post-translational modifications, including acetylation, phosphorylation and methylation, ubiquitination and ADP ribosylation occur in histones, particularly on the N-terminal tail domains of histones, particularly of H3 and H4.These modifications dictate chromatin states and the gene expression.
Phosphorylation of H3, mainly on Ser10 and Ser28, is localized to a small fraction of highly acetylated H3 and occurs primarily in response to mitogenic and stress stimuli. Phosphorylation of Ser10 is considered a crucial event for the onset of mitosis. It is tightly correlated with chromosome condensation during both mitosis and meiosis. Histone methylation, like acetylation, is a complex, dynamic process involved in a number of processes, including transcriptional regulation, chromatin condensation, mitosis ad heterochromatin assembly. Conserved lysine residues in the N-terminal tail domains of histone H3, Lys4, Lys9, and Lys27 are the preferred sites of methylation. Histone lysine residues can be mono-, di-, and tri-methylated at different heterochromatic subdomains, adding further complexity to the regulation of chromatin structure.
Specificity
Anti-Histone H3 specifically recognizes histone H3.Immunogensynthetic peptide corresponding to amino acids 125-136 located at the C-terminus of human histone H3, conjugated to KLH. This sequence is identical in many species including rat, mouse, chicken, Xenopus, Drosophila, and plant histone H3.ApplicationAnti-Histone H3 antibody produced in rabbit has been used in immunoblotting and immunofluorescence microscopy.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 17 kDa species reactivity mouse, chicken, Xenopus, human, rat, Drosophila, plant packaging antibody small pack of 25 µL application(s) indirect immunofluorescence: 1:250-1:500 using mouse fibroblast NIH3T3 cells","western blot: 1:2,500-1:5,000 using whole cell extract of the rat pheochromocytoma PC12 cell line","western blot: 1:5,000-1:10,000 using whole cell extract of the A431 human epidermoid carcinoma cell line or a whole cell extract of the mouse fibroblast NIH3T3 cell line conjugate unconjugated UniProt accession no. P68431, shipped in dry ice storage temp. 20°C Gene Information human ... H3F3A(3020), H3F3B(3021), HIST1H3A(8350), HIST1H3B(8358), HIST1H3C(8352), HIST1H3D(8351), HIST1H3E(8353), HIST1H3F(8968), HIST1H3G(8355), HIST1H3H(8357), HIST1H3I(8354), HIST1H3J(8356), HIST2H3A(333932), HIST2H3C(126961), HIST3H3(8290)
mouse ... H3f3a(15078), H3f3b(15081), Hist1h3a(360198), Hist1h3b(319150), Hist1h3c(319148), Hist1h3d(319149), Hist1h3e(319151), Hist1h3f(260423), Hist1h3g(97908), Hist1h3h(319152), Hist1h3i(319153), Hist2h3b(319154), Hist2h3c1(15077), Hist2h3c2(97114)
rat ... H3f3b(117056)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone H3 K4M mutant
Кат. номер ABE2927-25UL ABE2927-100UL General descriptionHistone H3.3 (UniProt: P84243; also known as H3.3) is encoded by the H3F3A (also known as H3.3A, H3F3, PP781, H3F3B, H3.3B) gene (Gene ID: 3020; 3021) in human. Histone H3.3 is a highly conserved variant form of Histone H3, which replaces conventional H3 in a wide range of nucleosomes in active genes. Histone H3 has two main variants, H3.1 and H3.3, which show different genomic localization patterns in animals. The H3.1 and H3.3 complexes also possess distinct histone chaperones, CAF-1 and HIRA, which play important role in mediating DNA-synthesis-dependent and -independent nucleosome assembly. Histone H3.1 serves as the canonical histone, which is incorporated during DNA replication, whereas H3.3 acts as the replacement histone that can be incorporated outside of S-phase during chromatin-disrupting processes like transcription. Histone H 3.3 constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. It is associated with actively expressed genes in both animals and plants. It is predominantly enriched near transcription end sites (TES) of genes and positively associated with transcription. Histone H3 contains a main globular domain and a long N-terminal tail and is involved with the structure of the nucleosomes of the ′beads on a string′ structure. The N-terminal tail of histone H3 protrudes from the globular nucleosome core and can undergo several different types of epigenetic modifications that influence cellular processes. These modifications include the covalent attachment of methyl or acetyl groups to lysine and arginine amino acids and the phosphorylation of serine or threonine. Mutations in Histone H3.3 have been implicated in a high proportion of malignant pediatric brain cancers. K4M mutation is reported to inhibit H3K4 methylation and prevent enhancer activation in adipogenesis by destabilizing MLL4/MLL4 proteins, but does not affect MLL1, MLL2, SETA1, or SET1B. Expression of K4M in lineage-specific precursor cells is shown to deplete H3K4 methylation and impair adipose tissue and muscle development. (Ref.: Jang, Y., et al. (2019). Nucleic Acids Res. 47(2); 607-620; Tagami, H., et al. (2004). Cell, 116(1); 51-61).
Specificity
This rabbit polyclonal antibody detected K4M and K4I mutant forms of Histone H3.ImmunogenKLH-conjugated linear peptide corresponding to the first 9 amino acids (without first methionine) from the N-terminal region of Histone H3 with K4M mutation.ApplicationQuality Control Testing
Evaluated by Western Blotting in HEK293T cells transfected with K4M mutant.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Histone H3.3 in HEK293T cells transfected with K4M mutation.
Tested Applications
Immunofluorescence Analysis: A representative lot detected Histone H3.3 in HEK293T cells transfected with K4M mutant (Courtesy of Dave Allis Lab @ Rockefeller University).
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected Histone H3.3 in HEK293T cells transfected with K4M mutant (Courtesy of Dave Allis Lab @ Rockefeller University).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Histone H3 K4M mutant, Cat. No. ABE2927, is a rabbit polyclonal antibody that detects Histone H3 with K4M mutation and is tested for use in Immunofluorescence and Western Blotting.
Physical form
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form purified antibody antibody product type primary antibodies clone polyclonal mol wt calculated mol wt 15.33 kDa","observed mol wt ~18 kDa purified by affinity chromatography species reactivity human packaging antibody small pack of 100 µL application(s) immunofluorescence: suitable","western blot: suitable isotype IgG epitope sequence N-terminal conjugate unconjugated Protein ID accession no. NP_001365972, UniProt accession no. P84243, shipped in 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone H3.3 K27I
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE990 ABE990-25UL General descriptionHistone H3.3 (UniProt: P84243) is encoded by the H3F3A (also known as H3.3A, H3F3, PP781, H3F3B, H3.3B) gene (Gene ID: 3020) in human. It is a highly conserved variant form of Histone H3, which replaces conventional H3 in a wide range of nucleosomes in active genes. Histone H 3.3 constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. H3.3 is associated with actively expressed genes in both animals and plants. It is predominantly enriched near transcription end sites (TES) of genes and positively associated with transcription. Histone H3 contains a main globular domain and a long N-terminal tail and is involved with the structure of the nucleosomes of the beads on a string structure. The N-terminal tail of histone H3 protrudes from the globular nucleosome core and can undergo several different types of epigenetic modifications that influence cellular processes. These modifications include the covalent attachment of methyl or acetyl groups to lysine and arginine amino acids and the phosphorylation of serine or threonine. For example, acetylation on Lys10 (H3K9ac; initial methionine removed) impairs methylation at Arg9 (H3R8me2s) and acetylation on Lys19 (H3K18ac) and Lys24 (H3K24ac) favors methylation at Arg18 (H3R17me). Phosphorylation at Ser11 (H3S10ph) by Aurora kinase B is crucial for chromosome condensation and cell-cycle progression during mitosis and meiosis. Phosphorylation at Ser11 by RPS6KA4 and RPS6KA5 is important during interphase because it enables the transcription of genes following external stimulation, like mitogens, stress, growth factors or UV irradiation and result in the activation of genes, such as c-Fos and c-Jun. Mutations in Histone H3.3 have been implicated in a high proportion of malignant pediatric brain cancers. The mutant H3.3 histone disrupts epigenetic post-translational modifications near genes involved in cancer processes and in brain function. Histone H3K27 is reported to be methylated by the Polycomb Repressive Complex 2 (PRC2) for X-chromosome inactivation and gene silencing and H3K27M peptides are shown to be potent inhibitors of PRC2 activity. H3K27I peptide also displays inhibitory, although to a lesser extent, on PRC2. The possibility of K27I mutation in Histone H3 has been suggested in pediatric gliomas, which might be due to blockage of glial cell differentiation. (Ref.: Lewis, PW., and Allis, CD (2013). Cell Cycle. 12(20): 3241-3242).
Specificity
This rabbit polyclonal antibody detects K27I mutant form of histone H3.3 and does not react with the wild-type H3.3.ImmunogenKLH-conjugated linear peptide corresponding to 8 amino acids from the N-terminal region of human histone H3.3 with K27I mutation.
Epitope: N-terminusApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected Histone H3.3 K27I in HEK293 cells transfected with H3.3 K27I mutant, but not the wild-type. (Courtesy of Dr. Peter Lewis, Rockefeller University).
Anti-Histone H3.3 K27I, Cat. No. ABE990, is a highly specific rabbit polyclonal antibody that detects Histone H3.3 mutant K27I and has been tested for use in Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in wold-type HEK293 cells and HEK293 cells transfected with Histone H3.3 K27I.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Histone H3.3 K27I in HEK293 cells transfected with Histone H3.3 K27I.
Target description
~18 kDa observed; 15.33 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG NCBI accession no. NP_005315, UniProt accession no. P84243, shipped in ambient Gene Information human ... H3F3B(3021)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
