Small Pack Antibodies
- Сортировать:
- Вид таблицей
-
Anti-EBOV GP Antibody, clone 4G7
eCl@ss: 32160702
Кат. номер MABF2111-25UG MABF2111-100UG General descriptionEnvelope glycoprotein (UniProt: Q05320; also known as GP1,2; GP) is encoded by the GP gene (Gene ID: 911829) in Zaire Ebola virus. Ebola virus (EBOV) is a filovirus that is shown to cause severe viral hemorrhagic fever with high lethality. It has a single stranded, negative-sense RNA genome that encodes seven viral structural proteins including nucleoprotein, virion proteins, and glycoprotein. The glycoprotein is the most important protein involved in pathogenesis. It is a type I transmembrane surface protein shown to be responsible for receptor binding, viral entry, and cellular tropism. The GP gene is reported to undergo transcriptional editing to give rise to several glycosylated proteins, including the structural protein GP1,2, and the secreted non-structural glycoprotein (sGP). The GP is synthesized as a 676-amino acid polyprotein with a signal peptide (aa 1-32). This polyprotein is cleaved by the furin to yield two disulfide linked subunits known as GP1 (aa 33-501) and GP2 (aa 502-676), which together form the GP1,2 heterodimer. The GP1 acts as the receptor-binding subunit and GP2 as the membrane fusion subunit. The GP1 subunit is expressed on the cell surface with the C-terminus oriented toward the aqueous environment, while the N-terminus is bound to GP2 via disulfide bonds. The GP1 subunit contains the heavily glycosylated mucin-like domain (aa 305-485), which is responsible for its cytotoxic function. The glycoprotein contains two coiled coil regions (aa 554-595 and 615-634) that play a role in its oligomerization and fusion activity. Clone 4G7 recognizes glycoprotein lacking a large part of the mucin domain (GP1,2 Mucin333 458). When administered before virus challenge, it provides complete protection. (Ref.: Qiu, X., et al. (2011). Clin. Immunol. 141(2); 218-227).
Specificity
Clone 4G7 is a mouse monoclonal antibody that detects envelope glycoprotein of Zaire Ebola virus. It binds to the C-terminal region of GP1.ImmunogenGlycoprotein from Zaire Ebola virus, strain Mayinga, expressed in VSV G. Reverse genetics technique was used to create the recombinant virus VSV G/ZEBOV glycoprotein.ApplicationImmunocytochemistry Analysis: A representative lot detected EBOV GP in Immunocytochemistry applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
ELISA Analysis: Various dilutions of this antibody detected Envelope glycoprotein in Recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP TM).
ELISA Analysis: A representative lot detected EBOV GP in ELISA applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Immunoprecipitation Analysis: A representative lot detected EBOV GP in Immunoprecipitation applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Neutralizing Analysis: A representative lot provided complete protection when administered prior to virus challenge. (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Anti-EBOV GP, clone 4G7, Cat. No. MABF2111, is a mouse monoclonal antibody that detects Envelope glycoprotein in Ebola virus and has been tested for use in ELISA, Immunocytochemistry, Immunoprecipitation, and Neutralizing applications.
Research Category
Inflammation & Immunology
Quality
Evaluated by ELISA with recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP deltaTM).
ELISA Analysis: Various dilutions of this antibody detected EBOV GP in Recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP deltaTM).
Target description
74.46 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 4G7, monoclonal species reactivity Ebola virus, virus packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","neutralization: suitable isotype IgG2a NCBI accession no. NP_066246, UniProt accession no. Q05320, Узнать цену -
Anti-EBOV GP Antibody, clone 5D2
eCl@ss: 32160702
Кат. номер MABF2110-25UG MABF2110-100UG General descriptionEnvelope glycoprotein (UniProt: Q05320; also known as GP1,2; GP) is encoded by the GP gene (Gene ID: 911829) in Zaire Ebola virus. Ebola virus (EBOV) is a filovirus that is shown to cause severe viral hemorrhagic fever with high lethality. It has a single stranded, negative-sense RNA genome that encodes seven viral structural proteins including nucleoprotein, virion proteins, and glycoprotein. The glycoprotein is the most important protein involved in pathogenesis. It is a type I transmembrane surface protein shown to be responsible for receptor binding, viral entry, and cellular tropism. The GP gene is reported to undergo transcriptional editing to give rise to several glycosylated proteins, including the structural protein GP1,2, and the secreted non-structural glycoprotein (sGP). The GP is synthesized as a 676-amino acid polyprotein with a signal peptide (aa 1-32). This polyprotein is cleaved by the furin to yield two disulfide linked subunits known as GP1 (aa 33-501) and GP2 (aa 502-676), which together form the GP1,2 heterodimer. The GP1 acts as the receptor-binding subunit and GP2 as the membrane fusion subunit. The GP1 subunit is expressed on the cell surface with the C-terminus oriented toward the aqueous environment, while the N-terminus is bound to GP2 via disulfide bonds. The GP1 subunit contains the heavily glycosylated mucin-like domain (aa 305-485), which is responsible for its cytotoxic function. The glycoprotein contains two coiled coil regions (aa 554-595 and 615-634) that play a role in its oligomerization and fusion activity. When administered before virus challenge, clone 5D2 can provide complete protection from cytopathic effects. (Ref.: Qiu, X., et al. (2011). Clin. Immunol. 141(2); 218-227).
Specificity
Clone 5D2 is a mouse monoclonal antibody that detects envelope glycoprotein from Zaire Ebola virus.ImmunogenGlycoprotein from Zaire Ebola virus, strain Mayinga, expressed in VSVdeltaG. Reverse genetics technique was used to create the recombinant virus VSVdeltaG/ZEBOV glycoprotein.ApplicationELISA Analysis: A representative lot detected EBOV GP in ELISA applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Immunocytochemistry Analysis: A representative lot detected EBOV GP in Immunocytochemistry applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Immunoprecipitation Analysis: A representative lot detected EBOV GP in Immunoprecipitation applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Western Blotting Analysis: A representative lot detected EBOV GP in Western Blotting applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Neutralizing Analysis: A representative lot provided complete protection from cytopathic effects when administed prior to virus challenge. (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Anti-EBOV GP, clone 5D2, Cat. No. MABF2110, is a mouse monoclonal antibody that detects envelope glycoprotein in Ebola virus and has been tested for use in ELISA, Immunocytochemistry, Immunoprecipitation, Neutralization, and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by ELISA with recombinant Ebola Virus Glycoprotein minus the transmembrane region (EBOV rGPdeltaTM).
ELISA Analysis: Various dilutions of this antibody detected rRecombinant Ebola Virus Glycoprotein minus the transmembrane region (EBOV rGPdeltaTM).
Target description
74.46 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 5D2, monoclonal species reactivity virus, Ebola virus packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","neutralization: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_066246, UniProt accession no. Q05320, Узнать цену -
Anti-EBOV GP Antibody, clone 5E6
eCl@ss: 32160702
Кат. номер MABF1982-25UL MABF1982-100UL General descriptionEnvelope glycoprotein (UniProt: Q05320; also known as GP1,2; GP) is encoded by the GP gene (Gene ID: 911829) in Zaire Ebola virus. Ebola virus (EBOV) is a filovirus that is shown to cause severe viral hemorrhagic fever with high lethality. It has a single stranded, negative-sense RNA genome that encodes seven viral structural proteins including nucleoprotein, virion proteins, and glycoprotein. The glycoprotein is the most important protein involved in pathogenesis. It is a type I transmembrane surface protein shown to be responsible for receptor binding, viral entry, and cellular tropism. The GP gene is reported to undergo transcriptional editing to give rise to several glycosylated proteins, including the structural protein GP1,2, and the secreted non-structural glycoprotein (sGP). The GP is synthesized as a 676-amino acid polyprotein with a signal peptide (aa 1-32). This polyprotein is cleaved by the furin to yield two disulfide linked subunits known as GP1 (aa 33-501) and GP2 (aa 502-676), which together form the GP1,2 heterodimer. The GP1 acts as the receptor-binding subunit and GP2 as the membrane fusion subunit. The GP1 subunit is expressed on the cell surface with the C-terminus oriented toward the aqueous environment, while the N-terminus is bound to GP2 via disulfide bonds. The GP1 subunit contains the heavily glycosylated mucin-like domain (aa 305-485), which is responsible for its cytotoxic function. The glycoprotein contains two coiled coil regions (aa 554-595 and 615-634) that play a role in its oligomerization and fusion activity. When administered before virus challenge, clone 5E6 can provide complete protection from cytopathic effects. (Ref.: Qiu, X., et al. (2011). Clin. Immunol. 141(2); 218-227).
Specificity
Clone 5E6 is a mouse monoclonal antibody that detects envelope glycoprotein from Zaire ebola virus.ImmunogenGlycoprotein from Zaire Ebola virus, strain Mayinga, expressed in VSVdeltaG. Reverse genetics technique was used to create the recombinant virus VSVdeltaG/ZEBOV glycoprotein.ApplicationImmunoprecipitation Analysis: A representative lot detected EBOV GP in Immunoprecipitation applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Neutralizing Analysis: A representative lot provided complete protection from cytopathic effects when administed prior to virus challenge. (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
ELISA Analysis: A representative lot detected EBOV GP in ELISA applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Immunocytochemistry Analysis: A representative lot detected EBOV GP in Immunocytochemistry applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Western Blotting Analysis: A representative lot detected EBOV GP in Western Blotting applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Anti-EBOV GP, clone 5E6, Cat. No. MABF1982, is a mouse monoclonal antibody that detects envelope glycoprotein of Ebola virus and has been tested for use in ELISA, Immunocytochemistry, Neutraliziation, Immunoprecipitation, and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by ELISA with recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGPdeltaTM).
ELISA Analysis: Various dilutions of this antibody detected recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGPdeltaTM).
Target description
74.46 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5E6, monoclonal species reactivity virus, Ebola virus packaging antibody small pack of 25 µL application(s) ELISA: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","neutralization: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_066246, UniProt accession no. Q05320, Узнать цену -
Anti-EDC4 (C-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200113-25UL SAB4200113-200UL General descriptionEnhancer of mRNA decapping 4 (EDC4) contains an N-terminal WD40 repeat and a C-terminal domain, which interacts with decapping enzyme (Dcp2) and mediates EDC4 oligomerization and P-body localization.
The EDC4 gene is located on the human chromosome at 16q22.1.
Specificity
Anti-EDC4 (C-terminal) specifically recognizes human EDC4.ApplicationAnti-EDC4 (C-terminal) antibody produced in rabbit may be used in immunoblotting and immunoprecipitation.
Biochem/physiol Actions
Enhancer of mRNA decapping 4 (EDC4) associates with mRNA-decapping enzyme 2 (hDcp2) and stimulates hDcp2 activity in vitro as well as mediates the interaction between decapping enzymes (DCP1 and DCP2).
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. Storage in “frost-free” freezers is also not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~150 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoprecipitation (IP): 5-10 µg using lysates of HEK-293 cells over expressing human EDC4","western blot: 0.5-1 µg/mL using lysates of HEK-293 cells over expressing human EDC4 conjugate unconjugated UniProt accession no. Q6P2E9, shipped in dry ice storage temp. 20°C Gene Information human ... EDC4(23644)
mouse ... Edc4(234699)
rat ... Edc4(361399)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-EEA1 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 7-1820-25UL 7-1820 7-1820-100UL General descriptionEarly endosome antigen 1 (EEA1) is a 170 kDa coiled-coil protein belonging to a group of early endosomal Rab5 effector proteins. EEA1 has a putative role in the tethering/docking of endocytic vesicles prior to their fusion with early endosomes. This protein is characterized as containing a zinc finger-like domain and coiled-coil regions. The zinc finger-like domain, also known as the FYVE finger, is a motif rich in cystine, is a necessary component of EEA1’s ability for endosomal targeting, and is specifically known for its dual interaction with Rab5 GTPase and phosphotidylinositol 3-phosphate (Ptdlns-3-P).
Specificity
Equine and Canine (99% sequence homology). Rat (98% sequence homology). Bovine (97% sequence homology).
This antibody recognizes EEA1.ImmunogenGST-tagged recombinant protein corresponding to the C-terminus of human EEA1.
Epitope: C-terminusApplicationThis Anti-EEA1 Antibody is validated for use in WB, IC for the detection of EEA1.
Western Blot (SNAP ID) Analysis: 1:250 dilution from a previous lot detected EEA1 on 10 µg of C2C12 cell lysate.
Immunocytochemistry Analysis: 1:500 dilution from a previous lot detected EEA1 in HeLa, A431, and C2C12 cells.
Research Sub Category
General Post-translation Modification
Research Category
Signaling
Quality
Evaluated by Western Blot in BALB 3T3/A31 cell lysate.
Western Blot Analysis: A 1:1000 dilution of this antibody detected EEA1 on 10 µg of BALB 3T3/A31 cell lysate.
Target description
~ 170 kDa
Physical form
Purified rabbit polyclonal in buffer containing 0.1 M Tris-Glycine (pH 7.4, 150 mM NaCl) with 0.05% sodium azide.
Affinity purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
BALB 3T3/A31 cell lysateOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human, mouse packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","western blot: suitable NCBI accession no. NP_003557, UniProt accession no. Q15075, shipped in ambient Gene Information human ... EEA1(8411) Узнать цену -
Anti-EGFR Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 6-847 6-847-25UG 6-847-100UG 6-847100UG General descriptionThe epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.
Specificity
Recognizes the EGFR, Mr 180 kDa.
Reported to detect rat and hamster.ImmunogenOvalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.ApplicationImmunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.
Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.
Quality
Routinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.
Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.
Target description
180 kDaLinkageReplaces: 04-337; 04-338
Physical form
Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.
Analysis Note
Control
A431 cell lysate, human cervical carcinoma.
Included Positive Antigen Control:
Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыbiological source rabbit Quality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone polyclonal species reactivity hamster, rat, mouse, human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_005219, UniProt accession no. P00533, shipped in ambient Узнать цену -
Anti-EGFRvIII Antibody, clone DH8.3
eCl@ss: 32160702
Кат. номер MABS1915-25UG MABS1915 General descriptionEpidermal growth factor receptor (UniProt: P00533; also known as EC:2.7.10.1, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1) is encoded by the EGFR (also known as ERBB, ERBB1, HER1) gene (Gene ID: 1956) in human. EGFR is a single-pass type 1 membrane protein that is ubiquitously expressed. It is synthesized with a 24 amino acids signal peptide that is subsequently cleaved. It contains an extracellular domain (aa 25-645) a transmembrane domain (aa 646-668), and a cytoplasmic domain (aa 669-1210). Upon binding of EGF, the receptor is phosphorylated and recruits adapter proteins to turn on downstream signaling cascades. EGFR is commonly overexpressed and is mutated in many human malignancies and is often associated with aggressive phenotypes. The most common truncated EGFR is the variant III EGFR deletion mutant (EGFRvIII), containing an inframe deletion of exons 2 7 (801 bp) from the extracellular domain. EGFRvIII mutation is reported in about 5% of human lung squamous cell carcinoma (SCC). It has also been suggested that EGFRvIII potentially plays an essential role in the human NSCLC tumor initiation and maintenance. Drugs such as Gefitinib, erlotnib, and HKI-272 are shown to inhibit the growth of EGFRvIII transformed cells and tumor growth. (Ref.: Ji, H., et al. (2006). Proc. Natl. Acad. Sci. USA 103(20); 7817-7822).
Specificity
Clone DH8.3 detects EGFR variant vIII a truncated form of EGFR, present in human cancer cells.ImmunogenKLH-conjugated linear peptide corresponding to EGFRvIII (EGFR variant III) (LEEKKGNYVVTDHC) sequence.ApplicationResearch Category
Signaling
Anti-EGFRvIII, clone DH8.3, Cat. No. MABS1915, is a mouse monoclonal antibody that specifically detects epidermal growth factor receptor vIIIa and has been tested for use in ELISA, Flow Cytometry, Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Western Blotting Analysis: A representative lot detected EGFRvIII in Western Blotting applications (Lammering, G., et. al. (2004). Clin Cancer Res. 10(19):6732-43; Nishikawa, R., et. al. (2004). Brain Tumor Pathol. 21(2):53-6; Hills, D., et. al. (1995). Int J Cancer. 63(4):537-43).
Flow Cytometry Analysis: A representative lot detected EGFRvIII in Flow Cytometry applications (Johns, T.G., et. al. (2002). Int J Cancer. 98(3):398-408; Hills, D., et. al. (1995). Int J Cancer. 63(4):537-43).
Immunohistochemistry Analysis: A representative lot detected EGFRvIII in Immunohistochemistry applications (Jungbluth, A.A., et. al. (2003). Proc Natl Acad Sci USA. 100(2):639-44; Nishikawa, R., et. al. (2004). Brain Tumor Pathol. 21(2):53-6; Feng, H., et. al. (2014). J Clin Invest. 124(9):3741-56; Feng, H., et. al. (2012). Proc Natl Acad Sci USA. 109(8):3018-23.
Immunoprecipitation Analysis: A representative lot detected EGFRvIII in Immunoprecipitation applications (Lammering, G., et. al. (2004). Clin Cancer Res. 10(19):6732-43; Hills, D., et. al. (1995). Int J Cancer. 63(4):537-43).
ELISA Analysis: A representative lot detected EGFRvIII in ELISA applications (Johns, T.G., et. al. (2002). Int J Cancer. 98(3):398-408; Hills, D., et. al. (1995). Int J Cancer. 63(4):537-43).
Quality
Evaluated by Western Blotting in U87MG.EGFR cell lysates.
Western Blotting Analysis: 4 ug/mL of this antibody detected EGFRvIII in 10 µg of U87MG.EGFR cell lysates.
Target description
~140 kDa observed; 134.28 kDa calculalted. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone DH8.3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","flow cytometry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_005219, UniProt accession no. P00533,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-EGFRvIII mutation Antibody, clone L8A4
eCl@ss: 32160702
Кат. номер MABC1126-25UG MABC1126-100UG General descriptionEpidermal growth factor receptor (UniProt: P00533; also known as EC:2.7.10.1, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1) is encoded by the EGFR (also known as ERBB, ERBB1, HER1) gene (Gene ID: 1956) in human. EGFR is a single-pass type 1 membrane protein that is ubiquitously expressed. It is synthesized with a 24 amino acids signal peptide that is subsequently cleaved. It contains an extracellular domain (aa 25-645) a transmembrane domain (aa 646-668), and a cytoplasmic domain (aa 669-1210). Upon binding of EGF, the receptor is phosphorylated and recruits adapter proteins to turn on downstream signaling cascades. EGFR is commonly overexpressed and is mutated in many human malignancies and is often associated with aggressive phenotypes. The most common truncated EGFR is the variant III EGFR deletion mutant (EGFRvIII), containing an inframe deletion of exons 2 7 (801 bp) from the extracellular domain. EGFRvIII mutation is reported in about 5% of human lung squamous cell carcinoma (SCC). It has also been suggested that EGFRvIII potentially plays an essential role in the human NSCLC tumor initiation and maintenance. Drugs such as Gefitinib, erlotnib, and HKI-272 are shown to inhibit the growth of EGFRvIII transformed cells and tumor growth. This monoclonal antibody binds specifically to the epidermal growth factor receptor variant III (EGFRvIII), which is present on gliomas, but not normal tissues, and is internalized rapidly after receptor binding. (Ref.: Ji, H., et al. (2006). Proc. Natl. Acad. Sci. USA 103(20); 7817-7822; Hens, M., et al. (2010). Nucl. Med. Biol. 37(7); 741-750).
Specificity
Clone L8A4 specifically binds to EGFRvIII, a mutated form of EGFR.ImmunogenKLH-conjugated linear peptide corresponding to the predicted amino acid sequence of 14 amino acids at the fusion junction combined with cultured HC2 20 d2 cells.ApplicationAnti-EGFRvIII mutation, clone L8A4, Cat. No. MABC1126, is a mouse monoclonal antibody that detects Epidermal Growth Factor Receptor variant III and has been tested for use in ELISA, Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Research Category
Apoptosis & Cancer
Western Blotting Analysis: A representative lot detected EGFRvIII mutation in Western Blotting applications (Wikstrand, C.J., et. al. (1998). J Neuroviral. 4(2):148-58; Grandi, P., et. al. (2010). Cancer Gene Ther. 17(9):655-63; Wikstrand, C.J., et. al. (1995). Cancer Res. 55(14):3140-8).
Immunohistochemistry (Paraffin) Analysis: A representative lot detected EGFRvIII mutation in Immunohistochemistry applications (Mellinghoff, I.K., et. al. (2005). N Engl J Med. 353(19):2012-24; Sok, J.C., et. al. (2006). Clin Cancer Res. 12(17):5064-73).
Immunohistochemistry Analysis: A representative lot detected EGFRvIII mutation in Immunohistochemistry applications (Wikstrand, C.J., et. al. (1998). J Neuroviral. 4(2):148-58; Wikstrand, C.J., et. al. (1995). Cancer Res. 55(14):3140-8).
ELISA Analysis: A representative lot detected EGFRvIII mutation in ELISA applications (Wikstrand, C.J., et. al. (1998). J Neuroviral. 4(2):148-58; Wikstrand, C.J., et. al. (1995). Cancer Res. 55(14):3140-8).
Flow Cytometry Analysis: A representative lot detected EGFRvIII mutation in Flow Cytometry applications (Wikstrand, C.J., et. al. (1998). J Neuroviral. 4(2):148-58; Wikstrand, C.J., et. al. (1995). Cancer Res. 55(14):3140-8).
Immunocytochemistry Analysis: A representative lot detected EGFRvIII mutation in Immunocytochemistry applications (Wikstrand, C.J., et. al. (1998). J Neuroviral. 4(2):148-58; Batra, S.K., et. al. (1995). Cell Growth Differ. 6(10):1251-9).
Quality
Evaluated by Western Blotting in NR6 cells expressing human EGFRvIII (NR6M).
Western Blotting Analysis: 1 µg/mL of this antibody detected EGFRvIII mutation in NR6 cells expressing human EGFRvIII (NR6M).
Target description
~145 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone L8A4, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_005219, UniProt accession no. P00533,
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-eIF-4E
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE2695 ABE2695-25UG General descriptionEukaryotic translation initiation factor 4E (UniProt: P06730; also known as eIF-4E, eIF4E, eIF-4F 25 kDa subunit, mRNA cap-binding protein) is encoded by the EIF4E (also known as EIF4EL1, EIF4F) gene (Gene ID: 1977) in human. elF-4E is a cytoplasmic factor that recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. It is a component of the CYFIP1-EIF4E-FMR1 complex that binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex. Three isoforms of elf-4E have been described that are generated by alternative splicing. Elf-4E contains four 7-methylguanosine-containing mRNA cap binding regions and three EIF4EBP1/2/3 binding regions. Hypophosphorylated EIF4EBP1, EIF4EBP2, and EIF4EBP3 are shown to compete with EIF4G1/EIF4G3 to interact with elF-4E. Phosphorylation of ElF4EBP1 by insulin-stimulated MAP kinase (MAPK1 and MAPK3) cause dissociation of the complex and allows EIF4G1/EIF4G3 to bind and result in initiation of translation. Mutations in ElF4E gene have been linked to autism with impairments in social interaction and communication and developmental abnormalities.
Specificity
This rabbit polyclonal antibody detects Eukaryotic translation initiation factor 4E in Human, Mouse, and Rat cells. it targets an epitope with in 14 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids from the N-terminal region of human Eukaryotic translation initiation factor 4E.
Epitope: unknownApplicationResearch Category
Epigenetics & Nuclear Function
Western Blotting Analysis: 0.9 µg/mL from a representative lot detected eIF-4E in 10 µg of PC12 cell lysate.
Immunocytochemistry Analysis: A 1:100-500 dilution from a representative lot detected eIF-4E in HeLa, A431, HUVEC, and NIH/3T3 cell lines.
Anti-eIF-4E, Cat. No. ABE2695, is a highly specific rabbit polyclonal antibody that targets Eukaryotic translation initiation factor 4E and has been tested in Immunocytochemistry and Western Blotting.
Quality
Evaluated by Western Blotting in Jurkat cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected eIF-4E in 10 µg of Jurkat cell lysate.
Target description
~31 kDa observed; 25.10 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity mouse, human, rat species reactivity (predicted by homology) monkey (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_001124150, UniProt accession no. P06730, shipped in ambient Gene Information human ... EIF4E(1977)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Enterobacterio Phage MS2 Coat Protein
eCl@ss: 32160702
Кат. номер ABE76-I ABE76-I-25UG General descriptionThe bacteriophage MS2 is a small, male-specific RNA bacteriophage that infects E. coli and other members of the Enterobacteriaceae family. Its genome comprises a single sense (+) strand of RNA 3569 nucleotides in length, which encodes only four proteins: the coat protein, the A or maturation protein, which is required for infectivity, a subunit of the viral replicase, and a small lysis protein encoded in an overlapping reading frame. The capsid protein (UniProt: P03612; also known as CP, Coat protein) of bacteriophage MS2 is a translational repressor. It is reported to inhibit the synthesis of the viral replicase by binding a specific RNA structure that contains the replicase translation initiation region. Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry and consists of 89 capsid proteins dimers (178 capsid proteins). It is involved in viral genome encapsidation through the interaction between a capsid protein homodimer and the multiple packaging signals present in the RNA genome. Proline 78 is shown to be essential for viral infectivity. (Ref.: Hill, HR et al. (1997). J. Mol. Biol. 266(1); 1-7).
Specificity
This rabbit polyclonal antibody detects MS2 bacteriophage capsid protein. The immunogen used has an N- terminus His tag and mutations to avoid dimerization and capsid formation.ImmunogenHis-tagged recombinant Enterobacteriophage MS2 Coat Protein (aa 2-130).ApplicationAnti-EnterobacterioPhage MS2 Coat Protein, Cat. No. ABE76-I, is a highly specific rabbit polyclonal antibody that targets Escherichia phage MS2 (Bacteriophage MS2) Capsid Protein and has been tested in Immunoprecipitation and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Western Blotting Analysis: A 1:5,000 dilution from a representative lot detected recombinant EnterobacterioPhage MS2 Coat Protein and wildtype MS2 protein (Courtesy of Caroline Horizny from CNSE at SUNY Albany, Albany, NY).
Immunoprecipitation Analysis: A 1:10,000 dilution from a representative lot detected EnterobacterioPhage MS2 Coat Protein in K562 cells treated with Escherichia phage MS2 (Bacteriophage MS2).
Quality
Evaluated by Western Blotting in K562 treated with Escherichia phage MS2 (Bacteriophage MS2) and K562+MS2 recombinant protein treated with Escherichia phage MS2 (Bacteriophage MS2) Capsid Protein.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected EnterobacterioPhage MS2 Coat Protein in K562 ells treated with Escherichia phage MS2 (Bacteriophage MS2) and K562+MS2 recombinant protein treated with Escherichia phage MS2 (Bacteriophage MS2) Capsid Protein.
Target description
~14 kDa observed; 13.86 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity virus species reactivity (predicted by homology) all packaging antibody small pack of 25 µg application(s) immunoprecipitation (IP): suitable","western blot: suitable NCBI accession no. NP_040648.1, UniProt accession no. P03612, Узнать цену -
Anti-EphA2 Antibody, clone F2-27
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2026-25UG MABS2026-100UG General descriptionEphrin type-A receptor 2 (UniProt: P29317; also known as EC: 2.7.10.1, Epithelial cell kinase, Tyrosine-protein kinase receptor ECK) is encoded by the EPHA2 (also known as ECK) gene (Gene ID: 1969) in human. Ephrin type-A receptor 2 is a homodimeric single-pass type I membrane protein that is expressed in brain and glioma tissue and in glioma cell lines. It is also highly expressed in tissues that contain a high proportion of epithelial cells. Its levels are shown to be up-regulated by UV irradiation via a TP53-independent, MAPK-dependent mechanism. Ephrin type-A receptor 2 serves as a receptor tyrosine kinase that binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. It is involved in the regulation of migration, integrin-mediated adhesion, and in proliferation and differentiation of cells. Ephrin type-A receptor 2 is phosphorylated on tyrosine residues upon binding and activation by EFNA1. Phosphorylation on Tyr 588 and Tyr 594 is reported to be essential for binding VAV2 and VAV3 while phosphorylation on Tyr 735 and Tyr 930 are required for binding PI3-kinase p85 subunit. It is synthesized with a signal peptide (aa 1-23) that is cleaved off in the mature form. The mature form has an extracellular domain (aa 24-537), a short transmembrane domain (aa 538-558), and a cytoplasmic domain (aa 559-976). Two isoforms of Ephrin type-A receptor 2 have been described that are produced by alternative splicing. EphA2 is reported to be overexpressed in skin tumors murine models and its overexpression may represent a compensatory feedback mechanism during tumorigenesis. (Ref.: Guo, H., et al. (2006). Cancer Res. 66(14); 7050-7058).
Specificity
Clone F2-27 specifically detects Ephrin type -A receptor 2 in human.ImmunogenKP-2, KP-3, SUIT-2, and MIAPaCa-2 cells.ApplicationInhibition Analysis: A representative lot inhibited cancer cell invasion in a three-dimensional spheroid formation assay. (Tanaka, T., et. al. (2017). Transl Oncol. 10(4):476-484).
Immunoprecipitation Analysis: A representative lot detected EphA2 in Immunoprecipitation applications (Tanaka, T., et. al. (2017). Transl Oncol. 10(4):476-484).
Flow Cytometry Analysis: A representative lot detected EphA2 in Flow Cytometry applications (Tanaka, T., et. al. (2017). Transl Oncol. 10(4):476-484).
Research Category
Signaling
Anti-EphA2, clone F2-27, Cat. No. MABS2026, is a mouse monoclonal antibody that detects Ephrin type-A receptor 2 and has been tested for use in Flow Cytometry, Immunoprecipitation, and Inhibition Assay.
Quality
Evaluated by Flow Cytometry in PC-3 cells.
Flow Cytometry Analysis: 1 µg of this antibody detected EphA2 in one million PC-3 cells.
Target description
108.27 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone F2-27, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunoprecipitation (IP): suitable","inhibition assay: suitable isotype IgG1 NCBI accession no. NP_004422, UniProt accession no. P29317, Узнать цену -
Anti-Epidermal Growth Factor (EGF) Receptor antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200802-25UL SAB4200802-100UL General descriptionEpidermal growth factor receptor (EGFR), also known as Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1 or HER-1, is an integral cell membrane protein which spans the membranes of a wide range of normal and malignant epithelial cells. EGFR is a tyrosine-specific protein kinase domain, it has an extracellular region which binds EGF and an intra-cellular carboxy-terminal region which possesses the tyrosine kinase activity.
Monoclonal Anti-Epidermal Growth Factor (EGF) Receptor (mouse IgG1 isotype) is derived from the F4 hybridoma, produced by the fusion of mouse myeloma cells and splenocytes from a mouse.Immunogenpeptide corresponding to the C-terminal region of human EGF receptor (EGFR) (GeneID 1956), coupled to KLHApplicationAnti-Epidermal Growth Factor (EGF) Receptor antibody, Mouse monoclonal has been used in:- immunoblotting
- immunoprecipitation
- immunohistochemistry
- immunofluorescence
Monoclonal Anti-Epidermal Growth Factor (EGF) Receptor recognizes intracellular domain of the EGF receptor. The antibody is recommended to use in various immunological techniques, including Immunobloting (∼170 kDa), Immunoprecipitation, Immunohistochemistry and Immunofluorescence.
Biochem/physiol Actions
Epidermal growth factor (EGF) binding to its specific EGFR, results in an increased DNA synthesis initiating a signaling cascades including cell proliferation, differentiation and repair of damaged epithelial tissue. The EGFR has a half-life of approximately ~10 hours in human fibroblasts, but in the presence of EGF this value is reduced to about 1hour. A close similarity has been found between the sequence of the v-erb-B oncogene and the cytoplasmic transmembrane domain of the EGFR (truncated EGFR). Overexpression or mutation of EGFR may enhance DNA repair mechanisms, thereby contributing to radio- and chemotherapy resistance. High levels of EGFR have been identified in sarcomas, gliomas, gynecological, breast, bladder and lung tumors.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.Other NotesThis product is for R&D use only, not for drug, household, or other uses.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone F4, monoclonal form buffered aqueous solution mol wt antigen ~170 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoblotting: 0.3-0.6 µg/mL using human epidermoid carcinoma A431 cell line extract","immunofluorescence: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable isotype IgG1 UniProt accession no. P00533, shipped in dry ice storage temp. 20°C Gene Information human ... EGFR(1956)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Epidermal Growth Factor (EGF) Receptor, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200809-25UL SAB4200809-100UL General descriptionEpidermal growth factor receptor (EGFR), also known as Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1 or HER-1, is an integral cell membrane protein which spans the membranes of a wide range of normal and malignant epithelial cells. EGFR is a tyrosine-specific protein kinase domain, it has an extracellular region which binds EGF and an intra-cellular carboxy-terminal region which possesses the tyrosine kinase activity. EGF binding to its specific EGFR, results in an increased DNA synthesis initiating a signaling cascades including cell proliferation, differentiation and repair of damaged epithelial tissue.ImmunogenParaformaldehyde-fixed carcinoma cell line A431ApplicationMonoclonal Anti-Epidermal Growth Factor (EGF) Receptor specifically bind to a carbohydrate residue on the external region of the EGF receptor molecule with no interference to the binding of EGF to its receptor, nor does it influence the binding of other monoclonal antibodies to the EGF Receptor. Reactivity has been observed with EGF receptors from mouse, human and bovine origin. The antibody is recommended to use in various immunological techniques, including Immunobloting (~170 kDa), Immunoprecipitation, flow cytometry (FACS), Immunohistochemistry and Immunofluorescence.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.Other NotesThis product is for R&D use only, not for drug, household, or other uses.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone 29.1, monoclonal form buffered aqueous solution mol wt ~170 kDa species reactivity bovine, mouse, human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 0.5-1 µg/mL using human epidermoid carcinoma A431 cell line extract.","immunofluorescence: 2-4 µg/mL using human epidermoid carcinoma A431 cells. isotype IgG1 UniProt accession no. P00533, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Epithelium Endothelial Cells Antibody, clone PHM-5
eCl@ss: 32160702
Кат. номер MAB430-I-25UG MAB430-I-100UG General descriptionThe glomeruli network of capillaries filters the blood and the filtrate then enters the renal tubule. Unlike most capillary beds, the glomerular capillaries exit into efferent arterioles rather than venules. The resistance that exists in efferent arterioles causes sufficient hydrostatic pressure within the glomerulus to provide the force for ultrafiltration. Glomerular endothelial cells that create an interface between blood and tissue compartments are responsible for regulating vasomotor tone, trafficking of leukocytes, and maintenance of maintain hemostasis. Unlike endothelium in other tissues, the normal glomerular endothelium is extremely attenuated, being only about 50 to 150 nm in height around the perimeter of the capillary loops. Glomeruli of human kidneys are shown to be rich sialoglycoprotein, which is chemically distinct from rat podocalyxin. (Ref.: Ballermann, BJ (2005). Kidney Int. 67(5); 1668-1671; Kerjaschki, D., et al. (1986). J. Clin. Invest. 78(5); 1142-1149).
Specificity
Clone PHM-5 is a mouse monoclonal antibody that detects human epithelium/endothelial cells.ImmunogenHuman Glomerular cells.ApplicationResearch Category
Cell Structure
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected Epithelium Endothelial Cells in human cerebral cortex tissue sections.
Anti-Epithelium Endothelial Cells, clone PHM-5, Cat. No. MAB430-I, is a mouse monoclonal antibody that detects human human epithelium/endothelial cells and has been tested for use in Immunohistochemistry (Paraffin).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human kidney tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected Epithelium Endothelial Cells in human kidney tissue sections.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 18.29 (PHM-5), monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin) isotype IgG1 NCBI accession no. NP_001018121, Узнать цену -
Anti-EPO-R Antibody, clone BCO-3H2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS1286 MABS1286-25UG General descriptionErythropoietin receptor (UniProt: P19235; also known as EPO-R) is encoded by the EPOR gene (Gene ID: 2057) in human. EPO-R is a single-pass type 1 membrane protein that mediates erythropoietin-induced erythroblast proliferation and differentiation. It is synthesized with a signal peptide (aa 1-24) that is cleaved to produce the mature form. Upon EPO stimulation, EPO-R homodimerizes and gets phosphorylated on C-terminal tyrosine residues by JAK2. The phosphotyrosine motifs are also recruitment sites for several SH2-containing proteins and adapter proteins which mediate cell proliferation. The tyrosine-phosphorylated form interacts with several SH2 domain-containing proteins. The EPO-R is expressed in erythroid cells and erythroid progenitor cells. Three isoforms of EPO-R has been described that are produced by alternate splicing. Isoform EPOR-F is the most abundant form in EPO-dependent erythroleukemia cells and in late-stage erythroid progenitors. Isoform EPOR-S and isoform EPOR-T are the predominant forms in bone marrow. Isoform EPOR-T is the most abundant from in early-stage erythroid progenitor cells. Mutation in EPOR gene are linked to familial erythrocytosis that is characterized by elevated serum red blood cell mass, hemoglobin and hematocrit, and increased sensitivity of erythroid progenitors to erythropoietin.
Specificity
Clone BCO-3H2 is a rat monoclonal antibody that detects erythopoietin receptor in human cells. It targets an epitope with in 17 amino acids from the C-terminal region.ImmunogenEpitope: cytoplasmic domain
KLH-conjugated linear peptide corresponding to 17 amino acids from the human erythropoietin receptor.ApplicationImmunohistochemistry Analysis: A representative lot detected EPO-R in Immunohistochemistry applications (Maxwell, P., et. al. (2015). Br J Haematol. 168(3):429-42).
Immunoprecipitation Analysis: A representative lot detected EPO-R in Immunoprecipitation applications (Maxwell, P., et. al. (2015). Br J Haematol. 168(3):429-42).
Immunofluorescence Analysis: A representative lot detected EPO-R in Immunofluorescence applications (Maxwell, P., et. al. (2015). Br J Haematol. 168(3):429-42).
Western Blotting Analysis: A representative lot detected EPO-R in Western Blotting applications (Maxwell, P., et. al. (2015). Br J Haematol. 168(3):429-42).
Research Category
Signaling
Anti-EPO-R, clone BCO-3H2, Cat. No. MABS1286, is a rat monoclonal antibody that detects erythropoietin receptor and has been tested for use in Immunofluorescence, Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in UT-7 cell lysates.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected EPO-R in 10 µg of UT-7 cell lysates.
Target description
~58 kDa observed; 55.07 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2b in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone BCO-3H2, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2b NCBI accession no. NP_000112, UniProt accession no. P19235, shipped in ambient
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-EPO-R Antibody, clone VP-2E8
eCl@ss: 32160702
Кат. номер MABS1287 MABS1287-25UG General descriptionErythropoietin receptor (UniProt: P19235, also known as EPO-R) is encoded by the EPOR gene (Gene ID: 2057) in human. EPO-R is a single-pass type I membrane protein that serves as a receptor for erythropoietin. It mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPO-R dimerizes triggering the JAK2/STAT5 signaling cascade. EPO-R has an extracellular domain (aa 25-250), a transmembrane domain (aa 251-273), and a cytoplasmic domain (aa 274-508). It is synthesized with a signal peptide (aa 1-24) that is cleaved to generate mature EPO-R. Upon stimulation following Erythropoietin (EPO) binding, EPO-R is phosphorylated on C-terminal tyrosine residues by JAK2. The phosphotyrosine motifs are also recruitment sites for several SH2-containing proteins and adapter proteins, which mediate cell proliferation. Phosphorylation on Tyrosine 454 is shown to be essential for PTPN6 interaction, and on Tyrosine 426 for PTPN11 interaction. Tyrosine 426 is also required for SOCS3 binding, however, Tyr-454/Tyr-456 motif is reported to be the preferred binding site. Ubiquitination of EPO-R at Lysine 81 is required for receptor internalization, whereas ubiquitination at Lysine 453 promotes trafficking of activated receptors to the lysosomes for degradation. Defects in EPOR gene are linked to familial erythrocytosis which is characterized by increased serum red blood cell mass, elevated hemoglobin and hematocrit, and hypersensitivity of erythroid progenitors to erythropoietin.
Specificity
Clone VP-2E8 recognizes EPO-R in human cells. It targets an epitope within the extracellular domain.ImmunogenA recombinant fragment corresponding to the extracellular domain of human EPO-R.
Epitope: extracellular domainApplicationResearch Category
Signaling
Flow Cytometry Analysis: 2 µg/mL from a representative lot detected EPO-R in UT-7 (EPO dependent) cells.
Immunoprecipitation Analysis: A representative lot detected EPO-R in Immunoprecipitation applications (Maxwell, P., et. al. (2015). Br J Haematol. 168(3):429-42).
Immunofluorescence Analysis: A representative lot detected EPO-R in Immunofluorescence applications (Maxwell, P., et. al. (2015). Br J Haematol. 168(3):429-42).
Flow Cytometry Analysis: A representative lot detected EPO-R in Flow Cytometry applications (Maxwell, P., et. al. (2015). Br J Haematol. 168(3):429-42).
Anti-EPO-R, clone VP-2E8, Cat. No. MABS1287, is a mouse monoclonal antibody that detects erythropoietin receptor and is tested for use in Flow Cytometry, Immunocytochemistry, Immunofluorescence, and Immunoprecipitation.
Quality
Evaluated by Immunocytochemistry in starved UT-7 cells.
Immunocytochemistry Analysis: 1:500 dilution of this antibody detected EPO-R in starved UT-7 cells.
Target description
55.06 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG1 in PBS without preservatives.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone VP-2E8, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunocytochemistry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable isotype IgG1 NCBI accession no. NP_000112, UniProt accession no. P19235, shipped in ambient Узнать цену -
Anti-ERAB antibody produced in rabbit
MDL number: MFCD02096320 NACRES: NA.41
Кат. номер E1151-25UG-PW E1151-25UG General descriptionThe gene HSD17B10 (hydroxysteroid (17-β) dehydrogenase 10) encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily.
Specificity
By immunoblotting, the antibody detects native human ERAB. It does not react with mouse or rat.Immunogensynthetic peptide corresponding to amino acids 100-116 of human ERAB protein.ApplicationAnti-ERAB antibody produced in rabbit is suitable for immunohistochemistry at a working concentration of 1-2μg/mL using human cerebellum tissue with DAB detection and for immunoblotting at 1-3μg/mL using human neuroblastoma SK-N-SH cells with chemiluminescence detection.
Biochem/physiol Actions
The gene product is a subunit of mitochondrial ribonuclease P and plays a pivotal role in in mitochondrial tRNA maturation. It catalyzes the oxidation of a wide variety of fatty acids and steroids. The gene is linked to the neuronal dysfunction associated with Alzheimer disease (AD).
Physical form
Solution in 0.05 M sodium phosphate buffer, pH 7.5, containing 0.2% gelatin and 0.1% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 27 kDa species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1-2 µg/mL using human cerebellum tissue","western blot: 1-3 µg/mL using human SK-N-SH cells conjugate unconjugated UniProt accession no. Q99714, shipped in wet ice storage temp. 2-8°C Gene Information human ... HSD17B10(3028)
Safety InformationPersonal Protective Equipment dust mask type N95 (US),, Eyeshields,, Gloves, RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ErbB4 Antibody, clone mAB10
eCl@ss: 32160702
Кат. номер MABN2484-25UL MABN2484-100UL General descriptionReceptor tyrosine-protein kinase erbB-4 (UniProt: Q61527; also known as EC: 2.7.10.1, Proto-oncogene-like protein c-ErbB-4) is encoded by the Erbb4 (also known as Mer4) gene (Gene ID: 13869) in murine species. ErbB-4 is a single-pass type I membrane protein of the EGF receptor family that plays an essential role as cell surface receptor for neuregulins (NRG) and EGF family members. ErbB-4 is monomeric in the absence of bound ligand and it homo- or heterodimerizes with another ERBB family member upon ligand binding. ErbB-4 is autophosphorylated on tyrosine residues in response to ligand binding that triggers receptor dimerization and autophosphorylation at specific tyrosine residues, which then serve as binding sites for scaffold proteins and effectors. ErbB-4 is reported to regulate the development of the heart, the central nervous system, and the mammary gland. It is shown to be involved in gene transcription, cell proliferation, differentiation, migration, and apoptosis. It is expressed in the developing and adult cerebral cortex, and represents the major NRG receptor in central neurons and regulates a diverse array of neuronal processes, including migration, differentiation, neurotransmission, and synaptic plasticity. NRG-1 and ErbB-4 are essentials of a signaling pathway that is critical for the proper development of inhibitory cortical and hippocampal circuits. ErbB-4 expression is reported to be restricted to GABAergic neurons in the cerebral cortex where it plays a role in regulating GABAergic synaptic development and interneuron migration. ErbB-4 is synthesized with a signal peptide (aa 1-25), which is cleaved off in the mature form. The mature form has an extracellular domain (aa 26-652), a short transmembrane domain (aa 653-673), and a long cytoplasmic tail (aa 674-1308). Its protein kinase domain is localized in the cytoplasmic tail (aa 718-985). Three isoforms of ErbB-4 have been described that are produced by alternative splicing.
Specificity
Clone mAB10 is a rabbit monoclonal antibody that detects mouse Receptor tyrosine-protein kinase erbB-4. It targets an epitope with in the C-terminal region.ImmunogenGST-tagged recombinant protein corresponding to 204 amino acids from the C-terminal region of murine Receptor tyrosine-protein kinase erbB-4.ApplicationImmunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected ErbB4 in mouse embryo tissue sections.
Western Blotting Analysis: A representative lot detected ErbB4 in Western Blotting applications (Vullhorst, D., et. al. (2009). J Neurosci. 29(39):12255-64).
ELISA Analysis: A representative lot detected ErbB4 in ELISA applications (Vullhorst, D., et. al. (2009). J Neurosci. 29(39):12255-64).
Immunohistochemistry Analysis: A representative lot detected ErbB4 in Immunohistochemistry applications (Vullhorst, D., et. al. (2009). J Neurosci. 29(39):12255-64).
Immunoprecipitation Analysis: A representative lot immunoprecipitated ErbB4 in Immunoprecipitation applications (Vullhorst, D., et. al. (2009). J Neurosci. 29(39):12255-64).
Research Category
Neuroscience
Anti-ErbB4, clone mAB10, Cat. No. MABN2484, is a highly specific rabbit monoclonal antibody that targets Receptor tyrosine-protein kinase ErbB-4 and has been tested for use in ELISA, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse cerebral cortex tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected ErbB4 in mouse cerebral cortex tissue sections.
Target description
146.85 kDa calculated.
Physical form
Purified rabbit monoclonal antibody IgG in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form purified immunoglobulin antibody product type primary antibodies clone mab10, monoclonal species reactivity mouse packaging antibody small pack of 25 µL application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_034284.1, UniProt accession no. Q61527, Узнать цену -
Anti-eRF1 antibody produced in rabbit
NACRES: NA.41
Кат. номер E8156-200UL E8156-25UL General descriptionEukaryotic translation termination factor 1 (eRF1) is a protein encoded by the ETF1 gene in humans. It belongs to eRF1 family and the amino-acid sequence is highly conserved.ApplicationAnti-eRF1 antibody produced in rabbit has been used in western blotting and immunoprecipitation.
Biochem/physiol Actions
Eukaryotic translation termination factor 1 (eRF1) proteins are directly implicated in the termination of translation in eukaryotes. It plays an important role in the termination of protein synthesis, which is performed by three domains (N, M and C) of eRF1. Rearrangement in eRF1 leads to N-domain accommodation into the ribosomal A site.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 50 kDa species reactivity human, rat, mouse packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoprecipitation (IP): 1-2 µg using HeLa cell lysates.","western blot: 0.5-1 µg/mL using 3T3 or Rat1 cell extracts. conjugate unconjugated UniProt accession no. P62495, shipped in dry ice storage temp. 20°C Gene Information human ... ETF1(2107)
mouse ... Etf1(225363)
rat ... Etf1(307503)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-eRF3a/GSPT1 antibody produced in rabbit
MDL number: MFCD09265357
Кат. номер E4781-200UL E4781-25UL General descriptionEukaryotic release factor 3 a (eRF3a) is encoded by the gene G1 to S phase transition 1 (GSPT1) in humans. The eRF3a/GSPT1 exon 1 is a translation termination protein characterized with a tri-nucleotide GGC repeat coding for a polyglycine expansion in the amino-terminal end.Immunogensynthetic peptide corresponding to amino acids 190-204 of human eRF3a/GSPT1, conjugated to KLH via a C-terminal added cysteine residue. The sequence is conserved in human, rat, and mouse.ApplicationAnti-eRF3a/GSPT1 antibody produced in rabbit has been used in immunoprecipitation, indirect immunofluorescence and western blotting.
Biochem/physiol Actions
Eukaryotic release factor 3a (eRF3a) is a translation termination protein that is encoded by G1 to S phase transition 1 gene (GSPT1) in humans. The eRF3a/GSPT1 exon 1 contains a tri-nucleotide GGC repeat coding for a polyglycine expansion in the N-terminal of the protein. It is associated with protein translation as a regulator of apoptosis signal-regulating kinase 1 (ASK1). GSPT1 interacts with ASK1 and enhances ASK1-induced apoptotic activity by activating caspase-3. It plays a novel role in the regulation of ASK1-mediated apoptosis. GSPT1 is found to be up-regulated in various human cancers and is considered as a potential proto-oncogene.
Eukaryotic release factor 3 a (eRF3a) is proteolytically processed into an IAP (Inhibitors of Apoptosis Proteins)-binding protein. Processed eRF3a interacts with IAPs and can promote caspase activation, IAP ubiquitination and apoptosis. The IAP binding motif is exposed only after proteolytic cleavage of a 69-residue leader sequence. eRF3a also affects mRNA stability and translation initiation by interacting with Poly(A)-binding protein (PABP) and the surveillance factor Upf1.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 76.5 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoprecipitation (IP): 1-2 µg using HeLa cell lysates","indirect immunofluorescence: 5-10 µg/mL using paraformadehyde-fixed HeLa cells","western blot: 0.5-1 µg/mL using HeLa cell lysates conjugate unconjugated UniProt accession no. P15170, shipped in dry ice storage temp. 20°C Gene Information human ... GSPT1(2935)
mouse ... Gspt1(14852)
rat ... Gspt1(24420)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ERG antibody produced in rabbit
Human Protein Atlas Number: HPA046598 Human Protein Atlas characterization data
Кат. номер HPA046598-100UL HPA046598-25UL Immunogenv-ets avian erythroblastosis virus E26 oncogene homologApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87475,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence HYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQ conjugate unconjugated UniProt accession no. P11308, shipped in wet ice storage temp. 20°C Gene Information human ... ERG(2078)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ERLIN1 antibody produced in rabbit
Human Protein Atlas Number: HPA011252 Human Protein Atlas characterization data
Кат. номер HPA011252-100UL HPA011252-25UL General descriptionERLIN1 (ER lipid raft associated 1) is a member of the prohibitin protein family, and contains the ~160 amino acid long prohibitin-homology domain (PHB). It has a molecular weight of ~40kDa. It exists in association with lipid rafts, and is found in the ER (endoplasmic reticulum). ERLIN1 mRNA is expressed in a wide range of human tissues. This protein contains a transmembrane N-terminal, which is responsible for targeting this protein to the ER, and a C-terminal containing the SPFH (Stomatin, Prohibitin, Flotillin, and HflC/HflK) domain, projecting into the ER lumen. ERLIN1 forms a hetero-oligomeric complex with ERLIN2, with which it shares high sequence homology.ImmunogenErlin-1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
ERLIN1 (ER lipid raft associated 1) is differentially expressed in activated and non-activated dendritic cells (DCs), and might play a role in the activation of DCs. ERLIN1/ERLIN2 complex is involved in the endoplasmic reticulum (ER) associated degradation (ERAD) of inositol 1,4,5-trisphosphate (IP3) receptor, post IP3-receptor activation. Variants in the ERLIN1-CHUK-CWF19L1 gene cluster are associated with simple steatosis and hepatic steatosis with inflammation. Thus, this cluster might influence the susceptibility to non-alcoholic fatty liver disease (NAFLD). ERLIN1 regulates and inhibits sterol regulatory element binding proteins (SREBPs) during cholesterol sufficiency, and therefore, contributes to cellular cholesterol homeostasis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71702,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500 immunogen sequence AREKAKADAEYYAAHKYATSNKHKLTPEYLELKKYQAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGRESSLPSKEALEPSGENVIQNK UniProt accession no. O75477, shipped in wet ice storage temp. 20°C Gene Information human ... ERLIN1(10613)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ESET (SETDB1) Antibody, clone F0808
eCl@ss: 32160702
Кат. номер MABE1067-25UG MABE1067-100UG General descriptionHistone-lysine N-methyltransferase SETDB1 (UniProt: O88974; also known as EC: 2.1.1.43, ERG-associated protein with SET domain, ESET, SET domain bifurcated 1, SETDB1) is encoded by the Setdb1 (also known as Eset, Kiaa0067) gene in murine species. SETDB1 is a ubiquitously expressed histone methyltransferase with multiple zinc-binding sites that specifically trimethylates lysine 9 of histone H3 immediately downstream of transcription start sites marked with H3K4me3 to establish the bivalent domain. It is targeted to histone H3 by TRIM28/TIF1B, a factor recruited by Kruppel-associated box (KRAB) zinc-finger proteins. The H3K4/H3K9me3 signature keeps RNA polymerase II (Pol II) paused at the proximal promoter and maintains gene expression at low levels, but in a poised state that is ready for activation in lineage-committed cells. It functions mainly in euchromatin regions, thereby playing a key role in the silencing of euchromatic genes. It probably acts by forming a complex with MBD1 and ATF7IP that represses transcription and couples DNA methylation and histone lysine 9 trimethylation. SETDB1 is reported to inhibit adipogenesis and its depletion induces preadipocyte differentiation and adipogenesis in mesenchymal stem cells and preadipocytes. Expression of Cebpa and Pparg genes that are its key targets of SETDB1 is enhanced when SETDB1 is knocked down in undifferentiated cells. Murine SETDB1 contains two Tudor domains (aa 257-320 and 347-403) and pre-SET (aa 744-817), SET (aa 820-1282), and post-SET (aa 1291-1307) domains that are required for its methyltransferase activity. (Ref.: Matsumura, Y., et al. (2015). Mol. Cell 60(4); 584-596).
Specificity
Clone F0808 specifically detects Histone-lysine N-methyltransferase SETDB1. It targets an epitope with in the internal region.ImmunogenHis-tagged recombinant fragment corresponding to 213 amino acids from the internal region of murine SETDB1.ApplicationAnti-ESET (SETDB1), clone F0808, Cat. No. MABE1067, is a highly specific mouse monoclonal antibody that targets Histone-lysine N-methyltransferase SETDB1 and has been tested for use in Chromatin Immunoprecipitation (ChIP), Immunoprecipitation, and Western Blotting.
Chromatin Immunoprecipitation Analysis (ChIP): A representative lot detected ESET (SETDB1) in Chromatin Immunoprecipitation applications (Matsumura, Y., et. al. (2015). Mol Cell. 60(4):584-96).
Immunoprecipitation Analysis: A representative lot immunoprecipitated ESET (SETDB1) in Immunoprecipitation applications (Matsumura, Y., et. al. (2015). Mol Cell. 60(4):584-96).
Quality
Evaluated by Western Blotting in 129/S6/SvEv mouse embryonic stem cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected ESET (SETDB1) in 129/S6/SvEv mouse embryonic stem cell lysate.
Target description
~180/200 kDa observed; 144.55 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone F0808, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) ChIP: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 UniProt accession no. O88974,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Estrogen Receptor Antibody, clone 60C, rabbit monoclonal
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 4-820-25UL 4-820 4-820-100UL General descriptionThe Estrogen Receptors (ER) belong to the nuclear receptor family that contains a ligand-binding domain that maintains the protein in an inactive conformation unless bound to the hormone. Two ERs are known, ERα, classically known as ER, and ERβ, described long after ERα. Activated Estrogen Receptor is a DNA-binding protein capable of inducing many changes in gene expression. The Estrogen Receptor is believed to play an important role in the growth and development of a subset of hormone dependent human breast cancers. ERβ is expressed in prostate, ovary, and other reproductive organs. Although its steroid specificity is very similar to that of the ERα, the molecular mechanisms regulating the transcriptional activity of ERβ may be distinct from those regulating ERα.
Specificity
Recognizes Estrogen Receptor α. No cross-reactivity with Estrogen Receptor β.
Predicted to cross-react with rat, mouse, bovine and porcine based on sequence homology.ImmunogenEpitope: N-term
KLH-conjugated, synthetic peptide corresponding to amino acids 13-32 (C-ALLHQIQGNELEPLNRPQLK) of human Estrogen Receptor α. The immunizing sequence is identical in rat and mouse and has 19/20 identical amino acids in bovine and porcine.ApplicationAnti-Estrogen Receptor α Antibody, clone 60C is an antibody against Estrogen Receptor α for use in WB & IP.
Research Sub Category
Transcription Factors
Immunoprecipitation:
4-10 µL of a previous lot of this clone immunoprecipitated Estrogen Receptor from 1 mg of MCF-7 RIPA lysate.
Research Category
Epigenetics & Nuclear Function
Quality
Routinely evaluated by western blot analysis.
Western Blot Analysis:
This lot detected ER at a 1:2,000 dilution in MCF-7 lysates via SDS-PAGE and transferred to PVDF (Immobilon-P).
Target description
66 kDaLinkageReplaces: 05-820
Physical form
Unpurified
Cultured supernantant with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
For maximum recovery of product, centrifuge the vial prior to removing the cap.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form culture supernatant antibody product type primary antibodies clone 60C, monoclonal species reactivity mouse, pig, bovine, rat, human packaging antibody small pack of 25 µL application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_000116.2, UniProt accession no. P03372, shipped in dry ice Узнать цену -
Anti-Estrogen Receptor Antibody, clone 68-4, rabbit monoclonal
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-824-25UL 5-824 5-824-100UL General descriptionProduced in collaboration with Epitomics
Estrogen receptors (ER) are members of the steroid/thyroid hormone receptor superfamily of ligand-activated transcription factors. Estrogen receptors, including ERα and ERβ, contain DNA binding and ligand binding domains and are critically involved in regulating the normal function of reproductive tissues. They are located in the nucleus, though some estrogen receptors associate with the cell surface membrane and can be rapidly activated by exposure of cells to estrogen. ERα and ERβ have been shown to be differentially activated by various ligands. Receptor-ligand interactions trigger a cascade of events, including dissociation from heat shock proteins, receptor dimerization, phosphorylation and the association of the hormone activated receptor with specific regulatory elements in target genes. Evidence suggests that ERα and ERβ may be regulated by distinct mechanisms even though they share many functional characteristics.
Specificity
Predicted to cross-react with rat and mouse based on sequence homology
Recognizes Estrogen Receptor β, long form, does not detect estrogen receptor alpha.ImmunogenKLH-conjugated linear peptide corresponding to amino acids 108-127 from the N-terminal half of human estrogen receptor beta.ApplicationDetect Estrogen Receptor β also known as Nuclear receptor subfamily 3 group A member 2 with Anti-Estrogen Receptor β Antibody, clone 68-4 (Rabbit Monoclonal Antibody), that has been demonstrated to work in IP & WB.
Research Sub Category
Transcription Factors
Research Category
Epigenetics & Nuclear Function
Quality
routinely evaluated by immunoblot on RIPA lysates from MCF7 cells
Target description
59 kDa
Physical form
Format: Purified
Protein A Purified immunoglobulin in 0.1M Tris-Glycine, 0.15M NaCl and 0.05% sodium azide, pH 7.4.
Protein A purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
MCF7 cell extractsOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone 68-4, monoclonal species reactivity human packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NM_001437, UniProt accession no. Q92731, shipped in ambient Gene Information human ... ESR2(2100) Узнать цену -
Anti-Estrogen-related Receptor Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 7-662 7-662-25UG 7-662-100UG General descriptionEstrogen-related receptor alpha is a nuclear receptor protein related to the Estrogen receptor. It is reported to interact with estrogen and similar steroids and functions as a transcriptional activator.
This protein is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes. In mouse, ERR alpha is expressed in many adult and embryonic tissues (particularly at the onset of ossification) as well as in several osteoblast cell lines. ERR alpha expression has been documented in mouse in brain, spinal cord, pituitary gland and heart.
Specificity
Recognizes Estrogen-related Receptor α.ImmunogenOvalbumin-conjugated, synthetic peptide corresponding to amino acids 339-364 of human Estrogen Receptor-Related αApplicationResearch Sub Category
Transcription Factors
Research Category
Epigenetics & Nuclear Function
Anti-Estrogen-related Receptor α Antibody is a Rabbit Polyclonal Antibody for detection of Estrogen-related Receptor α also known as ERR alpha & has been tested in EMSA, IHC, IP & WB.
Quality
Routinely evaluated by immunoblot on RIPA lysates from HeLa nuclear extracts.
Target description
53 kDa
Physical form
Format: Purified
Protein A Purified rabbit IgG in a solution of 30% glycerol, 0.07M Tris-glycine, pH 7.4, 0.135M NaCl, and 0.035% sodium azide as a preservative.
Protein A purified
Storage and Stability
Maintain for 2 years at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Positive Control Included: HeLa Nuclear Extract (12-309).Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, rat, human, hamster packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) electrophoretic mobility shift assay: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NM_000125.2, UniProt accession no. P03372, shipped in ambient Gene Information human ... ESR1(2099) Узнать цену -
Anti-Etanercept Antibody, clone ETA63C8
eCl@ss: 32160702
Кат. номер MABF1973 MABF1973-25UL General descriptionEtanercept is a chimeric fusion protein consisting of the extracellular ligand-binding portion of the p75 TNF receptor linked to the Fc portion of human IgG1. This Fc component contains the hinge, CH2 and CH3 regions, but not the CH1 region of IgG1. Etanercept binds to TNF-alpha and blocks its interactions with receptors. Hence, it is considered a TNF inhibitor that functions as a decoy receptor that binds to TNF. Although it mimics the inhibitory effects of naturally occurring soluble TNF receptors, the difference is that Etanercept has a greatly extended half-life in the bloodstream. Its speci fic activity is reported to be about 1.7 x 106 units/mg. Etanercept is shown to modulate biological responses produced by TNF, including expression of adhesion molecules responsible for leukocyte migration, serum levels of cytokines, and serum levels of matrix metalloproteinase-3. It is also shown to affect animal models of inflammation, including murine collagen-induced arthritis. Clone ETA63C8 can bind to Etanercept and block its activity.
Specificity
Clone ETA63C8 detects Etanercept in human samples. It can bind to Etanercept and block its activity.ImmunogenChimeric fusion protein cotaining the extracellular ligand-binding portion of the p75 TNF receptor linked to the Fc portion of human IgG1.ApplicationNeutralizing Analysis: A representative lot neutralized Etanercept in Neutralizing applications (Detrez, I., et. al. (2016). J Immunol. 196(6):2879-84).
ELISA Analysis: A representative lot detected Etanercept in ELISA applications (Detrez, I., et. al. (2016). J Immunol. 196(6):2879-84).
ELISA Analysis: 4 µg/mL from a representative lot detected Etanercept in human serum with AS (ankylosing spondylitis) (Courtesy of Professor Ann Gils, Ph.D., KU Leuven Belgium).
Anti-Etanercept, clone ETA63C8, Cat. No. MABF1973, is a mouse monoclonal antibody that can bind to Etanercept and has been tested for use in ELISA and Neutralizing.
Research Category
Inflammation & Immunology
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG1.
Target description
150 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100, biological source mouse antibody form purified antibody antibody product type primary antibodies clone ETA63C8, monoclonal species reactivity human packaging antibody small pack of 25 μL application(s) ELISA: suitable, neutralization: suitable isotype IgG1κ
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-EWS Antibody, clone 21B1
eCl@ss: 32160702
Кат. номер MABE1932-25UL MABE1932-100UL General descriptionRNA-binding protein EWS (UniProt: Q01844; also known as EWS oncogene, Ewing sarcoma breakpoint region 1 protein) is encoded by the EWSR1 (also known as EWS) gene (Gene ID: 2130) in human. EWS is member of the TET family of DNA and RNA-binding proteins, which also includes translocated in liposarcoma/fused in sarcoma protein (FUS/TLS) and TATA-binding protein-associated factor 15. It is a multifaceted RNA binding protein with established roles in transcription, pre-mRNA processing, and DNA damage response. It contains a transcriptional-activation domain (EAD), 3 glycine-arginine rich regions, an RNA-binding domain, and a zinc finger domain (aa 518-549). EWS is highly methylated on arginine residues and methylation is mediated by PRMT1 and to some extent by PRMT8. Various environmental signals are known to induce post-translational modifications in its RNA binding domain and glycine-arginine rich domains, thus modulating EWS activity. EWS can relocate from cytoplasm to ribosomes upon PTK2B/FAK2 activation. Mutations in EWS gene are known to cause Ewing sarcoma, a highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue.
Specificity
Clone 21B1 is a rat monoclonal antibody that detects human RNA-binding protein EWS. It targets an epitope with in 20 amino acids from the C-terminal region.ImmunogenOvalbumin-conjugated linear peptide corresponding to 20 amino acids from the RGG3 domain of human RNA-binding protein EWS.ApplicationAnti-EWS, clone 21B1, Cat. No. MABE1932, is a highly specific rat monoclonal antibody that targets RNA-binding protein EWS and has been tested in ELISA and Western Blotting.
ELISA Analysis: A representative lot detected EWS in ELISA applications (Suarez-Calvet, M, et. al. (2016). Acta Neropathol. 131(4):587-604).
Western Blotting Analysis: A representative lot detected EWS in Western Blotting applications (Suarez-Calvet, M, et. al. (2016). Acta Neropathol. 131(4):587-604).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected EWS in HeLa cell lysate.
Target description
~85 kDa observed; 68.48 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 21B1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) ELISA: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_053733, UniProt accession no. Q01844,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Exo1
eCl@ss: 32160702
Кат. номер ABE1354-25UG ABE1354-100UG General descriptionExonuclease 1 (UniProt: Q9UQ84; also known as hExo1, Exonuclease I, hExoI) is encoded by the EXO1 (also known as EXOI, HEX1) gene (Gene ID: 9156) in human. Exonuclease 1 is a magnesium-dependent protein with 5 to 3 exonuclease and an RNase H activity. It may also possess a cryptic 35 double-stranded DNA exonuclease activity. It is highly expressed in bone marrow, testis and thymus. Higher levels of expression are also observed in fetal liver. Lower expression has been observed in colon, lymph nodes, ovary, placenta, prostate, small intestine, spleen, and stomach. It functions in DNA mismatch repair to excise mismatch-containing DNA tracts directed by strand breaks located either 5 or 3 to the mismatch. It interacts physically with the DNA mismatch repair proteins, Msh2 and Mlh1, and is involved in the excision of the mispaired nucleotide. Exonuclease 1 is phosphorylated upon DNA damage and in response to agents stalling DNA replication, probably by ATM or ATR. It is shown to be phosphorylated at Serine 454, Threonine 621, and Serine 714 upon DNA-damage caused by treatment with hydroxyurea, but not upon IR treatment. The hydroxyurea-induced triple phosphorylation of exonuclease 1 facilitates destabilization/degradation of the protein.
Specificity
This rabbit polyclonal antibody detects Exonuclease 1 in human cells. It targets an epitope within 16 amino acids from the C-terminal half.ImmunogenKLH-conjugted linear peptide corresponding to 16 amino acids from the C-terminal half of human Exonuclease 1. The immunogen sequence is conserved in both isoforms 1 and 2.
Epitope: unknownApplicationImmunoprecipitation Analysis: A representative lot detected Exo1 in HeLa cell lysate (Courtesy of Dr. Zhongsheng You at Washington University in St. Louis).
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected Exo1 in HeLa and siExo1 hela cell lysates (Courtesy of Dr. Zhongsheng You at Washington University in St. Louis).
Anti-Exo1, Cat. No. ABE1354, is a highly specific rabbit polyclonal antibody that targets Exonuclease 1 and has been tested for use in Immunoprecipitation and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in 293T cells transfected with GFP-Exo1.
Western Blotting Analysis: 2 µg/mL of this antibody detected Exo1 in 293T cells transfected with GFP-Exo1.
Target description
~145 kDa observed; 94.10 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunoprecipitation (IP): suitable","western blot: suitable NCBI accession no. NP_006018, UniProt accession no. Q9UQ84, Gene Information human ... EXO1(9156) Узнать цену -
Anti-EXOC2 antibody produced in rabbit
Human Protein Atlas Number: HPA032093 Human Protein Atlas characterization data
Кат. номер HPA032093-100UL HPA032093-25UL Immunogenexocyst complex component 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77390,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS UniProt accession no. Q96KP1, shipped in wet ice storage temp. 20°C Gene Information human ... EXOC2(55770)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-EXOC7 antibody produced in rabbit
Human Protein Atlas Number: HPA022840 Human Protein Atlas characterization data
Кат. номер HPA022840-100UL HPA022840-25UL ImmunogenExocyst complex component 7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75901,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence DDMLDVETDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKAIVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKA UniProt accession no. Q9UPT5, shipped in wet ice storage temp. 20°C Gene Information human ... EXOC7(23265)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Exportin 1/Crm1 (C-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер E7909-25UL E7909-200UL General descriptionExportin 1/Crm1 (also known as XPO1, Exp1, chromosome region maintenance 1 protein homolog) is mapped to human chromosome 2p15.ApplicationAnti-Exportin 1/Crm1 (C-terminal) antibody produced in rabbit has been used in immunoblotting.
Biochem/physiol Actions
Exportin 1/Crm1 has been implicated in various steps during mitosis.
Exportin-1 is a protein encoded by the XPO1 gene in humans. It is a novel cell-cycle regulated gene that is essential for the nuclear export signal-dependent nuclear export of proteins. XPO1 is highly expressed in mantle cell lymphoma (MCL) cells. It acts as selective inhibitor of nuclear export (SINE) compounds that induce apoptosis in MCL cells. XPO1 is expressed in subpopulation of Gastric cancer (GC) with aggressive behavior and can serve as a prognosis marker for poor outcome. It has helical hairpin HEAT repeats and a C-terminal helical extension (C-extension). The C-extension helps in regulating CRM1′s cargo-binding affinity by modulating the conformation and flexibility of its HEAT repeats.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~125 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) western blot: 2-4 µg/mL using K562 cell lysates conjugate unconjugated UniProt accession no. O14980, shipped in dry ice storage temp. 20°C Gene Information human ... XPO1(7514)
mouse ... Xpo1(103573)
rat ... Xpo1(85252)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-EZH2 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 7-689-25UL 7-689 7-689-100UL General descriptionPolycomb protein group complexes are responsible for the regulation of hundreds of genes in mammals and insects. These proteins are responsible for the assembly and packaging of chromatin and for the induction of methylation on Histone H3. EZH2 (enhancer of zeste homologue 2) is a member of the polycomb group of proteins and is involved in cell cycle regulation. EZH2 represses transcription via trimethylation of histone H3 on Lys27 (H3K27) as indicated by the fact that RNAi-mediated knockdown of EZH2 resulted in a loss of H3K27 trimethylation. The expression of this protein in human tumors is aggressive for hormone refractory prostate cancer. In breast cancer EZH2 expression was increased in malignant tumors and promoted anchorage independent and invasive growth in vitro.
Specificity
EZH2ImmunogenHis-tagged fusion protein corresponding to residues 1-343 of mouse enhancer of Zeste homolog 2 (EZH2)ApplicationResearch Sub Category
Histones
This Anti-EZH2 Antibody is validated for use in Immunoprecipitation and Western Blotting and ChIP-seq for the detection of EZH2.
Research Category
Epigenetics & Nuclear Function
Quality
routinely evaluated by immunoblot on RIPA lysates from HeLa and C2C12 cells
Target description
95-100kDa
Physical form
Format: Purified
Antiserum
Storage and Stability
stable for 2 years at 2-8°C from date of shipment
Analysis Note
Control
K562 cell lysate, C2C12 cell lysateOther Notesfeature_concentration_valuePlease refer to lot specific datasheet.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form whole antiserum antibody product type primary antibodies clone polyclonal species reactivity human, mouse packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) ChIP: suitable (ChIP-seq)","immunoprecipitation (IP): suitable","western blot: suitable NCBI accession no. NM_004456.3,","NM_152998.1, UniProt accession no. Q15910, shipped in ambient Gene Information human ... EZH2(2146) Узнать цену -
Anti-Ezrin antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200806-25UL SAB4200806-100UL General descriptionEzrin, also known as cytovillin, p81 or 80K, is a.member of the ERM proteins family composed of Ezrin, Radixin, and Moesin. These proteins are known as actin-binding proteins that link the cell membrane to the actin cytoskeleton, particularly in microvillus-bearing epithelial cells. Ezrin is present in microvilli, microspikes, and membrane ruffles of cells.
The ERM proteins family are involved in the functional expression of membrane proteins on the cell surface, integrate Rho guanosine 5-triphosphatase (GTPase) signaling regulating cytoskeletal organization and act as protein kinase A (PKA)-anchoring proteins. Therefore, ERM proteins seem to play an important role in the membrane transport of electrolytes by ion channels and transporters.ImmunogenThe carboxy-terminal part of recombinant human ezrinApplicationMonoclonal Anti-Ezrin recognizes an epitope located on the C-terminal region of Ezrin. Reactivity has been observed with human, mouse, hamster, monkey, bovine, canine, rat and rat-kangaroo origin. The antibody is recommended to use in various immunological techniques, including Immunoblotting (~80kDa), immunofluorescence, Immunohistochemistry and immunoprecipitation.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.Other NotesThis product is for R&D use only, not for drug, household, or other uses.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone 3C12, monoclonal form buffered aqueous solution mol wt ~80 kDa species reactivity monkey, hamster, mouse, canine, human, rat, kangaroo, bovine packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 1-2 µg/mL using using canine MDCK cells extract","immunofluorescence: 0.5-1 µg/mL using human epidermoid carcinoma A431 cells. isotype IgG1 UniProt accession no. P15311, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-F4/80 (mouse), APC, clone BM8.1 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1524 MABF1523 General descriptionThe BM8.1 antibody is specific for mouse F4/80 antigen, a 125 kDa transmembrane protein widely expressed by members of the mononuclear phagocyte system and considered to be a key marker for mature macrophage cells. F4/80 is differentially expressed during myeloid cell development, and may be regulated by certain cytokines within the tissue microenvironment. Other cell types shown to express this antigen include Langerhans cells, Kupffer cells and dendritic cell subsets. BM8.1 is widely used together with antibodies to CD115 (c-fms), CD11b and CD11c to identify myeloid / macrophage cells by flow cytometry.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationThis rat monoclonal Anti-F4/80 Antibody (mouse), APC, clone BM8.1, Cat. No. MABF1523 is validated for use in Flow Cytometry, for the detection of F4/80.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg from a representative lot detected F4/80 in one million C57Bl/6 splenocytes stained with FITC Anti-mouse CD11b.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone BM8.1, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2a conjugate Allophycocyanin conjugate UniProt accession no. Q61549,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-F4/80 (mouse), FITC, clone BM8.1 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1527 MABF1528 General descriptionThe BM8.1 antibody is specific for mouse F4/80 antigen, a 125 kDa transmembrane protein widely expressed by members of the mononuclear phagocyte system and considered to be a key marker for mature macrophage cells. F4/80 is differentially expressed during myeloid cell development, and may be regulated by certain cytokines within the tissue microenvironment. Other cell types shown to express this antigen include Langerhans cells, Kupffer cells and dendritic cell subsets. BM8.1 is widely used together with antibodies to CD115 (c-fms), CD11b and CD11c to identify myeloid / macrophage cells by flow cytometry.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationResearch Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-F4/80 Antibody (mouse), FITC, clone BM8.1, Cat. No. MABF1528 is validated for use in Flow Cytometry, for the detection of F4/80.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected F4/80 in one million C57Bl/6 splenocytes.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone BM8.1, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable conjugate FITC conjugate UniProt accession no. Q61549,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-F4/80 (mouse), PerCP-Cy5.5, clone BM8.1 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1532 MABF1531 General descriptionThe BM8.1 antibody is specific for mouse F4/80 antigen, a 125 kDa transmembrane protein widely expressed by members of the mononuclear phagocyte system and considered to be a key marker for mature macrophage cells. F4/80 is differentially expressed during myeloid cell development, and may be regulated by certain cytokines within the tissue microenvironment. Other cell types shown to express this antigen include Langerhans cells, Kupffer cells and dendritic cell subsets. BM8.1 is widely used together with antibodies to CD115 (c-fms), CD11b and CD11c to identify myeloid / macrophage cells by flow cytometry.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationAnti-F4/80 (mouse), PerCP-Cy5.5, clone BM8.1 Antibody is an antibody against F4/80 for use in Flow Cytometry.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.125 µg from a representative lot detected F4/80 in one million C57Bl/6 bone marrow cells stained with FITC Anti-mouse CD11b.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone BM8.1, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2a conjugate PerCP-Cy5.5 UniProt accession no. Q61549, Узнать цену -
Anti-F4/80 (mouse), violetFluor® 450, clone BM8.1 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1534 MABF1533 General descriptionThe BM8.1 antibody is specific for mouse F4/80 antigen, a 125 kDa transmembrane protein widely expressed by members of the mononuclear phagocyte system and considered to be a key marker for mature macrophage cells. F4/80 is differentially expressed during myeloid cell development, and may be regulated by certain cytokines within the tissue microenvironment. Other cell types shown to express this antigen include Langerhans cells, Kupffer cells and dendritic cell subsets. BM8.1 is widely used together with antibodies to CD115 (c-fms), CD11b and CD11c to identify myeloid / macrophage cells by flow cytometry.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationAnti-F4/80 (mouse), violetFluor® 450, clone BM8.1 Antibody is an antibody against F4/80 for use in Flow Cytometry.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg from a representative lot detected F4/80 in one million C57Bl/6 bone marrow cells stained with PerCP-Cy5.5 Anti-mouse CD11b.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.Legal InformationvioletFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone BM8.1, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2a conjugate violetFluor® 450 UniProt accession no. Q61549,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Factor XII Antibody, clone 15H8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2037-25UG MABS2037-100UG General descriptionCoagulation factor XII (UniProt: P00748; also known as EC: 3.4.21.38, Hageman factor, HAF) is encoded by the F12 gene (Gene ID: 2161) in human. Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. It activates factor XI to XIa and factor VII to VIIa by selective cleavage of Arginine-Isoleucine bond. Factor XII itself can be activated to factor XIIa either by exposure to negatively charged surfaces or via proteolytic cleavage. It is synthesized in the liver with a signal peptide (aa 1-19), which is subsequently cleaved off in the mature form. Coagulation factor XII circulates in blood as a single chain zymogen, which is converted to a two-chain serine protease with a heavy chain (alpha-factor XIIa) and a light chain. The heavy chain contains two fibronectin-type domains, two epidermal growth factor (EGF)-like domains, a kringle domain, and a proline-rich domain. The light chain contains only a catalytic domain. Mutations in F12 gene can lead to Factor XII deficiency that is generally an asymptomatic anomaly of in vitro blood coagulation. However, some mutations may cause hereditary angioedema 3, which is characterized by episodic local swelling involving subcutaneous or submucous tissue of the upper respiratory and gastrointestinal tracts, face, extremities, and genitalia.
Specificity
Clone 15H8 is a mouse monoclonal antibody that specifically detects Coagulation factor XII.ImmunogenA mixture of purified human Factor XII and Factor XIIaApplicationAnti-Factor XII, clone 15H8, Cat. No. MABS2037, is a mouse monoclonal antibody that detects Coagulation factor XII and has been tested for use in ELISA, Inhibition and Function assays, and Western Blotting.
Research Category
Signaling
Function Analysis: A representative lot prolonged the activated partial thromboplastin time (aPTT). (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
Inhibition Analysis: A representative lot inhibited the generation of thrombin in normal plasma following addition of activated partial thromboplastin reagent. (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
Western Blotting Analysis: A representative lot detected Factor XII in Western Blotting applications (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
ELISA Analysis: A representative lot detected Factor XII in ELISA applications (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
Quality
Evaluated by Western Blotting in human factor XII.
Western Blotting Analysis: 1 µg/mL of this antibody detected human Coagulation factor XII.
Target description
~75 kDa observed; 67.79 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2a in PBS, pH 7.4, without preservatives.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 15H8, monoclonal species reactivity human, baboon packaging antibody small pack of 25 µg application(s) ELISA: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_000496, UniProt accession no. P00748, Узнать цену -
Anti-Factor XII Antibody, clone 9A2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2050-25UG MABS2050-100UG General descriptionCoagulation factor XII (UniProt: P00748; also known as EC: 3.4.21.38, Hageman factor, HAF) is encoded by the F12 gene (Gene ID: 2161) in human. Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. It activates factor XI to XIa and factor VII to VIIa by selective cleavage of Arginine-Isoleucine bond. Factor XII itself can be activated to factor XIIa either by exposure to negatively charged surfaces or via proteolytic cleavage. It is synthesized in the liver with a signal peptide (aa 1-19), which is subsequently cleaved off in the mature form. Coagulation factor XII circulates in blood as a single chain zymogen, which is converted to a two-chain serine protease with a heavy chain (alpha-factor XIIa) and a light chain. The heavy chain contains two fibronectin-type domains, two epidermal growth factor (EGF)-like domains, a kringle domain, and a proline-rich domain. The light chain contains only a catalytic domain. Mutations in F12 gene can lead to Factor XII deficiency that is generally an asymptomatic anomaly of in vitro blood coagulation. However, some mutations may cause hereditary angioedema 3, which is characterized by episodic local swelling involving subcutaneous or submucous tissue of the upper respiratory and gastrointestinal tracts, face, extremities, and genitalia.
Specificity
Clone 9A2 is a mouse monoclonal antibody that specifically detects Coagulation factor XII.ImmunogenA mixture of purified human Factor XII and Factor XIIa.ApplicationELISA Analysis: A representative lot detected Factor XII in ELISA applications (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
Western Blotting Analysis: A representative lot detected Factor XII in Western Blotting applications (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
Inhibition Analysis: A representative lot inhibited the generation of thrombin in normal plasma following addition of activated partial thromboplastin reagent. (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
Function Analysis: A representative lot prolong the activated partial thromboplastin time. (Matafonov, A., et. al. (2014). Blood. 123(11):1739-46).
Research Category
Signaling
Anti-Factor XII, clone 9A2, Cat. No. MABS2050, is a mouse monoclonal antibody that detects Coagulation factor XII and has been tested for use in ELISA, Inhibition and Function assay, and Western Blotting.
Quality
Evaluated by Western Blotting in human factor XII.
Western Blotting Analysis: 4 µg/mL of this antibody detected Factor XII in human factor XII.
Target description
~75 kDa observed; 67.79 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG1 in PBS, pH 7.4, without preservatives.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 9A2, monoclonal species reactivity human, baboon packaging antibody small pack of 25 µg application(s) ELISA: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_000496, UniProt accession no. P00748, Узнать цену -
Anti-FAM83B Antibody, clone 7D11
eCl@ss: 32160702
Кат. номер MABC1128-25UG MABC1128-100UG General descriptionProtein FAM83B (UniProt: Q5T0W9; also known as Family with Sequence Similarity 83, member B) is encoded by the FAM83B (also known as C6orf143) gene (Gene ID: 222584) in human. FAM83B is a member of an 8-member protein family (FAM83) that shares the highly conserved DUF1669. It is a proto-oncogene that functions in the epidermal growth factor (EGF) receptor signaling pathway. May activate both the EGFR itself and downstream RAS/MAPK and PI3K/AKT/TOR signaling cascades. It interacts with RAF1 leading to displacement of 14-3-3 proteins from RAF1, which then activates RAF1 within the RAS/MAPK signaling cascade. Higher levels of FAM83B are shown to increase PI3K/AKT signaling and cell proliferation. In EGFR-dependent breast cancer cells that express higher levels of FAM83B expression, ablation of FAM83B is shown to diminish p110 alpha and AKT membrane localization, which result in reduced AKT phosphorylation and cell proliferation. (Ref.: Cipriano, R., et al (2013). Oncotarget 4(5); 728-738; Cipriano, R., et al (2014). Oncogene 33(25); 3298-3306).
Specificity
Clone 7D11 specifically detects human FAM83B protein.ImmunogenHis-tagged full length human recombinant Protein FAM83B.ApplicationAnti-FAM83B, clone 7D1, Cat. No. MABC1128, is a mouse monoclonal antibody that detects FAM83B and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Signaling
Western Blotting Analysis: A representative lot detected FAM83B in Western Blotting applications (Cipriano, R., et. al. (2014). Oncogene. 33(25):3298-306; Cipriano, R., et. al. (2012). J Clin Incest. 122(9):3197-210).
Immunocytochemistry Analysis: A representative lot detected FAM83B in Immunocytochemistry applications (Cipriano, R., et. al. (2012). J Clin Incest. 122(9):3197-210).
Immunoprecipitation Analysis: A representative lot detected FAM83B in Immunoprecipitation applications (Cipriano, R., et. al. (2014). Oncogene. 33(25):3298-306).
Quality
Evaluated by Western Blotting in HEK293T cells transfected with SN3-hFAM83B-HA.
Western Blotting Analysis: 1 µg/mL of this antibody detected FAM83B in HEK293T cells transfected with SN3-hFAM83B-HA.
Target description
~115 kDa observed; 114.80 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 7D11, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2b NCBI accession no. NP_001010872, UniProt accession no. Q5T0W9,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-FANCD2 Antibody, clone 10F8.1
eCl@ss: 32160702
Кат. номер MABS1889-100UG MABS1889-25UG General descriptionFanconi anemia group D2 protein (UniProt: Q9BXW9; also known as Protein FACD2) is encoded by the FANCD2 (also known as FACD) gene (gene ID: 2177) in human. FACD2 is a nuclear protein that is required for maintenance of chromosomal stability. It is highly expressed in fetal oocytes, and in hematopoietic cells of the fetal liver and bone marrow. High expression is also observed in germinal center cells of the spleen, tonsil, and reactive lymph nodes and in the proliferating basal layer of squamous epithelium of tonsil, esophagus, larynx and cervix. FACD2 promotes accurate and efficient pairing of homologs during meiosis. It is also involved in the repair of DNA double-strand breaks, both by homologous recombination and single-strand annealing and may participate in S phase and G2 phase checkpoint activation upon DNA damage. It is concentrated in nuclear foci during S phase and upon genotoxic stress. FACD2 plays a role in preventing breakage and loss of missegregating chromatin at the end of cell division, particularly after replication stress. It is phosphorylated in response to various genotoxic stresses by ATM and/or ATR. Upon ionizing radiation, it is phosphorylated on serine 222 and serine 1404 by ATM. Phosphorylation on serine 222 is shown to be essential for S-phase checkpoint activation. Mutations in FANCD2 gene are known to cause Fanconi anemia complementation group D2, which results in anemia, leukopenia, and thrombopenia and may cause cardiac, renal, and limb malformations and increase predisposition to malignancies. (Ref.: Shen, Y., et al. (2015). Cancer Cell Microenviron. 2(4): e986).
Specificity
Clone 10F8.1 specifically detects human Fanconi anemia group D2 protein. It targets an epitope with in the first 150 amino acids from the N-terminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to first 150 amino acids of human Fanconi anemia group D2 protein.ApplicationImmunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected FANCD2 in human tonsil and human testis tissue sections.
Research Category
Signaling
Anti-FANCD2, clone 10F8.1, Cat. No. MABS1889, is a mouse monoclonal antibody that detects Fanconi anemia group D2 protein and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in Jurkat cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected FANCD2 in Jurkat cell lysate.
Target description
~166 kDa observed; 164.13 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 10F8.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_149075, UniProt accession no. Q9BXW9,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-FAT10 (human specific) antibody produced in rabbit
Кат. номер SAB4200836-25UL SAB4200836-100UL General descriptionThe Ubiquitin-like protein FAT10, also known as Ubiquitin D (UBD) or Human Leukocyte Antigen (HLA)-F adjacent transcript 10 (FAT10), is a member of the Ubiquitin-like proteins (UBLs) modifier proteins.There are more than 12 identified UBLs including FAT10, SUMOs, NEDD8, ISG15, UFM1, URM1, ATG12, ATG8, FUB1 and HUB1.2 UBLs share a similar structure and function and all UBLs can be covalently attached to their target proteins via the E1–E2–E3 enzymatic cascade in a similar manner to Ubiquitin. UBLylation is a major post-translational modification that in many cases leads to protein degradation in the 26S proteasome.2
Specificity
Anti-FAT10 antibody specifically recognizes FAT10 from human origin.Immunogensynthetic peptide corresponding to the C-terminal region of human FAT10, conjugated to KLHApplicationThe antibody may be used in various immunochemical techniques including Immunoblotting and Immunoprecipitation. Detection of the FAT10 band by Immunoblotting is specifically inhibited by the immunogen.
Biochem/physiol Actions
FAT10 is a unique UBL containing a C-terminal GG motif available for activation and conjugation. This motif differentiates FAT10 from ubiquitin and other UBLs the needs to be cleaved from precursors. Furthermore, unlike ubiquitin that requires a poly-ubiquitin chain, the FAT10 can bind the 26S proteasome as a monomer to mediate proteasomal degradation.2-3 Under normal conditions, FAT10 have short half-life, its expression is repressed by p534 and is restricted to tissues of the immune system like thymus, lymph nodes and the spleen. Inflammatory cytokines such as IFN? and TNFa and downstream STAT3 and NF-?B signaling can induce its expression also in other tissues.2-3,5 FAT10 expression is also upregulated and can be increased up to 100-fold in many cancer types including liver and colon cancer HCC, colorectal, ovarian and uterine carcinomas triple-negative breast cancer, bladder cancer, gastric cancer, glioma, pancreatic ductal, adenocarcinoma and osteosarcoma.2,5-6 FATylation has an important role in many cellular process varied from cell maintenance to DNA repair. Understanding FAT10 mechanism and finding its downstream substrates is important to reveal its role in tumorigenesis.1-7
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 1:1000-1:2000 using human HepG2 treated with TNF-& IFNG& MG-132 whole cell extract. UniProt accession no. O15205 , shipped in dry ice storage temp. 20°C Gene Information human ... UBD(10537)
Safety InformationFlash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-FAT10 (human specific) antibody, Mouse monoclonal
Кат. номер SAB4200835-25UL SAB4200835-100UL General descriptionThe Ubiquitin-like protein FAT10, also known as Ubiquitin D (UBD) or Human Leukocyte Antigen (HLA)-F adjacent transcript 10 (FAT10), is a member of the Ubiquitin-like proteins (UBLs) modifier proteins.There are more than 12 identified UBLs including FAT10, SUMOs, NEDD8, ISG15, UFM1, URM1, ATG12, ATG8, FUB1 and HUB1.2 UBLs share a similar structure and function and all UBLs can be covalently attached to their target proteins via the E1–E2–E3 enzymatic cascade in a similar manner to Ubiquitin. UBLylation is a major post-translational modification that in many cases leads to protein degradation in the 26S proteasome.2
Specificity
Monoclonal Anti-FAT10 antibody specifically recognizes FAT10 from human origin.Immunogensynthetic peptide corresponding to the C-terminal region of human FAT10, conjugated to KLHApplicationThe antibody may be used in various immunochemical techniques including Immunoblotting. Detection of the FAT10 band by Immunoblotting is specifically inhibited by the immunogen.
Biochem/physiol Actions
FAT10 is a unique UBL containing a C-terminal GG motif available for activation and conjugation. This motif differentiates FAT10 from ubiquitin and other UBLs the needs to be cleaved from precursors. Furthermore, unlike ubiquitin that requires a poly-ubiquitin chain, the FAT10 can bind the 26S proteasome as a monomer to mediate proteasomal degradation.2-3 Under normal conditions, FAT10 have short half-life, its expression is repressed by p534 and is restricted to tissues of the immune system like thymus, lymph nodes and the spleen. Inflammatory cytokines such as IFN? and TNFa and downstream STAT3 and NF-?B signaling can induce its expression also in other tissues.2-3,5 FAT10 expression is also upregulated and can be increased up to 100-fold in many cancer types including liver and colon cancer HCC, colorectal, ovarian and uterine carcinomas triple-negative breast cancer, bladder cancer, gastric cancer, glioma, pancreatic ductal, adenocarcinoma and osteosarcoma.2,5-6 FATylation has an important role in many cellular process varied from cell maintenance to DNA repair. Understanding FAT10 mechanism and finding its downstream substrates is important to reveal its role in tumorigenesis.1-7
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone FAT10-10, monoclonal form liquid packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 0.5-1 µg/mL using human HepG2 treated with TNF-& IFNG& MG-132 whole cell extract. isotype IgG1 UniProt accession no. ,","O15205 , shipped in dry ice storage temp. 20°C Gene Information human ... UBD(10537)
Safety InformationFlash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-FcRH5 Antibody, clone F25
eCl@ss: 32160702
Кат. номер MABF2103-25UG MABF2103-100UG General descriptionFc receptor-like protein 5 (UniProt: Q96RD9; also known as FcR-like protein 5, FcRL5, BXMAS1, Fc receptor homolog 5, FcRH5, Immune receptor translocation-associated protein 2, IRTA2, CD307e) is encoded by the FCRL5 (also known as FCRH5, IRTA2, UNQ503/PRO820) gene (Gene ID: 83416) in human. FcRH5 is a single-pass type I membrane protein that is expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. It is involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. It is shown to regulate BCR signaling and binds aggregated IgG and engages several of its Ig-domains to bind IgG. It is shown to be overexpressed in many lymphoma cell lines and on hairy cell leukemia cells. Serum levels of soluble FcRH5 are reported to be elevated in patients with several types of B cell tumors. FcRH5 is synthesized with a signal peptide (aa 1-15), which is cleaved off in the mature form that has a long extracellular domain (aa 16-851), a short transmembrane domain (aa 852-872), and a cytoplasmic tail (aa 873-977) that contains immunoreceptor tyrosine-based inhibitor motifs (ITIM). (Ref.: Franco, A., et al. (2013). J. Immunol. 190(11); 5739-46; Ise, T., et al. (2007). Leukemia 21(1); 169-174).
Specificity
Clone F25 detects human Fc receptor-like protein 5. It targets an epitope with in the extracellular domain.ImmunogenEpitope: extracellular domain
Full-length FcRH5 expression plasmid followed by a boost with 293T cells transfected with FcRH5 plasmid.ApplicationAnti-FcRH5, clone F25, Cat. No. MABF2103, is a mouse monoclonal antibody that detects Fc receptor-like protein 5 and has been tested for use in ELISA, Flow Cytometry, and Western Blotting.
Flow Cytometry Analysis: A representative lot detected FcRH5 in Flow Cytometry applications (Ise, T., et. al. (2005). Clin Cancer Res. 11(1):87-96).
Western Blotting Analysis: A representative lot detected FcRH5 in Western Blotting applications (Ise, T., et. al. (2005). Clin Cancer Res. 11(1):87-96).
ELISA Analysis: A representative lot detected FcRH5 in ELISA applications (Ise, T., et. al. (2005). Clin Cancer Res. 11(1):87-96).
Research Category
Inflammation & Immunology
Quality
Evaluated by Flow Cytometry in SU-DHL-5 cells.
Flow Cytometry Analysis: 1 µg of this antibody detected FcRH5 in one million SU-DHL-5 cells .
Target description
106.44 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone F25, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","flow cytometry: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_112571.2, UniProt accession no. Q96RD9, Gene Information human ... FCRL5(83416) Узнать цену -
Anti-FcRH5 Antibody, clone F56
eCl@ss: 32160702
Кат. номер MABF2102-25UL MABF2102-100UL General descriptionFc receptor-like protein 5 (UniProt: Q96RD9; also known as FcR-like protein 5, FcRL5, BXMAS1, Fc receptor homolog 5, FcRH5, Immune receptor translocation-associated protein 2, IRTA2, CD307e) is encoded by the FCRL5 (also known as FCRH5, IRTA2, UNQ503/PRO820) gene (Gene ID: 83416) in human. FcRH5 is a single-pass type I membrane protein that is expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. It is involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. It is shown to regulate BCR signaling and binds aggregated IgG and engages several of its Ig-domains to bind IgG. It is shown to be overexpressed in many lymphoma cell lines and on hairy cell leukemia cells. Serum levels of soluble FcRH5 are reported to be elevated in patients with several types of B cell tumors. FcRH5 is synthesized with a signal peptide (aa 1-15), which is cleaved off in the mature form that has a long extracellular domain (aa 16-851), a short transmembrane domain (aa 852-872), and a cytoplasmic tail (aa 873-977) that contains immunoreceptor tyrosine-based inhibitor motifs (ITIM). (Ref.: Franco, A., et al. (2013). J. Immunol. 190(11); 5739-46; Ise, T., et al. (2007). Leukemia 21(1); 169-174).
Specificity
Clone F56 detects human Fc receptor-like protein 5. It targets an epitope with in the extracellular domain.ApplicationAnti-FcRH5, clone F56, Cat. No. MABF2102, is a mouse monoclonal antibody that detects Fc receptor-like protein 5 and has been for use in ELISA, Flow Cytometry, Immunocytochemistry, and Western Blotting.
Immunocytochemistry Analysis: A representative lot detected FcRH5 in Immunocytochemistry applications (Ise, T., et. al. (2005). Clin Cancer Res. 11(1):87-96).
Western Blotting Analysis: A representative lot detected FcRH5 in Western Blotting applications (Ise, T., et. al. (2005). Clin Cancer Res. 11(1):87-96).
ELISA Analysis: A representative lot detected FcRH5 in ELISA applications (Ise, T., et. al. (2005). Clin Cancer Res. 11(1):87-96).
Flow Cytometry Analysis: A representative lot detected FcRH5 in Flow Cytometry applications (Ise, T., et. al. (2005). Clin Cancer Res. 11(1):87-96).
Quality
Evaluated by Flow Cytometry in SU-DHL-5 cells.
Flow Cytometry Analysis: 1 µg of this antibody detected FcRH5 in one million SU-DHL-5 cells.
Target description
106.44 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone F56, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) ELISA: suitable","flow cytometry: suitable","immunocytochemistry: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_112571.2, UniProt accession no. Q96RD9, Gene Information human ... FCRL5(83416)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-FcRn (FCGRT)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABF191 ABF191-25UL General descriptionIgG receptor FcRn large subunit p51 (UniProt: Q61559; also known as FcRn, IgG Fc fragment receptor transporter alpha chain, Neonatal Fc receptor) is encoded by the Fcgrt (also known as Fcrn) gene (Gene ID: 14132) in murine species. FcRn is a single-pass type I membrane protein that binds to the Fc region of monomeric immunoglobulins gamma. FcRn complex consist of two subunits: p51 and p14 and contains one Ig-like C1-type (immunoglobulin-like) domain of 88 amino acids. FcRn mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. In rodents, FcRn functions effectively in the neonatal period when it transports maternally derived IgG in ingested milk across the epithelial-cell layer of the proximal small intestine. However, in humans it transports maternal antibody to the fetus across the placenta. In rodent FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. FcRn also protects IgG from degradation providing long half-life of this class of antibody in the serum. (Ref.: Roopenian,, DC and Shreeram,, A (2007). Nat. Rev. Immunol. 7(9); 715-725).
Specificity
This polyclonal antibody detects murine IgG receptor FcRn. It targets an epitope within 44 amino acids from the C-terminal region.ImmunogenGST-tagged recombinant fragment corresponding to 44 amino acids from the C-terminal region of murine IgG receptor FcRn large subunit p51.
Epitope: C-terminusApplicationThis rabbit polyclonal Anti-FcRn (FCGRT) antibody, Cat. No. ABF191, detects IgG receptor FcRn large subunit p51. It has been tested for use in Immunofluorescence and Western Blotting.
Immunofluorescence Analysis: A representative lot detected FcRn (FCGRT) in mouse uterus and vagina (Li, Z., et. al. (2011). Proc Natl Acad Sci USA. 108(11):4388-93).
Western Blotting Analysis: A representative lot detected FcRn (FCGRT) in mouse liver, mouse uterus, and vagina tissue lysate (Li, Z., et. al. (2011). Proc Natl Acad Sci USA. 108(11):4388-93).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in mouse liver tissue lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected FcRn (FCGRT) in 10 µg of mouse liver tissue lysate.
Target description
~53 kDa observed; 40.09 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse packaging antibody small pack of 25 µL application(s) immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_034319, UniProt accession no. Q61559, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-fd Bacteriophage antibody produced in rabbit
NACRES: NA.46
Кат. номер B7786-25UL B7786-.5ML B7786-.2ML
Specificity
The antibody binds specifically to phage coat proteins of fd phage or M13 phage and thus may act as a capture antibody when coated directly on multiwell plates or as a primary detection antibody for specifically captured fd or M13 phage. The antibody may be useful in rapidly sorting large phage display libraries (antibody, peptide, etc.) with the expressed proteins fused to either the gene III or to the gene VIII protein of the filamentous phage. The antibody may be used as a reagent in "phage ELISA" offering sensitive and specific activity for detection of recombinant phages.Immunogenfd bacteriophageApplicationB7786 Rabbit Anti-fd Bactieriophage may be used to sort phage display libraries (antibody, peptide, etc.) with expressed proteins fused to either the gene III or gene VIII protein of filamentous bacteriophage. The product may also be used in "phage ELISA" offering specific activity for detection of recombinant bacteriophage. It will also function as a capture antibody when coated directly on microwell plates or as primary detection antibody for specifically captured fd or M13 bacteriophage.
Anti-fd Bacteriophage antibody produced in rabbit may be used in ELISA at a dilution of 1:1000. It was used to in antiphage immunohistochemistry.
Physical form
Solution supplied in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide
Preparation Note
Anti-fd Bacteriophage is developed in rabbit using repeated injections of fd bacteriophage as the immunogen. Whole antiserum is fractionated and then further purified by ion-exchange chromatography to provide the IgG fraction of antiserum which is essentially free of other rabbit serum proteins.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution packaging antibody small pack of 25 µL application(s) indirect ELISA: 1:1,000 using 5 x 107 phage/ml or 5 x 1010 phage/ml, respectively conjugate unconjugated shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
