Small Pack Antibodies

GST-tagged full-length recombinant murine Disabled homolog 1 expressed in E. coli.

Anti-Dab1, clone 4E12, Cat. No. MABN2276, is a highly specific rat monoclonal antibody that targets Disabled homolog 1 and has been tested in Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Neuroscience
Western Blotting Analysis: A representative lot detected Dab1 in Western Blotting applications (Onoune, A., et. al. (2014). Neurosci Res. 88:23-27; Nakamura, K., et. al. (2016). Neuroscience. 336:20-29).
Immunoprecipitation Analysis: A 1:500 dilution from a representative lot immunoprecipitated Dab1 in cerebral cortex tissue lysate from P20 mouse (Courtesy of Prof. Mitsuharu Hattori, Nagoya City University).
Immunohistochemistry Analysis: A representative lot detected Dab1 in Immunohistochemistry applications (Onoune, A., et. al. (2014). Neurosci Res. 88:23-27).
Quality
Evaluated by Western Blotting in HEK293T cells expressing murine Dab 1.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Dab1 in lysates from HEK293T cells expressing murine Dab 1.
Target description
~78 and 62 kDa observed; 63.58 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Concentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Disabled homolog 1 (UniProt: P97318; also known as DAB1) is encoded by the Dab1 gene (Gene ID: 13131) in murine species. Dab 1 is mainly expressed in the brain and serves as an adapter molecule involved in neural development where it is reported to direct the migration of cortical neurons past previously formed neurons to reach their proper layer. It is a cytosolic protein that is shown to be essential component of the reelin signaling pathway. It is shown to bind to the cytoplasmic tail of Reelin receptor, APO E receptor 2, and to LDL receptor. Dab1 can be phosphorylated on Tyr198, Tyr220, and Tyr232 upon reelin induction in embryonic neurons. It can also be phosphorylated on Ser524, but this phosphorylation is independent of reelin signaling. Tyrosine phosphorylation of Dab1 by Src family tyrosine kinases is considered to be the most critical downstream event in Reelin signaling. Dab1 contains a phosphotyrosine interaction domain (PID) (aa 36-189), which specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins. Seven different isoforms of Dab1 have been identified that are generated via alternative splicing. Clone 4H1 binds to an epitope within amino acids 281-460. (Ref.: Onoue, A., et al. (2014). Neurosci. Res. 88; 23-27).
Specificity
Clone 4H11 is a rat monoclonal antibody that detects murine Disabled homolog 1 (Dab1).

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	4E12, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_034144.1,
UniProt accession no.	P97318,

Узнать цену

Подробнее

Anti-Dab1 Antibody, clone 4H11

GST-tagged full-length recombinant murine Disabled homolog 1 expressed in E. coli.

Anti-Dab1, clone 4H11, Cat. No. MABN2277, is a highly specific rat monoclonal antibody that targets Disabled homolog 1 and has been tested for use in Immunoprecipitation, Immunohistochemistry, and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected Dab1 in Immunohistochemistry applications (Onoune, A., et. al. (2014). Neurosci Res. 88:23-7).
Western Blotting Analysis: A representative lot detected Dab1 in Western Blotting applications (Onoune, A., et. al. (2014). Neurosci Res. 88:23-7; Nakamura, K., et. al. (2016). Neuroscience. 336:20-29).
Immunoprecipitation Analysis: A 1:500 dilution from a representative lot immunoprecipitated Dab1 in cerebral cortex tissue lysate of P20 mouse (Courtesy of Prof. Mitsuharu Hattori, Nagoya City University).
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in HEK293T cells expressing murine Dab 1.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected Dab1 in lysates from HEK293T cells expressing murine Dab 1 but not in mock HEK293T cells.
Target description
68 kDa observed; 63.58 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Dachshund homolog 1 (UniProt: Q9UI36; also known as Dach1) is encoded by the DACH1 (also known as DACH) gene (Gene ID: 1602) in human. Dach1 is a transcription factor that is involved in regulation of organogenesis. Four isoforms of Dach1 have been reported that are produced by alternative splicing. It is shown to be widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart and isoform 4 is found in spleen. Clone 1F6.1 exhibits reactivity with all four isoforms. Dach1 is reported to act as regulator of SIX1, SIX6, and probably SIX5. It also acts as a a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter. Dach1 is shown to Inhibit TGF-beta signaling through interaction with SMAD4 and NCOR1. It binds to chromatin DNA via its DACHbox-N domain, which forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain. PELP1 (proline, glutamic acid, and leucine rich protein 1) serves as a Dach1-binding protein and the carboxyl terminus of Dach1 is required for binding to PELP1. Dach1 is reported to prevent the proliferation of cancerous cells due to being a natural repressor of estrogen receptors (ER) in the normal function of mammary tissue. It inhibits ER alpha transcriptional activity. (Ref.: Popov, VM et al. (2009). Cancer Res. 69(14); 5752-60). +D1
Specificity
Clone 1F6.1 detects all isoforms of Dach1 in human and murine cells. It targets an epitope within 60 amino acids from the C-terminal region.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	4H11, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_034144.1,
UniProt accession no.	P97318,

Узнать цену

Подробнее

Anti-Dach1 Antibody, clone 1F6.1

GST/His-tagged recombinant fragment coreesponding to 60 amino acids from the C-termnal region of human Dach1.

Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Dach1 in human bone marrow and human colon cancer tissues.
Western Blotting Analysis: 0.5 µg/mL from a representative lot detected Dach1 in Neuro-2a cell lysate.
Research Category
Signaling
Anti-Dach1, clone 1F6.1, Cat. No. MABS1805, is a mouse monoclonal antibody that detects Dach1 in human and murine cells and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in SHSY-5Y cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Dach1 in 10 µg of SHSY-5Y cell lysate.
Target description
~78 kDa observed; 78.68 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	1F6.1, monoclonal
species reactivity	human, mouse
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_004383,
UniProt accession no.	Q9UI36,
Gene Information	human ... DACH1(1602)

Diacylglycerol kinase alpha (UniProt: P23743; also known as EC:2.7.1.107, DAG kinase alpha, 80 kDa diacylglycerol kinase, Diglyceride kinase alpha, DGK-alpha) is encoded by the DGKA (also known as DAGK, DAGK1) gene (Gene ID: 1606) in human. Diacylglycerol kinase is a lipid kinase that converts diacylglycerol to phosphatidic acid, and regulates the activity of many enzymes including protein kinase C, phosphatidylinositol 4-phosphate 5-kinase, and mTOR. Thus far ten mammalian subtypes of DAG kinase have been reported. All DAG kinase with the exception of beta isoform are localized in cytoplasm in several cells, but some translocate to the plasma membrane upon activation. DAG kinase acts as a modulator, which competes with protein kinase C for diacylglycerol in intracellular signaling pathways. DAG kinase also plays a role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Most DAG kinases, with the exception of theta, contain two cysteine-rich regions (C1A and C1B domains) in the regulatory domain of the N-terminal half of the molecule. In DAK kinase alpha the C1 domain closest to the catalytic domain has an extended region of fifteen amino acids that is not present in C1 domains of other DAG kinases. DAG kinase alpha can be activated by the phosphorylation of Tyr335, which occurs during T cell activation or following exposure of cells to hepatocyte growth factor.
Specificity
Clone 10D6.1 detects DAG kinase alpha in human. It targets an epitope within the first 110 amino acids from the N-terminal region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DAG Kinase Alpha Antibody, clone 10D6.1

eCl@ss:	32160702
NACRES:	NA.41

GST/His-tagged recombinant fragment corresponding to the first 110 amino acids of human DAG kinase alpha.

Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected DAG Kinase Alpha in human tonsil and human breast cancer tissue.
Anti-DAG Kinase Alpha, clone 10D6.1, Cat. No. MABF1105, is a mouse monoclonal antibody that detects DAG kinase alpha. It has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in Jurkat cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected DAG Kinase Alpha in 10 µg of Jurkat cell lysate.
Target description
~83 kDa observed; 82.63 kDa calculaed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	10D6.1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_001336,
UniProt accession no.	P23743,
shipped in	ambient

Death domain-associated protein 6 (UniProt: Q9UER7; also known as Daxx, hDaxx, ETS1-associated protein 1, EAP1, Fas death domain-associated protein) is encoded by the DAXX (also known as BING2, DAP6) gene (Gene ID: 1616) in human. Daxx is a homomultimeric protein that is dispersed throughout the nucleoplasm, in PML/POD/ND10 nuclear bodies, and in nucleoli. It serves as a transcription corepressor that represses transcriptional potential of several sumoylated transcription factors. It down-regulates basal and activated transcription and its repressor activity is modulated by its recruitment to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively. It is reported to regulate transcription in PML/POD/ND10 nuclear bodies together with PML and may thereby influence TNFRSF6-dependent apoptosis. It also acts as an adapter protein in a MDM2-DAXX-USP7 complex by regulating the RING-finger E3 ligase MDM2 ubiquitination activity. Under non-stress conditions, in association with the deubiquitinating USP7, it prevents MDM2 self-ubiquitination and enhances the intrinsic E3 ligase activity of MDM2 towards TP53 that leads to TP53 ubiquitination and proteasomal degradation. However, upon DNA damage, its association with MDM2 and USP7 is disrupted, which results in increased MDM2 autoubiquitination and consequently, MDM2 degradation and TP53 stabilization. It also acts as targeting component of the chromatin remodeling complex ATRX:DAXX that has ATP-dependent DNA translocase activity and catalyzes the replication-independent deposition of histone H3.3 in pericentric DNA repeats. However, it does not affect the ATPase activity of ATRX, but alleviates its transcription repression activity.
Specificity
Clone DAXX5.14 specifically detects human Daxx. It targets an epitope with in 40 amino acids from the C-terminal half.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-Daxx Antibody, clone Daxx5.14

His-tagged recombinant fragment corresponding to 318 amino acids from the C-terminal half of human Daxx.

Anti-Daxx, clone Daxx5.14, Cat. No. MABE1911, is a highly specific mouse monoclonal antibody that targets Daxx and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunocytochemistry Analysis: A representative lot detected Daxx in Immunocytochemistry applications (Nefkens, I., et. al. (2003). J Cell Sci. 116(Pt 3):513-24; Ishov, A.M., et. al. (2002). J Virol. 76(15):7705-12).
Western Blotting Analysis: A representative lot detected Daxx in Western Blotting applications (Nefkens, I., et. al. (2003). J Cell Sci. 116(Pt 3):513-24).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human testis tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected Daxx in human testis tissue sections.
Target description
81.37 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	DAXX5.14, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001341,
UniProt accession no.	Q9UER7,

Serine/threonine-protein kinase DCLK1 (UniProt: O15075; also known as EC: 2.7.11.1, Doublecortin domain-containing protein 3A, Doublecortin-like and CAM kinase-like 1, Doublecortin-like kinase 1) is encoded by the DCLK1 (also known as DCAMKL1, DCDC3A, KIAA0369) gene (Gene ID: 9201) in human. DCLK1 is an integral component of plasma membrane and is highly expressed in fetal brain tissue and is also detectable in lung and liver. DCLK1 expression is reported to be critical for growth of human colon cancer cells and its expression is up-regulated in response to growth factors resulting in hyperproliferation. Both long (L) (~80-82 kDa) and short (S) (~45-50 kDa) isoforms of DCLK1 have been described. The long isoform of DCLK1 contains two N-terminal doublecortin domains, which bind microtubules, a C-terminal serine/threonine kinase domain with homology to CaM kinases, and a middle serine/proline rich domain that mediates protein interactions. The short isoform, DCLK1-S, has been reported in human colorectal cancer cells and in cancer stem cells, while normal colon cells express only the long isoform of DCLK1. The short isoforms lacks the two N-terminal doublecortin domains. Although DCLK1-S differs from the long isoform by only six amino-acids., this mono-specific antibody does not cross-react with the long isoform and is shown to specifically detect cancer stem cells. The short isoform is not a splice variant, but is expressed from an alternate beta promoter in intron V of the gene that results in the presence of the unique sequence of amino acids. These amino acids are absent in the long isoform, which is expressed by the alpha promoter in the 5’ region of the gene. It has been reported that the 5′ (alpha)-promoter of the human DCLK1 gene becomes epigenetically silenced during colon carcinogenesis, resulting in loss of expression of the canonical long isoform in human colorectal adenocarcinomas (hCRCs). Instead, hCRCs express the short isoform, DCLK1-S. Colon tumors and normal colons from mice only express the long isoform, since the epigenetics of colon carcinogenesis in mice is significantly different from that in humans. (Ref.: Sarkar, S et al. (2017). Lab. Invest. doi:10. 1038/labinvest.2017.40; Sarkar, S., et al. (2017). Mol. Cancer Res. doi: 10.1158/1541-7786.MCR-17-0287).
Specificity
This rabbit polyclonal antibody detects the short version of Serine/threonine-protein kinase DCLK1 (DCLK1-S). It does not react with long isoforms. It targets an epitope within six amino acids from the N-terminus region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DCLK1-S

eCl@ss:	32160702
NACRES:	NA.41

A multimeric scaffold of the 6 amino acids from the N-terminal region of the short version of human DCLK1 (DCLK1-S).

Anti-DCLK1-S, Cat. No. ABC1389, is a rabbit polyclonal antibody that specifically detects the short version of Serine/threonine-protein kinase DCLK1. It has been tested for use in Immunohistochemistry and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected DCLK1-S in Immunohistochemistry applications (Sarkar, S., et. al. (2017). Lab Invest. [Epub ahead of print]).
Western Blotting Analysis: A representative lot detected DCLK1-S in Western Blotting applications (Sarkar, S., et. al. (2017). Lab Invest. [Epub ahead of print]).
Quality
Evaluated by Western Blotting in HCT116 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected DCLK1-S in 10 µg of HCT116 cell lysate.
Target description
~55 kDa observed. 47.60 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001182345,
UniProt accession no.	O15075,
shipped in	ambient
Gene Information	human ... DCLK1(9201)

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-DCP1A antibody produced in rabbit

HPA013202 Human Protein Atlas characterization data

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50","indirect immunofluorescence: suitable
immunogen sequence	RSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSASA
conjugate	unconjugated
UniProt accession no.	Q9NPI6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... DCP1A(55802)

m7GpppN-mRNA hydrolase (UniProt: Q8IU60; also known as EC:3.6.1.62, Nucleoside diphosphate-linked moiety X motif 20, Nudix motif 20, mRNA-decapping enzyme 2, hDpc) is encoded by the DCP2 (also known as NUDT20) gene (Gene ID: 167227) in human. Dcp2 is a manganese-dependent decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. It removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5-phosphorylated mRNA fragment and 7m-GDP. Dcp2 contains a functional Nudix (nucleotide diphosphate linked to an X moiety) motif (aa 95-226) that is essential for its decapping activity. Two isoforms of Dcp2 have been described that are produced by alternative splicing. Dcp2 is reported to play a role in replication-dependent histone mRNA degradation. It has higher activity towards mRNAs that lack a poly(A) tail and does not display any activity towards a cap structure lacking an RNA moiety. Dcp2 is predominantly cytoplasmic, however, a small amount may also be found in the nucleus. Higher expression of Dcp2 has been reported in subjects with celiac disease with higher levels in the nuclear fraction. (Ref.: Wang, Z., et al. (2002). Proc. Natl. Acad. Sci. USA 99(20); 12663-12668; Castellanos-Rubio, A., et al. (2016). Science 352(6281); 91-95).
Specificity
This rabbit polyclonal antibody detects m7GpppN-mRNA hydrolase (Dcp2) in human and murine cells.

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Dcp2

eCl@ss:	32160702
NACRES:	NA.41

His-tagged full length recombinant human m7GpppN-mRNA hydrolase (Dcp2).
Epitope: unknown

Western Blotting Analysis: A representative lot detected Dcp2 in 293T KO, K562, 293T and MEF DCP 2 lysates (Courtesy of Dr. Mike Kiledjian at Rutgers University).
Western Blotting Analysis: A representative lot detected Dcp2 in Western Blotting applications (Castellanos-Rubio, A., et. al. (2016). Science. 352(6281):91-5; Li, Y., et. al. (2012). Mol Cell Biol. 32(6):1164-72; Jiao, X., et. al. (2006). Mol Cell. 24(5):713-22; Li, Y., et. al. (2008). Mol Cell Biol. 28(3):939-48; Song, M.G., et. al. (2010). Mol Cell. 40(3):423-32; Li, Y., et. al. (2012). Mol Cell Biol. 32(6):1164-72).
Research Category
Epigenetics & Nuclear Function
Anti-Dcp2, Cat. No. ABE2901, is a highly specific rabbit polyclonal antibody that targets m7GpppN-mRNA hydrolase / NUDT20 (Dcp2) and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in 293T control KO cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Dcp2 (NUDT20) in lysate from 293T control knockout cells, but did not react with Dcp2 knockout 293T cell lysate.
Target description
~51 kDa observed; 48.46 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Rabbit polyclonal antibody in serum with 0.05% sodium azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
antibody form	serum
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µL
application(s)	western blot: suitable
isotype	IgG
NCBI accession no.	NP_689837,
UniProt accession no.	Q8IU60,
Gene Information	human ... DCP2(167227)

Узнать цену

Подробнее

Anti-DDOST antibody produced in rabbit

HPA046841 Human Protein Atlas characterization data

dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87480,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	NYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQY
conjugate	unconjugated
UniProt accession no.	P39656,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... DDOST(1650)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DDX58 antibody produced in rabbit

HPA047193 Human Protein Atlas characterization data

DEAD (Asp-Glu-Ala-Asp) box polypeptide 58

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST89539,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL
immunogen sequence	NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
conjugate	unconjugated
UniProt accession no.	O95786,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... DDX58(23586)

Probable ATP-dependent RNA helicase DDX6 also known as DEAD box protein 6 or Oncogene RCK/p54, is a conserved member of the DEAD-box RNA helicase family. DDX6 plays a central role in P-body assembly in mammals and its depletion prevents P-body assembly leading to P-bodies disappearance.1 DDX6 coordinates RNA and ATP helicase binding activities and binds along the mRNA. DDX6 sequence specific binding at mRNA 5′ end, activates recruitment of the decapping complex, thus coupling translational repression and mRNA degradation.1-2partial human DDX6 recombinant protein
Specificity
Monoclonal Anti-DDX6 antibody specifically recognizes DDX6 from human, mouse, monkey, canine and bovine origin.

pictograms	GHS07
signalword	Warning
hcodes	H315 - H319
pcodes	P305 + P351 + P338
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DDX6 antibody, Mouse monoclonal

partial human DDX6 recombinant protein

The antibody may be used in various immunochemical techniques including Immunoblotting (~54 kDa) and Immunofluorescence. Detection of the DDX6 band by Immunoblotting is specifically inhibited by the immunogen.
Biochem/physiol Actions
DDX6 is considered to be a P-bodies marker due to its mediating role between translational repression and P-bodies formation and toits interaction with Ago2 and the RISC complex that also mediates translational silencing by miRNAs.1-4 Viruses like Hepatitis C virus (HCV) or West Nile virus (WNV) utilize the host cell DDX6 to promote virus infection by recruiting it to the viral replication sites where it is involved in stabilization of the viral genome and the shift between translation and replication.2,5-6DDX6 was reported to be overexpressed in colorectal adenocarcinomas, gastric cancer and in most malignant cell lines.7-9 It was suggested that DDX6 acted as an upstream cancerous enhancer through RNA-binding of HER2 and FGFR2 mRNAs that positively regulates post-transcriptional processes in cancer cells.7
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	DDX6-34, monoclonal
species reactivity	mouse, dog, rat, monkey, human, bovine
packaging	antibody small pack of 25 µL
concentration	~1 mg/mL
application(s)	immunoblotting: 1-2 µg/mL using human HeLa whole cell extract.","immunofluorescence: 10-20 µg/mL using human U-2-OS cells.
isotype	IgG1
UniProt accession no.	P26196,
shipped in	dry ice
storage temp.	20°C
Gene Information	Monkey ... DDX6(101053064) bovine ... DDX6(513906) dog ... DDX6(479414) human ... DDX6(1656) mouse ... DDX6(13209) rat ... DDX6(500988)

EGF-like repeat and discoidin I-like domain-containing protein 3 (UniProt: O43854; also known as Developmentally-regulated endothelial cell locus 1 protein, Integrin-binding protein DEL1, Del-1) is encoded by the EDIL3 (also known as DEL1) gene (Gene ID: 10085) in human. Del-1 is a calcium-dependent glycoprotein that is secreted by endothelial cells and is shown to be expressed in a developmentally restricted pattern during embryogenesis. In adult tissues it is expressed in endothelial cells and in macrophages. Del-1 is reported to prevent apoptosis in endothelial cell subjected to TNF alpha, etoposide, and anoikis treatment. This anti-apoptotic effect is shown to be mediated specifically through binding of integrin alphav beta3 by the RGD motif. Del-1 expression is reported to be inversely related to that of IL-17 that is shown to inhibit Del-1 via a GSK-3beta and C/EBPb-dependent mechanism. This inhibitory action can be reversed at the PI3K/Akt signaling induced by D-resolvins. It serves as an endothelial cell-secreted homeostatic factor that regulates local inflammation in several tissues. It is reported to interfere with beta2-integrin-dependent inflammatory cell adhesion to endothelium and restricts transendothelial migration of neutrophils. Del-1 is synthesized with a signal peptide (aa 1-23), which is subsequently cleaved off in the mature form. It has three EGF-like domains in its N-terminal region. EGF-like domains 2 and 3 form a rigid rod via an interdomain calcium ion binding site, while the long linker between EGF1 and EGF2 lends considerable flexibility to EGF1. Del-1 also has discoidin I-like domains at the C-terminal region that mediate its binding to phosphatidylserine. Two isoforms of Del-1 have been described that are produced by alternative splicing. (Ref.: Dasgupta, SK et al. (2012). Circulation 125 (13); 1664-1672; Wang, Z., et al. (2012). Surgery 151(2); 296-305; Maekawa, T et al. (2015). Nat. Commun. DOI: 10.1038/ncomms9272).
Specificity
Clone D345 detects human Developmentally-regulated endothelial cell locus 1 protein (Del-1).

Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Del-1 Antibody, clone D345

eCl@ss:	32160702
NACRES:	NA.41

GST-tagged full length human recombinant Developmentally-regulated endothelial cell locus 1 protein (Del-1).

Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected Del-1 in human cerebral cortex tissue sections.
ELISA Analysis: A representative lot detected Del-1 in ELISA applications (Dasgupta, S.K., et. al. (2012). Ciculation. 125(13):1664-72; Maekawa, T., et. al. (2015). Nat Commun. 6:8272).
Inhibition Analysis: A representative lot inhibited the uptake of BODIPY-labeled platelet microparticles by endothelium. (Dasgupta, S.K., et. al. (2012). Ciculation. 125(13):1664-72).
Western Blotting Analysis: A representative lot detected Del-1 in Western Blotting applications (Dasgupta, S.K., et. al. (2012). Ciculation. 125(13):1664-72).
Flow Cytometry Analysis: A representative lot detected Del-1 in Flow Cytometry applications (Dasgupta, S.K., et. al. (2012). Ciculation. 125(13):1664-72).
Research Category
Apoptosis & Cancer
Detects Del-1 using this Anti-Del-1, clone D345, Cat. No. MABS1976, is a mouse monoclonal antibody that detects Developmentally-regulated endothelial cell locus 1 protein (Del-1) and has been tested for use in ELISA, Flow Cytometry, Immunohistochemistry (Paraffin), Inhibition assay, & Western Blot.
Quality
Evaluated by Immunohistochemistry (Paraffin) in human pancreas tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected Del-1 in human pancreas tissue sections.
Target description
53.76 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Delta-like protein 1 (UniProt: Q61483; also known as Drosophila Delta homolog 1, Delta1, DLL1) is encoded by the Dll1 gene (Gene ID: 13388) in murine species. DLL1 is a single-pass transmembrane ligand protein of NOTCH1, NOTCH2 and NOTCH3 receptors that binds the extracellular domain (ECD) of Notch receptor in a cis and trans fashion manner. Following transinteraction, ligand cells produce mechanical force that promotes Notch receptor extracellular domain (NECD) transendocytosis and triggers Notch signaling. Delta1 is required for embryonic development and maintenance of adult stem cells in many different tissues. DLL1-induced Notch signaling plays a role in the regulation of cell lineage, cell specification, cell patterning, and morphogenesis through effects on differentiation and proliferation. DLL1 is reported to play a role in regulating neuronal differentiation of neural precursor cells via cell-cell interaction. DLL1 is reported to be co-expressed with DLL3 in the presomtic mesoderm of mouse embryo, however despite their co-expression, mutations in these proteins cause strikingly different effects. Heterozygous DLL1 mutant mice are lighter and smaller, with altered fat to lean ratio and display increased blood pressure and a slight bradycardia. They also exhibit reduced cholesterol and triglyceride levels in blood.
Specificity
Clone PGPM-1F9 specifically detects murine Delta Like protein 1. It targets an epitope within 17 amino acids from the C-terminal region.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	D345, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","inhibition assay: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_005702.3,
UniProt accession no.	O43854,
Gene Information	human ... EDIL3(10085)

Узнать цену

Подробнее

Anti-Delta-like protein 1 Antibody, clone PGPM-1F9

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 17 amino acids from the C-terminal half of murine Delta-like protein 1.

Anti-Delta-like protein 1 antibody, clone PGPM-1F9, Cat. No. MABN2284, is a highly specific rat monoclonal antibody that targets Delta-like protein 1 and has been tested in Flow Cytometry, Immunohistochemistry, and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected Delta-like protein 1 in Immunohistochemistry applications (Bone, R.A., et. al. (2014). Development. 141(24):4806-16).
Flow Cytometry Analysis: 1 µg from a representative lot detected Delta-like protein 1 in one million DLL1-flag A7A1/CHO cells expressing DLL1.
Western Blotting Analysis: A representative lot detected Delta-like protein 1 in Western Blotting applications (Geffers, I., et. al. (2007). J Cell Biol. 178(3):465-76).
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in DLL1-FLAG/CHO cell lysates.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Delta-like protein 1 in 10 µg of lysate from CHO cells stably expressing Flag-tagged Delta-like Protein 1.
Target description
~78 kDa observed; 78.45 calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	PGPM-1F9, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_031891,
UniProt accession no.	Q61483,
shipped in	ambient

Узнать цену

Подробнее

Anti-DENND5A antibody produced in rabbit

HPA052923 Human Protein Atlas characterization data

DENN/MADD domain containing 5A recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84912,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL
immunogen sequence	MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR
conjugate	unconjugated
UniProt accession no.	Q6IQ26,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... DENND5A(23258)

Desmin (UniProt: P17661) is encoded by the DES gene (Gene ID: 1674) in human. Desmin is a major class III intermediate filament protein essential for the structural integrity and function of muscle.
In adult striated muscle desmin forms a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures. It may also act as a sarcomeric microtubule-anchoring protein and specifically associate with detyrosinated tubulin-alpha chains, leading to buckled microtubules and mechanical resistance to contraction. Desmin is particularly abundant at the myotendinous junctions and at the neuromuscular junctions of skeletal muscle. Mammalian cardiac muscle cells contain higher amounts of desmin (up to 2% of total protein) compared to skeletal muscle cells (0.35% of total protein). Mutations in DES gene have been linked to familial cardiac and skeletal myopathy characterized by skeletal muscle weakness associated with cardiac conduction blocks, arrhythmias, and restrictive heart failure. It can also lead to myofibrillar destruction with intracytoplasmic accumulation of desmin-reactive deposits in cardiac and skeletal muscle cells. (rEF.: Denise Paulin, D., and Li, Z (2004). Experimental Cell Research 301(1); 1 -7).
Specificity
Clone 4C12.1 specifically detects Desmin in human, mouse, and rat muscles. It targets an epitope within 64 amino acids from the C-terminal end.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Desmin Antibody, clone 4C12.1

GST/His-taged recombinant fragment corresponding to 64 amino acids from the C-terminal region of human Desmin.

Anti-Desmin Antibody, clone 4C12.1, Cat. No. MABT535, is a mouse monoclonal antibody that targets Desmin in Human, Mouse, and Rat and it is tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Cell Structure
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Desmin in mouse heart, mouse skeletal muscle, rat heart, and rat skeletal muscle tissues.
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Desmin in human heart and human skeletal muscle tissues.
Quality
Evaluated by Western Blotting in human skeletal muscle tissue lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Desmin in 10 µg of human skeletal muscle tissue lysate.
Target description
~53 kDa observed; 53.53 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	4C12.1, monoclonal
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001918,
UniProt accession no.	P17661,
shipped in	ambient
Gene Information	human ... DES(1674)

Desmoglein-2 (UniProt: Q14126; also known as Cadherin family member 5, HDGC) is encoded by the DSG2 (also known as CDHF5) gene (Gene ID: 1829) in human. Desmogleins are protein substances located in and on the surface of keratinocytes. They are present in specialized cell-cell adhesion structures enriched in tissues that undergo substantial mechanical stress. These proteins have been shown to be a critical factor in cell-to-cell adhesion. Desmoglein-2 is a single-pass type I membrane protein that is found in all tissues and in carcinomas. It serves as a component of intercellular desmosome junctions. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. It is synthesized with a signal peptide (aa 1-23) and a propeptide (aa 24-49) that are cleaved off in the mature form. It contains an extracellular domain (aa 50-609), a transmembrane domain (aa 610-634), and a cytoplasmic domain (aa 635-1118). Mutations in DSG2 gene have been linked to familial type of arrhythmogenic right ventricular dysplalsia that is characterized y infiltration of adipose and fibrous tissue into the right ventricle and loss of myocardial cells, resulting in ventricular and supraventricular arrhythmias.
Specificity
Clone 6D8 specifically detects Desmoglein-2 in human cells.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Desmoglein 2 Antibody, clone 6D8

eCl@ss:	32160702
NACRES:	NA.41

Supernatant from cell membranes extract from A-431 cells.

Research Category
Cell Structure
Anti-Desmoglein 2, clone 6D8, Cat. No. MABT1507, is a mouse monoclonal antibody that detects Desmoglein-2 and has been tested for use in Flow Cytometry, Immunocytochemistry, Immunoprecipitation, Inhibition assays, and Western Blotting,
Flow Cytometry Analysis: A representative lot detected Desmoglein 2 in Flow Cytometry applications (Tan, L.Y., et. al. (2016). Oncotarget. 7(29):46492-46508).
Western Blotting Analysis: A 1:125 dilution from a repesentative lot detected Desmoglein 2 in HaCaT cell lysates.
Flow Cytometry Analysis: 1 µg from a representative lot detected Desmoglein2 in SK-MEL-28.
Western Blotting Analysis: A representative lot detected Desmoglein 2 in Western Blotting applications (Wahl, J.K. 3rd, et. al. (2002). Hybrid Hybridomics. 21(1):37-44).
Immunocytochemistry Analysis: A representative lot detected Desmoglein 2 in Immunocytochemistry applications (Wahl, J.K. 3rd, et. al. (2002). Hybrid Hybridomics. 21(1):37-44; Tan, L.Y., et. al. (2016). Oncotarget. 7(29):46492-46508).
Immunoprecipitation Analysis: A representative lot immunoprecipitated Desmoglein 2 in Immunoprecipitation applications (Wahl, J.K. 3rd, et. al. (2002). Hybrid Hybridomics. 21(1):37-44).
Inhibition Analysis: A representative lotinhibited the attachment of adenovirus (Ad) serotypes Ad3.(Wang, H., et. al. (2011). Nat Med. 17(1):96-104).
Quality
Evaluated by Immunocytochemistry in A431 cell line.
Immunocytochemistry Analysis: A 1:500 dilution of this antibody detected Desmoglein 2 in A431 cell line.
Target description
~165 kDa observed; 122.29 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Desmoglein-3 (UniProt: P32926; also known as 130 kDa pemphigus vulgaris antigen, PVA, Cadherin family member 6) is encoded by the DSG3 (also known as CDHF6) gene (Gene ID: 1830) in human. Desmogleins are protein substances located in and on the surface of keratinocytes. They are present in specialized cell-cell adhesion structures enriched in tissues that undergo substantial mechanical stress. These proteins have been shown to be a critical factor in cell-to-cell adhesion. Desmoglein-3 is a single-pass type I membrane protein that is a component of intercellular desmosome junctions. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. It is synthesized with a signal peptide (aa 1-23) and a propeptide (aa 24-49) that are cleaved off in the mature form. It contains an extracellular domain (aa 50-615), a transmembrane domain (aa 616-640), and a cytoplasmic domain (aa 641-999). Desmoglein-3 has four cadherin domains and two desmoglein repeats. This antibody (clone 5H10) recognized the extracellular domain of desmoglein-3.
Specificity
Clone 5H10 detects Desmoglein-3 in human cells. It targets an epitope with in the extracellular domain.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	6D8, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	flow cytometry: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","inhibition assay: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001934,
UniProt accession no.	Q14126,

Узнать цену

Подробнее

Anti-Desmoglein 3 Antibody, clone 5H10

Extracellular domain of Desmoglein 3
Epitope: extracellular domain

Research Category
Cell Structure
Immunoprecipitation Analysis: A representative lot detected Desmoglein 3 in Immunoprecipitation applications (Wahl, J.K. 3rd, et. al. (2002). Hybrid Hybridomics. 21(1):37-44).
Flow Cytometry Analysis: A representative lot detected Desmoglein 3 in Flow Cytometry applications (Wan, H., et. al. (2007). Stem Cells. 25(5):1286-97).
Western Blotting Analysis: A representative lot detected Desmoglein 3 in Western Blotting applications (Wahl, J.K. 3rd, et. al. (2002). Hybrid Hybridomics. 21(1):37-44).
Immunocytochemistry Analysis: A representative lot detected Desmoglein 3 in Immunocytochemistry applications (Wahl, J.K. 3rd, et. al. (2002). Hybrid Hybridomics. 21(1):37-44).
Immunofluorescence Analysis: A representative lot detected Desmoglein 3 in Immunofluorescnece applications (Wan, H., et. al. (2007). Stem Cells. 25(5):1286-97).
Anti-Desmoglein 3, clone 5H10, Cat. No. MABT1506, is a mouse monoclonal antibody that detects Desmoglein-3 and has been tested for use in Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in HaCaT cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Desmoglein 3 in HaCaT cell lysate.
Target description
~125 kDa observed; 107.53 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Desmoplakin (UniProt: P15924; also known as DP, 250/210 kDa paraneoplastic pemphigus antigen) is encoded by the DSP gene (Gene ID:1832) in human. Desmoplakin is a major high molecular weight homodimeric protein that is involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes, which are prominent adhesive junctions present between many epithelial cells and cardiomyocytes. Desmoplakin is the most abundant of the desmosomal proteins and plays a key role in tissue morphogenesis and maintaining the integrity of tissue. Desmoplakin is composed of an N-terminal plakin domain, a central alpha-helical coiled-coil rod domain, and a C-terminal intermediate filament-binding domain. The N-terminal domain is required for desmosome association and the C-terminal binds to desmin. Three isoforms for Desmoplakin have been reported that are produced by alternative splicing. Desmoplakin 2 and 3 lack most of the central rod domain. Desmoplakin 1 is the dominant isoform in the cardiac tissue. Desmoplakin is phosphorylated by protein kinase A on serine 2849 and this phosphorylation affects its association with epidermal, simple cytokeratins, and VIM intermediate filaments. Mutations in DSP gene have been linked to DCWHK (Cardiomyopathy, dilated, with woolly hair and keratoderma) that is characterized by a generalized striate keratoderma particularly affecting the palmoplantar epidermis, woolly hair, and dilated left ventricular cardiomyopathy. Mice deficient in Desmoplakin perish around the time of implantation (E6.5) and show fewer desmosomes.
Specificity
Clone 20B6 detects human Desmoplankin. It targets an epitope with in the C-terminal half.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	5H10, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunocytochemistry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001935,
UniProt accession no.	P32926,
Gene Information	human ... DSG3(1830)

Узнать цену

Подробнее

Anti-Desmoplakin Antibody, clone 20B6

eCl@ss:	32160702
NACRES:	NA.41

His-tagged recombinant fragment corresponding to 863 amino acids from the C-terminal half of human Desmoplakin.

Anti-Desmoplakin, clone 20B6, Cat. No. MABT1492, is a mouse monoclonal antibody that detects human Desmoplakin and has been tested for use in Immunocytochemistry and Western Blotting.
Western Blotting Analysis: A representative lot detected Desmoplakin in Western Blotting applications (Sobolik-Delmaire, T., et. al. (2006). J Biol Chem. 281(25):16962-70; Hall, C., et. al. (2009). Cell Commun Adhes. 16(1-3):15-27; Roberts, B.J., et. al. (2011). Exp Cell Res. 317(20):2814-22).
Immunocytochemistry Analysis: A representative lot detected Desmoplakin in Immunocytochemistry applications (Roberts, B.J., et. al. (2011). Exp Cell Res. 317(20):2814-22; Sobolik-Delmaire, T., et. al. (2006). J Biol Chem. 281(25):16962-70; Roberts, B.J., et. al. (2016). J Biol Chem. 291(48):24857-24865).
Quality
Evaluated by Immunocytochemistry in A431 cells.
Immunocytochemistry Analysis: A 1:500 dilution of this antibody detected Desmoplakin in A431 cells.
Target description
331.77 kDa calculated.
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	20B6, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001008844,
UniProt accession no.	P15924,

Monoclonal Anti-DFF45 (mouse IgG1 isotype) is derived from the hybridoma 3F12 produced by the fusion of mouse myeloma cells and splenocytes from immunized BALB/c mice.
The gene DNA fragmentation factor subunit (DFFA) is mapped to human chromosome 1p36.2. The encoded protein localizes to the chromatin fraction. It exists in association with DFF40, thereby forming a heterodimer. DFFA is popularly called as DFF45 (DNA fragmentation factor 45).
Specificity
Monoclonal Anti-DFF45 recognizes human DFF45 isoform 1 and isoform 2.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DFF45 antibody ,Mouse monoclonal

MDL number:	MFCD02096208
NACRES:	NA.41

human DFF45 recombinant protein

Anti-DFF45 antibody, Mouse monoclonal is suitable for immunoblotting.
Biochem/physiol Actions
DNA fragmentation factor subunit alpha (DFFA) is a component of DNA fragmentation factor (DFF). It is mainly associated with apoptosis and genomic stability. Caspase-3-mediated cleavage of DFFA releases DFF40 (DNA fragmentation factor 40) which degrades chromosomal DNA. During menstruation, the apoptosis of endometrium cells is associated with DFFA. Its expression decreases after menopause. Silencing of DFFA increases doxorubicin effects in breast cancer cells.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at -20 oC. For continuous use,the product may be stored at 2-8oCfor up to one month. For extended storage, freeze at -20oC in working aliquots. Repeated freezing and thawing,or storage in “frost-free” freezers,is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discardedif not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	3F12, monoclonal
form	buffered aqueous solution
mol wt	antigen ~37 kDa","antigen ~45 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	western blot: 1-2 µg/mL using whole extracts of human G361 cells
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	O00273,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... DFFA(1676)

DGCR8 (DGCR8 microprocessor complex subunit) is a double-stranded RNA-binding protein mapped to the chromosome 22q11.2. It is composed of a WW domain and two double-stranded RNA-binding domains (dsRBDs).

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DGCR8 (C-terminal) antibody produced in rabbit

Anti-DGCR8 (C-terminal) antibody produced in rabbit has been used in western blot assay to study the subcellular localization of KSRP (KH-type splicing regulatory protein) in RACK1 (receptor for activated protein kinase C)-knockdown cells. It has been used in Western blotting to study the phosphorylation status of TRBP (TAR RNA binding protein) in a study of glucose tolerance through inhibition of microRNA maturation in miRNA103 transgenic mice. Anti-DGCR8 (C-terminal) antibody produced in rabbit is also suitable for immunoprecipitation at a concentration of 2.5-5μg using lysates of HEK-293T cells over expressing human DGCR8, indirect immunofluorescence at the concentration of 2-5μg/mL using paraformaldehyde fixed HEK-293T cells over expressing human DGCR8 and western blot at a dilution of 1-2μg/mL using lysates of HEK-293T cells over expressing human DGCR8.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Biochem/physiol Actions
DGCR8 (DGCR8 microprocessor complex subunit) participates in the biogenesis of microRNA (miRNA, miR) as a major component of the microprocessor complex. DGCR8 provides guidance to the RNase III enzyme, Drosha during rRNA processing. It forms the microprocessor complex by binding to the RNase III enzyme Drosha, which further converts long primary miRNAs (pri-miRNAs) into short hairpins called precursor miRNAs (pre-miRNAs). The processed hairpins finally are transported to the cytoplasm for further processing by Dicer into mature miRNAs. DGCR8 is also required for global gene regulation and silencing of embryonic stem cell self-renewal. Deletion of DGCR8 chromosomal location has been reported in the DiGeorge and velocardiofacial syndrome.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~100 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	immunoprecipitation (IP): 2.5-5 µg using lysates of HEK-293T cells over expressing human DGCR8","indirect immunofluorescence: 2-5 µg/mL using paraformaldehyde fixed HEK-293T cells over expressing human DGCR8","western blot: 1-2 µg/mL using lysates of HEK-293T cells over expressing human DGCR8
conjugate	unconjugated
UniProt accession no.	Q8WYQ5,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... DGCR8(54487) mouse ... Dgcr8(94223)

DGCR8 contains an N-terminal region which is critical for nuclear localization and C-terminus which can directly and stably interact with the pri-mRNAs.
DGCR8 (DGCR8 microprocessor complex subunit) is a double-stranded RNA-binding protein mapped to the chromosome 22q11.2. It is composed of a WW domain and two double-stranded RNA-binding domains (dsRBDs).

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DGCR8 (N-terminal) antibody produced in rabbit

Anti-DGCR8 (N-terminal) antibody produced in rabbit is suitable for immunoprecipitation (2.5-5μg using lysates of HEK-293T cells over expressing human DGCR8), indirect immunofluorescence (2-5μg/mL using paraformaldehyde fixed HEK-293T cells over expressing human DGCR8) and western blot at a dilution of 1-2μg/mL (using lysates of HEK-293T cells over expressing human DGCR8).
Anti-DGCR8 (N-terminal) antibody produced in rabbit has been used in western blotting.
Anti-DGCR8 (N-terminal) antibody produced in rabbit has been used in:

western blotting
immunoprecipitation
immunofluorescence

Biochem/physiol Actions
DGCR8, also known as DiGeorge syndrome critical region 8, DGCRK8 is the cofactor that interacts with drosha and forms a functional complex called the ‘‘Microprocessor” which is essential for microRNA (miRNA) maturation. DGCR8 contains an N-terminal region which is critical for nuclear localization and the C-terminal region stably interacts with the pri-miRNAs.
DGCR8 (DGCR8 microprocessor complex subunit) participates in the biogenesis of microRNA (miRNA, miR) as a major component of the microprocessor complex. DGCR8 provides guidance to the RNase III enzyme, Drosha during rRNA processing. It forms the microprocessor complex by binding to the RNase III enzyme Drosha, which further converts long primary miRNAs (pri-miRNAs) into short hairpins called precursor miRNAs (pre-miRNAs). The processed hairpins finally are transported to the cytoplasm for further processing by Dicer into mature miRNAs. DGCR8 is also required for global gene regulation and silencing of embryonic stem cell self-renewal. Deletion of DGCR8 chromosomal location has been reported in the DiGeorge and velocardiofacial syndrome.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~100 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	immunoprecipitation (IP): 2.5-5 µg using lysates of HEK-293T cells over expressing human DGCR8","indirect immunofluorescence: 2-5 µg/mL using paraformaldehyde fixed HEK-293T cells over expressing human DGCR8","western blot: 1-2 µg/mL using lysates of HEK-293T cells over expressing human DGCR8
conjugate	unconjugated
UniProt accession no.	Q8WYQ5,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... DGCR8(54487) mouse ... Dgcr8(94223)

RNA interference (RNAi) is mechanism for post-transcriptional gene silencing that leads to the loss of the activity of the gene. RNAi is activated when long dsRNAs are cleaved by the enzyme Dicer1 (RNase III family of dsRNA-specific endonucleases) into 21-23 nucleotide siRNA (small interfering RNA). These siRNAs bind proteins to form the RISC (RNA-induced silencing complex) which is activated when the double stranded siRNAs are unzipped to single stranded siRNAs. Activated RISC recognizes and binds complementary sequences in mRNA. The mRNA is cleaved and the overall effect is an inhibition of the protein expression and a loss of the gene activity. Dicer1 along with the Argonaute family of proteins (Ago1 and Ago2) share the same domain PIWI and PAZ domain that provide endonuclease activity to RNA-induced silencing complexes (RISC).
Specificity
Human Dicer1

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Dicer1 Antibody, clone 5D12.2

eCl@ss:	32160702
NACRES:	NA.41

KLH conjugated synthetic peptide corresponding to amino acids 378-385 of human Dicer1

Western blot
Anti-Dicer1 Antibody, clone 5D12.2 is a Mouse Monoclonal Antibody for detection of Dicer1 also known as DCR1, Dicer, HERNA, KIAA0928 & has been validated in WB.
Research Category
Epigenetics & Nuclear Function
Research Sub Category
RNA Metabolism & Binding Proteins
RNA Binding Protein (RBP)
Quality
Routinely evaluated by western blot on lysates from HeLa nuclear extracts.
Target description
220 kDa
Physical form
Format: Purified
Protein G Chromatography
Storage and Stability
Maintain at 2-8°C in undiluted aliquots for up to 6 months after date of receipt.

feature_concentration_valuePlease refer to lot specific datasheet.

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

KLH-conjugated linear peptide corresponding to 15 amino acids from the N-terminal region of human Dickkopf-2 protein.

Quality Level	100
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	5D12.2, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
Торговая марка	Upstate^®
application(s)	western blot: suitable
isotype	IgG1
NCBI accession no.	NP_085124.2,
UniProt accession no.	Q9UPY3,
shipped in	ambient
Gene Information	human ... DICER1(23405)

Узнать цену

Подробнее

Anti-DKK2 Antibody, clone 5F8

Anti-DKK2, clone 5F8, Cat. No. MABC1102, is a mouse monoclonal antibody that detects Dickkopf-related protein 2 and has been tested for use in ELISA, Inhibits Activity/Function, and Western Blotting.
Inhibits Activity/Function Analysis: A representative lot inhibited DKK2-mediated, but not DKK1-mediated, antagonism of Wnt activation. (Xiao, Q., et. al. (2018). Nat Med. 24(3):262-270).
ELISA Analysis: A representative lot detected DKK2 in ELISA applications (Xiao, Q., et. al. (2018). Nat Med. 24(3):262-270).
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in human heart tissue lysates.
Western Blotting Analysis: A 1:250 dilution of this antibody detected DKK2 in human heart tissue lysates.
Target description
~38 kDa observed; 28.45 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	5F8, monoclonal
species reactivity	human
species reactivity (predicted by homology)	monkey (based on 100% sequence homology)
packaging	antibody small pack of 25 µL
application(s)	ELISA: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_055236.1,
UniProt accession no.	Q9UBU2,
Gene Information	human ... DKK2(27123)

Deleted in liver cancer 1 (DLC1) is a Rho-GTPase activating protein. The gene encoding it is located on chromosome 8p22. DLC-1 possesses a Rho GTPase-activating (RhoGAP) domain, a sterile α motif (SAM) domain and a StAR-related lipid-transfer (START) domain.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DLC1 antibody produced in rabbit

MDL number:	MFCD01634006
Human Protein Atlas Number:	HPA017753 Human Protein Atlas characterization data

DLC1 Rho GTPase activating protein

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Deleted in liver cancer 1 (DLC1) suppresses cell growth and invasion in cancers and thus functions as a tumor-suppressor gene. It also induces cell apoptosis by controlling cyclin D1 expression. DLC1 interacts with the tensin family of proteins and hence plays a role in the cytoskeletal organization of cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72690,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000
immunogen sequence	RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
conjugate	unconjugated
UniProt accession no.	Q96QB1,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... DLC1(10395)

DNA G-quadruplex structures are associated with a number of important aspects of genome function, which include transcription, recombination and replication. Single-stranded guanine (G)-rich DNA can form stable secondary structures called G-quadruplexes (G-tetrads or G4), which can influence methylation at CpG islands (CGIs). G4 structure is reported to be tightly associated with CGI hypomethylation in the human genome. Four guanine bases can associate through Hoogsteen hydrogen bonding to form a square planar structure called a guanine tetrad (G-tetrad), and two or more G-tetrads can stack on top of each other to form a G-quadruplex. The quadruplex structure is further stabilized by the presence of a cation, especially potassium, which sits in a central channel between each pair of tetrads. A DNA G-tetrad can be formed within one DNA strand (intramolecular), between two DNA strands (bimolecular), or four DNA strands (tetramolecular). G4 DNA can arise anywhere in the genome where sufficiently long stretches of single-stranded G-rich DNA are exposed during replication, transcription or recombination. Chemical analysis of quadruplex-forming oligonucleotides has revealed the existence of a plethora of dynamic quadruplex structures with varying stabilities. The diverse nature of G4 DNA structures makes it an attractive topic in molecular biomedical research.(Ref.: Mao, SQ et al., (2018). Nat. Struc. Mol. Biol. 25(10); 951-957).
Specificity
Clone BG4 has a high affinity for intramolecular and intermolecular DNA G-quadruplexes with no detectable binding to a RNA hairpin, single-stranded DNA or double-stranded DNA.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DNA G-quadruplex structures Antibody, clone BG4

G-quadruplex oligonucleotides.

Anti-DNA G-quadruplex structures, clone BG4 Antibody, Cat. No. MABE917, is a highly specific monoclonal antibody that targets DNA G-quadruplex structures and has been tested in and ELISA, ChIP-seq, and Immunocytochemistry.
ELISA Analysis: A representative lot detected DNA G-quadruplex structures in Anti-DNA G-quarduplex structures, BG4 (Courtesy of University of Cambridge).
ChIP-seq Analysis: A representative lot detected DNA G-quadruplex structures in ChIP-seq applications (Hansel-Hertsch, R., et. al. (2016). Nat Genet. 48(10):1267-72).
ELISA Analysis: A representative lot detected DNA G-quadruplex structures in ELISA applications (Biffi, G., et. al. (2013). Nat Chem. 5(3):182-6).
Immunocytochemistry Analysis: A representative lot detected DNA G-quadruplex structures in Immunocytochemistry applications (Biffi, G., et. al. (2013). Nat Chem. 5(3):182-6).
Quality
The Anti-DNA-G-quadruplex structures, clone BG4 antibody (Cat. No. MABE917) was resolved by SDS-PAGE, transferred to PVDF membrane and probed with Anti-FLAG epitope tag antibody (MAB3118).
Physical form
Purified monoclonal antibody in PBS with 0.05% sodium azide.
Format: Purified

Concentration: Please refer to lot specific datasheet.

biological source	Escherichia coli
Quality Level	100,
antibody form	purified antibody
antibody product type	primary antibodies
clone	BG4, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	ChIP: suitable (ChIP-seq), ELISA: suitable, immunocytochemistry: suitable
shipped in	ambient

DNA helicase B (UniProt: Q8NG08; also known as EC: 3.6.4.12, hDHB) is encoded by the HELB gene (Gene ID: 92797) in human. DNA helicase B is highly expressed in testis and thymus and weaker expression is observed in liver, spleen, kidney, and brain. It is predominantly nuclear, however, following phosphorylation at serine 967 by CDK2 during the G1/S transition it is exported into the cytoplasm. Following DNA damage, it is recruited to sites of double-strand breaks by the RPA complex. Its recruitment to single-stranded DNA following DNA damage leads to inhibition of nucleases catalyzing resection, such as EXO1, BLM and DNA2, possibly via the 5-3 ssDNA translocase activity of HELB. As cells approach S phase, DNA end resection is promoted by the nuclear export of HELB following its phosphorylation. Its nuclear export signal is localized to amino acids 1055-1078. It uses either magnesium or manganese ions to support its helicase activity and the DNA helicase B activity is inhibited by salt concentrations higher than 100 mM. It binds strongly to single-stranded DNA in the absence of ATP, but dissociates readily in the presence of 1 mM ATP. Two isoforms of DNA helicase B have been reported that are produced by alternative splicing.
Specificity
This rabbit polyclonal antibody specifically detects DNA helicase B in human cells.

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DNA helicase B (HELB)

MBP-conjugated recombinant fragment corresponding to the first 199 amino acids from the N-terminal region of human DNA helicase B.
Epitope: N-terminus

Research Category
Epigenetics & Nuclear Function
Western Blotting Analysis: A representative lot detected DNA helicase B (HELB) in U2OS cells transfected with a non-targeting siRNA (CTRL) or siRNAs targeting protein and HeLa cells transfected with non-targeting (siCTRL) or HELB-targeting (siHELB) siRNAs (Tkac, J., et. al. (2016). Mol Cell. 61(3):405-418).
Anti-DNA helicase B (HELB) Antibody, Cat. No. ABE2601, is a highly specific rabbit polyclonal antibody that targets DNA helicase B (HELB) and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in siRNA control & siRNA HELB U2OS cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected DNA helicase B (HELB) in lysate from U2OS cells treated with non-targeting siRNA, but not in lysates from siRNA HELB treated U2OS cells.
Target description
~145 kDa observed; 123.25 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

DNA (cytosine-5)-methyltransferase 1 (UniProt: P26358; also known as EC: 2.1.1.37, Dnmt1, CXXC-type zinc finger protein 9, DNA methyltransferase HsaI, DNA MTase HsaI, M.HsaI, MCMT) is encoded by the DNMT1 (also known as AIM, CXXC9, DNMT) gene (Gene ID: 1786) in human. Dnmt1 is an important epigenetic regulator that plays a key role in the maintenance of DNA methylation. Dnmt1 is a homodimeric protein that is ubiquitous in its expression. It is highly expressed in fetal tissues and in heart, kidney, placenta and peripheral mononuclear cells. Its abundance is reduced to almost non-detectable levels at the G0 phase of the cell cycle and is dramatically induced upon entrance into the S-phase of the cell cycle. Its expression is regulated by many signaling pathways, including PI3/Akt, Rb/E2F and p53/SP1. Dnmt1 is shown to preferentially methylate hemimethylated DNA and it associates with DNA replication sites in the S phase to maintain the methylation pattern in newly synthesized strand, which is essential for epigenetic inheritance. Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is also responsible for maintaining methylation patterns established in development. Dnmt1 can undergo acetylation on multiple lysines mainly by KAT2B/PCAF. It can be phosphorylated on Serine 154 by Cdks and this phosphorylation is considered to be essential for its enzymatic activity and protein stability. Its phosphorylation on Serine 143 by Akt1 is reported to prevent methylation by SETD7, which increases its stability. Mutations in DNMT1 gene are reported to cause hereditary sensory neuropathy that is characterized by adult onset of progressive peripheral sensory loss associated with progressive hearing impairment and early-onset dementia.
Specificity
This rabbit polyclonal antibody specifically detects DNA (cytosine-5)-methyltransferase 1 acetylated on four lysine residues from the C-terminal half containing six tandem repeats of K-G.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG
NCBI accession no.	NP_387467,
UniProt accession no.	Q8NG08,

Узнать цену

Подробнее

Anti-DNMT1 Antibody, Ac-4K

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 11 amino acids from the C-terminal half with acetylated K1111, 1113, 1115, and 1117.

Anti-DNMT1, Ac-4K, Cat. No. ABE1956, is a highly specific rabbit polyclonal antibody that targets DNA (cytosine-5)-methyltransferase 1 (DNMT1) and has been tested for use in Dot Blot, Immunocytochemistry, and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected DNA (cytosine-5)-methyltransferase 1 (DNMT1) in 293T cells transfected with pcmv-Tag2B-DNMT1 (Courtesy of an Independent Researcher).
Immunocytochemistry Analysis: A representative lot detected DNA (cytosine-5)-methyltransferase 1 (DNMT1) in Immunocytochemistry applications (Cheng, J., et. al. (2015). Nat Commun. 6:7023).
Dot Blot Analsysi: A representative lot detected DNA (cytosine-5)-methyltransferase 1 (DNMT1) in Dot Blot applications (Cheng, J., et. al. (2015). Nat Commun. 6:7023).
Western Blotting Analysis: A representative lot detected DNA (cytosine-5)-methyltransferase 1 (DNMT1) in Western Blotting applications (Cheng, J., et. al. (2015). Nat Commun. 6:7023).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Dot Blot in DNMT1-Control peptide & DNMT1-4Ac peptide.
Dot Blot Analysis: A 1:500 dilution of this antibody detected DNA (cytosine-5)-methyltransferase 1 with acetylated Lysine 1111, 1113, 1115, and 1117.
Target description
~200 kDa observed; 183.16 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in PBS with 0.02% sodium azide and 50% glycerol.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

DNA (cytosine-5)-methyltransferase 3B (Dnmt3B) is one of three mammalian enzymes that catalyze the addition of a methyl group to the 5’ carbon of cytosine residues in CpG dinucleotides. The Dnmt3b enzyme is involved in de novo methylation and the establishment of genome-wide DNA methylation patterns during development. DNA methylation has been linked to chromosome stability and gene expression in somatic cells; and to parental imprinting and X-chromosome inactivation in germ cells. Several studies have indicated that DNA methylation patterns are altered in various cancers.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
species reactivity (predicted by homology)	rat (based on 100% sequence homology), mouse (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	dot blot: suitable","immunocytochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001370,
UniProt accession no.	P26358,
Gene Information	human ... DNMT1(1786)

Узнать цену

Подробнее

Anti-Dnmt3b Antibody, clone D3B2-2C1

eCl@ss:	32160702
NACRES:	NA.41

Linear peptide corresponding to human Dnmt3b.

Immunoprecipitation Analysis: A representative lot was used by an independent laboratory to immunoprecipitate Dnmt3b in IP (Felle, M., et al. (2011). Nucleic Acids Res. 39(19):8355-8365.).
Research Category
Epigenetics & Nuclear Function
Anti-Dnmt3b Antibody, clone D3B2-2C1 is a Rat Monoclonal Antibody for detection of Dnmt3b also known as DNA (cytosine-5)-methyltransferase 3B & has been validated in WB & IP.
Research Sub Category
Chromatin Biology
Quality
Evaluated by Western Blot in HeLa nuclear extract.
Western Blot Analysis: 0.5 µg/mL of this antibody detected Dnmt3b in 10 µg of of HeLa nuclear extract.
Target description
~110 kDa observed. Multiple isoforms between ~80-96 kDa are known to exist. A truncated protein at ~40 kDa may be observed in some cell lysates (Ostler, K. R., et al. (2007). 26(38): 5553-5563.). Uncharacterized bands may be observed at ~20 kDa and ~34 kDa in some cell lysates.
Physical form
Protein G Purified
Format: Purified
Purified rat monoclonal IgG2bκ in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
HeLa nuclear extract

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	D3B2-2C1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001193984,
UniProt accession no.	Q9UBC3,
shipped in	wet ice
storage temp.	2-8°C

DNA (cytosine-5)-methyltransferase 3-like (UniProt: Q9CWR8; also known as DNMT3L) is encoded by the Dnmt3l gene (Gene ID: 54427) in murine species. DNMT3L is a catalytically inactive regulatory factor of DNA methyltransferases that can either promote or inhibit DNA methylation depending on the context.
It is shown to be essential for the function of DNMT3A and DNMT3B. It activates DNMT3A and DNMT3B by binding to their catalytic domain. It acts by accelerating the binding of DNA and S-adenosyl-L-methionine (AdoMet) to the methyltransferases and dissociates from the complex after DNA binding to the methyltransferases. DNMT3L recognizes unmethylated histone H3 lysine 4 (H3K4me0) and induces de novo DNA methylation by recruitment or activation of DNMT3. In germ cells, it is required for the methylation of imprinted loci together with DNMT3A. In male germ it is essential for the methylation of retrotransposons, which prevents their mobilization. DNMT3A also plays a key role in embryonic stem cells (ESCs) by acting both as a positive and negative regulator of DNA methylation. It promotes DNA methylation of housekeeping genes together with DNMT3A and DNMT3B. It can also serve as an inhibitor of DNA methylation at the promoter of bivalent genes. It is reported to promote differentiation of ESCs into primordial germ cells by inhibiting DNA methylation at the promoter of RHOX5, thereby activating its expression. In testicular cells it is first observed in non-dividing prospermatogonia after 12.5 dpc and its level reaches its highest at about the time of birth and then rapidly declines and is non-detectable six days postpartum when most of the prospermatognia are differentiated into dividing spermatogonial stem cells.
Specificity
This rabbit polyclonal antibody detects Dnmt3l in murine cells.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DNMT3L

eCl@ss:	32160702
NACRES:	NA.41

His-tagged full length (421 aa) murine recombinant DNA (cytosine-5)-methyltransferase 3-like (DNMT3L).
Epitope: unknown

Western Blotting Analysis: A representative lot detected Dnmt3l in undifferentiated J1 mouse embryonic stem cells (Nimura, K., et. al. (2006). Genes Cells. 11(10):1225-37).
Immunofluorescence Analysis: A representative lot detected Dnmt3l in mouse testes (Nimura, K., et. al. (2006). Genes Cells. 11(10):1225-37) and XY germ cells at E15.5 (Kato, Y., et. al. (2016). Nat Commun. 7:11272).
Immunocytochemistry Analysis: A representative lot detected Dnmt3l in undifferentiated J1 mouse embryonic stem cells (Nimura, K., et. al. (2006). Genes Cells. 11(10):1225-37).
Anti-DNMT3L, Cat. No. ABE2910, is a highly specific rabbit polyclonal antibody that targets DNA (cytosine-5)-methyltransferase 3-like and has been tested in Immunocytochemistry, Immunofluorescence, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in mouse embryonic stem cell lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected Dnmt3l in 10 µg of mouse embryonic stem cell lysate.
Target description
~50 kDa observed; 47.99 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse
packaging	antibody small pack of 25 µL
application(s)	immunocytochemistry: suitable","immunofluorescence: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_062321,
UniProt accession no.	Q9CWR8,
shipped in	ambient

Monoclonal Anti-DOCK9 (Zizimin1) (mouse IgG2a isotype) is derived from the hybridoma 8B3-C3-E4 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice. Zizimin1 is a guanine nucleotide exchange factor (GEF) specific to Cdc42. It is a part of the second family of mammalian Rho-GEFs, CZH [CDM (Ced-5/DOCK180/Myoblast city)-zizimin homology] proteins. The Zizimin1 protein contains the CZH2 domain, CZH1 domain and Pleckstrin homology (PH) domain.
Specificity
Monoclonal Anti-DOCK9 (Zizimin1) recognizes human DOCK9.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DOCK9 (Zizimin 1) antibody, Mouse monoclonal

full length DOCK9 (Zizimin1)

Anti-DOCK9 (Zizimin 1) antibody, Mouse monoclonal is suitable for:

immunoblotting
immunoprecipitation
immunocytochemistry
immunohistochemistry

Biochem/physiol Actions
Zizimin1/ dedicator of cytokinesis 9 (DOCK9) is found to activate Cdc42 through binding to its CZH2 domain. Interestingly, the CZH1 domain of Zizimin1 at the N-terminal binds to its CZH2 domain and thus inhibits Cdc42 binding. The Pleckstrin homology (PH) domain at the N-terminal, binds phosphoinositides and results in zizimin1 membrane targeting.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at -20 °C. For continuous use, the product may be stored at 2-8 °C for up to one month. For extended storage, freeze in working aliquots at -20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	8B3-C3-E4, monoclonal
form	buffered aqueous solution
mol wt	antigen ~236 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 3.0-6.0 µg/mL using MDA-MB-231 cell extracts
conjugate	unconjugated
UniProt accession no.	Q9BZ29,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... DOCK9(23348)

Specificity
Dopamine b-HydroxylaseDBH is a single gene product that exists as a cytosolic enzyme, as a membrane protein and is secreted into the circulation (Lewis & Asnani, 1992). Because of its residence time as a plasma membrane-bound protein, it is able to be used as a targeting agent for neurons. The target neurons include postganglionic sympathetic neurons and all noradrenergic and adrenergic neurons of the central nervous system. As such anti-DBH-SAP can be used for the production of acute peripheral autonomic failure in a model for the human disease. It can also be used for the analysis of the behavioral effects of noradrenergic or adrenergic ablation. When injected intraventricularly, noradrenergic neurons of the locus coeruleus are eliminated (Wiley & Lappi, 1994). The antibody and immunotoxin undergo retrograde transport.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Dopamine Hydroxylase-SAP Antibody, clone 4F10.2

eCl@ss:	32160702
NACRES:	NA.41

Кат. номер

MAB394-250UG

MAB394-25UG

Anti-Dopamine β Hydroxylase-SAP Antibody, clone 4F10.2 detects level of Dopamine β Hydroxylase & has been published & validated for use in 0.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Zinc finger protein ubi-d4 (UniProt: Q92785; also known as Apoptosis response zinc finger protein, BRG1-associated factor 45D, BAF45D, D4, zinc and double PHD fingers family 2, Protein requiem, DFP2) is encoded by the DPF2 (also known as BAF45D, REQ, UBID4) gene (Gene ID: 5977) in human. BAF45D is a member of the requiem/DPF protein family and is ubiquitously expressed. It may serve as a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. It is also believed to have a role in the development and maturation of lymphoid cells. It contains 3 zinc-finger domains (C2H2-type aa 209-232; PHD type I aa 270-330; and PHD type 2 aa 327-377). Two isoforms of BAF45D have been described that are generated via alternative splicing.
Specificity
This rabbit polyclonal antibody detects BRG1-associated factor 45D in human, mouse, and rat species. It targets an epitope within 17 amino acids from the N-terminal half. The immunogen sequence is conserved in both isoforms.

Quality Level	100
biological source	mouse
antibody product type	primary antibodies
clone	4F10.2, monoclonal
species reactivity	rat
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	immunolesioning: suitable
isotype	IgG1
conjugate	saporin
NCBI accession no.	NM_000787.3,
UniProt accession no.	P09172,
shipped in	wet ice

Узнать цену

Подробнее

Anti-DPF2

KLH-conjugated liner peptide that corresponding to 17 amino acids from the N-terminal region of human BRG1-associated factor 45D (DPF2).

Western Blotting Analysis: 2 µg/mL from a representative lot detected DPF2 in 10 µg of PC12 cell lysate.
Immunocytochemistry Analysis: A 1:100-500 dilution from a representative lot detected DPF2 in A431 and HepG2 cells.
Anti-DPF2, Cat. No. ABE1327, is a highly specific rabbit polyclonal antibody that targets BRG1-associated factor 45D and has been tested in Immunocytochemistry and Western Blotting.
Quality
Evaluated by Western Blotting in NIH3T3 cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected DPF2 in 10 µg of NIH3T3 cell lysate.
Target description
~44 kDa observed; 44.15 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_006259.1,
UniProt accession no.	Q92785,
Gene Information	human ... DPF2(5977)

Glutathione S-transferase kappa 1 (UniProt: Q9DCM2; also known as EC:2.5.1.18, GST 13-13, GST class-kappa, GSTK1-1, mGSTK1, Glutathione S-transferase subunit 13, DsbA-L) is encoded by the Gstk1 gene (Gene ID: 76263) in murine species. DsbA-L is a disulfide bond A oxidoreductase like homodimeric mitochondrial protein that is predominantly expressed in heart, kidney, liver and skeletal muscle. It is also highly expressed in adipose tissue and its expression level is negatively correlated with obesity in mice and humans. Overexpression of DsbA-L is shown to promote adiponectin multimerization. Suppression of DsbA-L expression can selectively reduce adiponectin levels and secretion in 3T3-L1 adipocytes. Expression of DsbA-L in 3T3-L1 adipocytes is shown to be stimulated by the insulin sensitizer rosiglitazone and inhibited by TNFalpha. Adiponectin expression is reduced in both human obesity and mouse models of genetic obesity. DsbA-L is also shown to co-localize with the endoplasmic reticulum (ER) marker protein disulfide isomerase and it interacts with the ER chaperone protein Ero1-L in 3T3-L1 adipocytes. Deletion of the first 6 amino acid residues at the N terminus greatly impaired DsbA-L localization in the ER. (Ref.: Liu, M et al. (2015). J Biol Chem. 290(16):10143-8).
Specificity
This rabbit polyclonal antibody detects DsbA-L (Glutathione S-transferase kappa 1) in human and mouse cells.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DsbA-L

eCl@ss:	32160702
NACRES:	NA.41

Myc-tagged full length recombinant protein from mouse.
Epitope: unknown

Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected DsbA-L in A431, HUVEC, NIH/3T3 cells.
Western Blotting Analysis: A representative lot detected DsbA-L in mouse brain, mouse kidney, and mouse liver (Liu, M., et. al. (2008). Proc Natl Acad Sci USA. 105(47):18302-7; Lui, M., et. al. (2015). J Biol Chem. 290(16):10143-8).
Immunoprecipitation Analysis: A representative lot detected DsbA-L in 3T3-L1 adipocytes (Liu, M., et. al. (2008). Proc Natl Acad Sci USA. 105(47):18302-7; Lui, M., et. al. (2015). J Biol Chem. 290(16):10143-8).
Immunocytochemistry Analysis: A representative lot detected DsbA-L in adipocytes on differentiation day 7 were used for the following studies. confocal immunofluorescence study of DsbA-L co-localization with the mitochondrial marker (MitoTracker) and the ER marker (PDI) in 3T3-L1 adipocytes (Lui, M., et. al. (2015). J Biol Chem. 290(16):10143-8).
Research Category
Signaling
Anti-DsbA-L, Cat. No. ABS1644, is a rabbit polyclonal antibody that detects Glutathione S-transferase kappa 1 (DsbA-L) and is tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in mouse kidney tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected DsbA-L in 10 µg of mouse kidney tissue lysate.
Target description
~28 kDa observed; 25.70 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide with 20% glycerol.
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide with 20% glycerol.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µL
application(s)	immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_083831,
UniProt accession no.	Q9DCM2,
shipped in	ambient

Red fluorescent protein drFP583 (UniProt: Q9U6Y8; also known as DsRed) is a fluorescent protein that serves as a useful and ubiquitous tool for making chimeric proteins, where it can function as a fluorescent protein tag. Fluorescent proteins serve as useful tools for making chimeric proteins and function as fluorescent protein tag. They can tolerate N- and C-terminal fusion to a broad variety of proteins. DsRed is a stable homotetrameric protein with high quantum yield and is derived from coral Discosoma. It is an 11-stranded beta-can with a central alpha-helix and its each monomer is structurally similar to GFP. DsRed has an orange-red fluorescence and is excited optimally at 558 nm, but can also be excited by a standard 488 nm laser, allowing it to be used with laser-based confocal microscopes and flow cytometers. DsRed offers stability to changes in external pH and its spectral properties are ideal for dual-color experiments with green fluorescent protein (Ref.: Bevis, BJ., and Glick, BS (2002). Nat. Biotech. 20; 83-87).
Specificity
This rabbit polyclonal antibody detects Red fluorescent protein drFP583. It targets an epitope within 6 amino acids from the N-terminal region.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-DsRed (RFP)

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 6 amino acids from the N-terminal region of Red fluorescent protein drFP583 from Discosoma sp. (Sea anemone).
Epitope: N-terminus

Research Category
Secondary & Control Antibodies
Western Blotting Analysis: A representative lot detected DsRed (RFP) in Western Blotting applications (Aihara, H., et. al. (2016). Mol Cell. 64(1):176-188).
Western Blotting Analysis: A 1:200 dilution of a representative lot detected DsRed (RFP) in whole cell lysate from 293T cell expressing HcRed & DsRed-mouse USP21 fusion protein. (Courtesy of Dr. Ito Takashi at Nagasaki University).
Anti-DsRed (RFP) is a rabbit polyclonal antibody that detects Red fluorescent protein DsRed and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in whole cell lysate from 293T cell expressing DsRed-mouse USP21 fusion protein.
Western Blotting Analysis: 1 µg/mL of this antibody detected DsRed (RFP) in whole cell lysate from 293T cell expressing DsRed-mouse USP21 fusion protein.
Target description
~100 kDa observed; 25.93 kDA calculated. (Observed molecular weight includes USP21 (~63KDa). Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 50 mM KCL, 25 mM HEPES (pH 7.6), 10% glycerol, 0.1 mM EDTA, 0.01% NP40.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity (predicted by homology)	all (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG
UniProt accession no.	Q9U6Y8,

Double-stranded RNA (dsRNA) is a viral product that induces innate immunity, leading to the production of interferon (IFN) alpha and beta, which can lead to the activation of hundreds of IFN-stimulated genes that confer resistance to viruses. dsRNA of more than 30-bp length are reported to be is a key activator of the innate immune response against viral infections. dsRNA is produced by positive-strand RNA viruses, dsRNA viruses, and DNA viruses. However, negative-strand RNA viruses are not shown to generate any significant dsRNA signals. The interaction of the host cell with dsRNA can occur in several ways. Mainly, specific receptors activate the synthesis of IFN alpha and beta, antiviral proteins, and dsRNA-activated enzymes that can block viral replication. dsRNA replication is shown to occur in the cytoplasm for all dsRNA viruses. This dsRNA-specific mouse monoclonal antibody specifically recognizes dsRNA of more than 40-bp length. Clone rJ2 has been used to detect dsRNA intermediates of multiple types of viruses, including Hepatitis C virus, Dengue virus, rhinovirus, Chikungunya virus, Rabies virus, and Polio virus in biological samples. It can be useful in understanding how anti-viral responses are initiated and what how viruses overcome and avoid these antiviral therapies.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-dsRNA Antibody, clone rJ2

Specificity

Clone rJ2 specifically recognizes double stranded RNA (dsRNA) of greater than 40 bp in length that is generated during the replication of positive sense genome viruses.

Double stranded RNA produced by positive sense genome viruses.

Anti-dsRNA, clone rJ2, Cat. No. MABE1134, is a mouse monoclonal antibody that detects double stranded RNA (dsRNA) and has been tested for use in Immunocytochemistry and Immunofluorescence.
Immunofluorescence Analysis: A representative lot detected dsRNA in Immunofluorescent applications (Savidis, G., et. al. (2016). Cell Rep. 15(11):2323-30; Savidis, G., et. al. (2016). Cell Rep. 16(1):232-246).
Research Category
Inflammation & Immunology

Quality

Evaluated by Immunocytochemistry in Dengue virus infected A549 cells.
Immunocytochemistry Analysis: A 1:60 dilution of this antibody detected dsRNA in Dengue virus infected A549 cells.

Physical form

Unpurified
Mouse monoclonal antibody in supernatant without preservatives.

Storage and Stability

Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Concentration: Please refer to lot specific datasheet.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	mouse
antibody form	culture supernatant
antibody product type	primary antibodies
clone	rJ2, monoclonal
species reactivity	virus
packaging	antibody small pack of 25 μL
application(s)	immunocytochemistry: suitable, immunofluorescence: suitable
isotype	IgG2aκ

Monoclonal Anti-dTAF40 (mouse IgG2a isotype) is derived from the hybridoma 4H6 produced by the fusion of mouse myeloma cells and splenocytes from Swiss Webster mice immunized with Drosophila TFIID complex.

WGK Germany

WGK 2

Узнать цену

Подробнее

Anti-dTAF40 antibody, Mouse monoclonal

Drosophila TFIID complex.

Monoclonal Anti-dTAF40 antibody produced in mouse has been used in immunoblotting and enzyme linked immune sorbent assay (ELISA).
Biochem/physiol Actions
The role of TAFs in transcription is not clear and it is proposed that they function as obligatory co-activators essential for activator response. Some of the promoters respond to specific TAFs. Inactivation of TATA-binding protein (TBP) associated factors (TAFs) like TAF17, TAF40, TAF60, TAF61/68 and TAF23/25 results in dramatic effects on many genes transcribed by Pol II. TAF40 is an important TFIID TAF, which in yeast has been found to be responsible for the majority of Pol II mediated transcription activity. It has been shown that TAF40 is responsible for the interaction of TFIID with TFIIA, which is important in cell growth.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200,
biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	4H6, monoclonal
form	buffered aqueous solution
mol wt	antigen ~40 kDa
species reactivity	Drosophila
packaging	antibody small pack of 25 µL
concentration	~1.5 mg/mL
application(s)	indirect ELISA: suitable, western blot: 1-2 µg/mL using nuclear extracts of D.Mel cells
conjugate	unconjugated
shipped in	dry ice
storage temp.	20°C
Gene Information	Drosophila melanogaster ... e(y)1(32762)

Monoclonal Anti-dTAF80 (mouse IgG2b isotype) is derived from the hybridoma 3D10 produced by the fusion of mouse myeloma cells and splenocytes from mice. Drosophila tightly associated factor 80 (dTAF80), also known as tightly associated factor 5 (TAF5) consists of numerous copies ofβtransducin (WD40) repeat.
Specificity
Monoclonal Anti-dTAF80 reacts specifically with Drosophila dTAF80

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-dTAF80 antibody, Mouse monoclonal

Drosophila TFIID complex.

Anti-dTAF80 antibody, mouse monoclonal may be used in immunoblotting and enzyme-linked immunosorbent assay (ELISA).
Biochem/physiol Actions
Drosophila tightly associated factor 80 (dTAF80) recognizes and interacts with a higher-order complex containing TATA box-binding protein (TBP), delta N250, 110 and 60.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For extended storage, freeze at -20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples shouldbe discard if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200,
biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	3D10, monoclonal
form	buffered aqueous solution
mol wt	antigen ~80 kDa
species reactivity	Drosophila melanogaster
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	indirect ELISA: suitable, western blot: 8-16 µg/mL using nuclear extracts of D.Mel cells.
isotype	IgG2b
conjugate	unconjugated
shipped in	dry ice
storage temp.	20°C
Gene Information	Drosophila melanogaster ... Taf5(47900)

Dual specificity tyrosine-phosphorylation-regulated kinase 1A (UniProt: Q13627; also known as EC 2.7.12.1, Dual specificity YAK1-related kinase, DYRK1A, HP86, Protein kinase minibrain homolog, MNBH, hMNB) is encoded by the DYRK1A (also known as DYRK, MNB, MNBH) gene (Gene ID: 1859) in human. DYRK1A is a dual-specificity kinase that possesses both serine/threonine and tyrosine kinase activities and plays a role in a signaling pathway regulating nuclear functions of cell proliferation. DYRK family members share a conserved kinase domain and an adjacent DYRK-homology domain or DH-box (DDDNXDY), while differing in their N- and C-terminal regions. DYRK1A is ubiquitous in its distribution and highest levels are observed in skeletal muscle, testis, fetal lung, and fetal kidney. It is also expressed in the developing central nervous system. DYRK1A is regulated by autophosphorylation on serine, threonine, and tyrosine residues, but catalyzes phosphorylation of a broad-range of substrates only on serine/threonine residues within the RPX(S/T)P motif with a preference for proline at position P+1 and arginine at position P-3. The ATP binding region of DYRK1A is localized to amino acids 165-173 and 238-241. Its protein kinase domain is localized to amino acids 159-479. Five isoforms of DYRK1A have been described that are produced by alternative splicing. Mutations in DYRK1A gene are known to cause autosomal dominant mental retardation that is characterized by primary microcephaly, severe mental retardation without speech, and anxious autistic behavior.
Specificity
Clone 11D9.1 specifically detects human Dual specificity tyrosine-phosphorylation-regulated kinase 1A. It targets an epitope within the first 95 amino acids in the N-terminal region.

pictograms	GHS07
signalword	Warning
hcodes	H302 - H412
pcodes	P273 - P301 + P312 + P330
Personal Protective Equipment	Eyeshields,, Faceshields,, Gloves,, type ABEK (EN14387) respirator filter,
RIDADR	NONH for all modes of transport
WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-DYRK1A Antibody, clone 11D9.1

GST/His-tagged recombinant fragment corresponding to the first 95 amino acids from human Dual specificity tyrosine-phosphorylation-regulated kinase 1A (DYRK1A).

Anti-DYRK1A, clone 11D9.1, Cat. No. MABN1564, is a highly specific mouse monoclonal antibody that targets DYRK1A and has been tested in Western Blotting.
Quality
Evaluated by Western Blotting in human cerebral cortex tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected DYRK1A in human cerebral cortex tissue lysate.
Target description
~86 kDa observed; 85.58 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	11D9.1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001387,
UniProt accession no.	Q13627,
Gene Information	human ... DYRK1A(1859)

H/ACA ribonucleoprotein complex subunit 4 (UniProt: O60832; also known as CBF5 homolog, Dyskerin, Nopp140-associated protein of 57 kDa, Nucleolar protein NAP57, Nucleolar protein family A member 4, snoRNP protein DKC1) is encoded by the DKC1 (also known as NOLA4) gene (Gene ID: 1736) in human. Dyskerin is a highly conserved nucleolar protein that is involved with multiple cellular functions, such as protein expression, growth, proliferation, and nucleo-cytoplasmic shuttling. It helps in the stabilization of the telomerase RNA component, which allows for the proper functioning of telomerase enzymatic complex. It also modifies specific uridine residues of ribosomal RNA by converting them to pseudouridine, thus allowing proper ribosome processing and function. Point mutations in the DKC1 gene result in a rare inherited syndrome called X-linked dyskeratosis congenita, which is leads to early mortality due to progressive bone marrow failure and is characterized by the triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. (Ref.: Montanaro, L (2010). J. Pathol. 222(4): 345-9).
Specificity
This rabbit polyclonal antibody detects Dyskerin in human cells. It targets a 16 amino acid epitope within the C-terminal half of the Dyskerin protein. For immunoprecipitaion the use of HEPES or Tris bufer with KCl is highly recommended.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Dyskerin (Rabbit)

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 16 amino acids from the C-teminal half of human Dyskerin, isoform 1.
Epitope: unknown

Research Category
Epigenetics & Nuclear Function
Anti-Dyskerin (Rabbit), Cat. No. ABE2587, is a highly specific rabbit polyclonal antibody that targets H/ACA ribonucleoprotein complex subunit 4 and has been tested for use in Immunofluorescence, Immunoprecipitation, and in Western Blotting.
Western Blotting Analysis: A 1:500 dilution from a representative lot detected Dyskerin in 10 µg of HeLa cell lysate.
Immunoprecipitation Analysis: A representative lot recovered Dyskerin associated with active telomerase in telomerase-overexpressing HEK293T cells (Courtesy of the laboratories of Dr. Hilda Pickett and Dr. Tracy Bryan, Children s Medical Research Institute, Australia).
Western Blotting Analysis: A representative lot detected Dyskerin in Western Blotting applications (OBrien, R., et. al. (2016). Cancer Res. 76(12):3604-17).
Western Blotting Analysis: A representative lot detected Dyskerin in mid-S phase HEK293T cells. The signal depleted upon treatment with siRNA against Dyskerin. (Moye, A.L., et. al. (2015). Nat Commun. 6:7643).
Immunofluorescence Analysis: A representative lot detected Dyskerin in HeLa cells. (telomerase positive) (Courtesy of the laboratories of Dr. Hilda Pickett and Dr. Tracy Bryan, Children s Medical Research Institute, Australia).
Western Blotting Analysis: A representative lot detected Dyskerin in HEK293 Cell lysate. The signal was depleted upon treatment with siRNA against Dyskerin (Courtesy of the laboratories of Dr. Hilda Pickett and Dr. Tracy Bryan, Children s Medical Research Institute, Australia).
Quality
Evaluated by Western Blotting in SW480 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Dyskerin in 10 µg of SW480 cell lysate.
Target description
~58 kDa observed; 57.67 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in buffer containing 20 mM Tris, 200 mM KCl, 1 mM EDTA, pH 8.5 with 0.02% sodium azide.
Affinity Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
UniProt accession no.	O60832,

H/ACA ribonucleoprotein complex subunit 4 (UniProt: O60832; also known as CBF5 homolog, Dyskerin, Nopp140-associated protein of 57 kDa, Nucleolar protein NAP57, Nucleolar protein family A member 4, snoRNP protein DKC1) is encoded by the DKC1 (also known as NOLA4) gene (Gene ID: 1736) in human. Dyskerin is a highly conserved nucleolar protein that is involved with multiple cellular functions, such as protein expression, growth, proliferation, and nucleo-cytoplasmic shuttling. It helps in the stabilization of the telomerase RNA component, which allows for the proper functioning of telomerase enzymatic complex. It also modifies specific uridine residues of ribosomal RNA by converting them to pseudouridine, thus allowing proper ribosome processing and function. Point mutations in the DKC1 gene result in a rare inherited syndrome called X-linked dyskeratosis congenita, which is leads to early mortality due to progressive bone marrow failure and is characterized by the triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. (Ref.: Montanaro, L (2010). J. Pathol. 222(4): 345-9).
Specificity
This sheep polyclonal antibody detects Dyskerin in human cells. It targets a 16 amino acid epitope within the C-terminal half of human Dyskerin.

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Dyskerin (Sheep)

Epitope: C-terminal half
Diphtheria Toxoid Carrier Protein-conugated linear peptide corresponding to 16 amino acids from the C-terminal half of human Dyskerin.

Western Blotting Analysis: A representative lot detected Dyskerin in 293T cells. The signal was depleted upon treatment with siRNA against Dyskerin (Stern, J.L., et. al. (2012). Mol Cell Biol. 32(13):2384-95).
Chromatin Immunoprecipitation (ChIP) Analysis: A representative lot detected Dyskerin associated to telomeres in telomerase-overexpressing HEK293 cells (Stern, J.L., et. al. (2012). Mol Cell Biol. 32(13):2384-95).
Immunoprecipitation Analysis: A representative lot recoverd Dyskerin telomerase-overexpressing 293T cells. (Stern, J.L., et. al. (2012). Mol Cell Biol. 32(13):2384-95).
Western Blotting Analysis: A representative lot detected Dyskerin in HEK293T cells transfected with a dyskerin expression plasmid (Courtesy of the laboratories of Dr. Hilda Pickett and Dr. Tracy Bryan, Children s Medical Research Institute, Australia).
Research Category
Epigenetics & Nuclear Function
Anti-Dyskerin (Sheep), Cat. No. ABE2879, is a highly specific sheep polyclonal antibody that targets H/ACA ribonucleoprotein complex subunit 4 and has been tested in Chromatin Immunoprecipitation (ChIP), Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in HeLa cell Lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Dyskerin in HeLa cell Lysate.
Target description
~58 kDa observed; 57.67 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified sheep polyclonal antibody in buffer containing 20 mM HEPES-KOH (pH 7.9) 200 mM KCl 1 mM EDTA with 0.02% sodium azide.
Affinity Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	sheep
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	ChIP: suitable (ChIP-seq)","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001354,
UniProt accession no.	O60832,

Specificity
E-Cadherin
Predicted to cross-react with mouse, rat, orangutan, bovine, chicken and canine based on sequence homology

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-E-Cadherin Antibody

eCl@ss:	32160702
NACRES:	NA.41

synthetic peptide corresponding to amino acids 859-874 of human E-Cadherin

Research Category
Cell Structure
Detect E-Cadherin using this Anti-E-Cadherin Antibody validated for use in WB.
Research Sub Category
Adhesion (CAMs)
Quality
Routinely evaluated by immunoblot with RIPA lysates from HepG2 cells.
Target description
106kDa
Physical form
Serum
Storage and Stability
2 years at -20°C from date of shipment

feature_concentration_valuePlease refer to lot specific datasheet.

Specificity
Antibodies against E-cadherin are suitable to characterize epithelial cells. E-Cadherin is involved in adhesion of epithelial cells (mostly homotypic and homophilic). E-cadherin is also expressed on immature erythroid cells. The antibody 67A4 is suitable to study E cadherin expression by flow cytometry. In addition, it blocks the interaction of E-cadherin molecules and therefore is suitable to study E-cadherin-mediated signal transduction.

biological source	rabbit
Quality Level	100
antibody form	serum
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
packaging	antibody small pack of 25 µL
Торговая марка	Upstate^®
application(s)	western blot: suitable
isotype	IgG
NCBI accession no.	NM_004360.2,
UniProt accession no.	P12830,
shipped in	ambient

Узнать цену

Подробнее

Anti-E-Cadherin Antibody, clone 67A4, Azide Free

eCl@ss:	32160702
NACRES:	NA.41

T-47D breast carcinoma line.

Anti-E-Cadherin Antibody, clone 67A4, Azide Free is an antibody against E-Cadherin for use in FC & IF.
Immunoblotting
FACS Analysis
Functional blocking of E-cadherin
Does not work well for immunoprecipitation
Optimal working dilutions must be determined by end user.
Quality
Tested
Physical form
Liquid in 0.02M PBS with NaCl, pH=7.6, with no preservatives. Protein A purified immunoglobulin.
Format: Purified

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

E3 ubiquitin-protein ligase UBR5 (UniProt: O95071; also known as EC:2.3.2.26, E3 ubiquitin-protein ligase, HECT domain-containing 1, HECT-type E3 ubiquitin transferase UBR5, Hyperplastic discs protein homolog, hHYD, Progestin-induced protein) is encoded by the UBR5 (also known as EDD, EDD1, HYD, KIAA0896) gene (Gene ID: 51366) in human. UBR5 is a nuclear protein that is widely expressed and is shown to be most abundant in testis and is expressed at high levels in brain, pituitary, and kidney. Two isoforms of UBR5 are described that are produced by alternative splicing and differ only in a single amino acid. It is identified as a novel regulator of p53 and downregulation of UBR5 results in elevated levels of p53 in normal and transformed cells. Its deficiency in mice is reported to result in mid gestation embryonic death due to a compromised yolk sac vascular development. UBR5 is a component of the N-end rule pathway. It recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. It is shown to be involved in maturation and/or transcriptional regulation of mRNA by activating CDK9 by polyubiquitination and is believed to play a role in control of cell cycle progression. It associates with CDK9 and TFIIS/TCEA1 and forms a transcription regulatory complex made of CDK9, RNAP II, UBR5, and TFIIS/TCEA1 that can stimulate target gene transcription. UBR5 regulates DNA topoisomerase II binding protein (TopBP1) in the DNA damage response and may have a role in tumor suppression. (Ref.: Smits, VAJ (2012). Cell Cycle 11(4); 715-720).
Specificity
This rabbit polyclonal antibody detects E3 ubiquitin-protein ligase UBR5/EDD in human and murine cells. It targets an epitope within 331 amino acids from the internal region.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	67A4, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	flow cytometry: suitable","immunofluorescence: suitable
isotype	IgG1
NCBI accession no.	NM_004360.2,
UniProt accession no.	P12830,
shipped in	dry ice
storage temp.	20°C

Узнать цену

Подробнее

Anti-E3 ubiquitin-protein ligase (UBR5/EDD)

eCl@ss:	32160702
NACRES:	NA.41

His-tagged recombinant fragment corresponding to 331 amino acids from the internal region of human E3 ubiquitin-protein ligase UBR5/EDD.
Epitope: unknown

Anti-E3 ubiquitin-protein ligase (UBR5/EDD), Cat. No. ABE2863, is a highly specific rabbit polyclonal antibody that targets E3 ubiquitin-protein ligase UBR5 and has been tested in Immunofluorescence, Immunoprecipitation, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Western Blotting Analysis: A 1:50,000 dilution from a representative lot detected E3 ubiquitin-protein ligase (UBR5/EDD) in 10 µg of Balb 3T3/A31 cell lysate.
Western Blotting Analysis: A representative lot detected E3 ubiquitin-protein ligase (UBR5) in U2OS cells transefected with Luc or different EDD siRNA oligos (Smits, V.A., et. al. (2012). Cell Cycle. 11(4):715-20).
Immunoprecipitation Analysis: 2.5ul µL from a representative lot detected E3 ubiquitin-protein ligase (UBR5?EDD) in U2OS cell lysate (Courtesy of Dr. Veronique Smits at Hospital Univers. Canarias, Spain).
Immunofluorescence Analysis: A 1:1,000 dilution from a representative lot detected E3 ubiquitin-protein ligase (UBR5/EDD) in U2OS cells (Courtesy of Dr. Veronique Smits at Hospital Univers. Canarias, Spain).
Quality
Evaluated by Western Blotting in U2OS cell lysate.
Western Blotting Analysis: A 1:50,000 dilution of this antibody detected E3 ubiquitin-protein ligase (UBR5/EDD) in 10 µg of U2OS cell lysate.
Target description
~309 kDa observed; 309.35 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Rabbit polyclonal antiserum with 0.1% sodium azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	serum
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human, mouse
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_056986,
UniProt accession no.	O95071,
Gene Information	human ... UBR5(51366)

E3 ubiquitin-protein ligase RNF31 (UniProt: Q96EP0; also known as EC: 2.3.2.27, HOIL-1-interacting protein, HOIP, RING finger protein 31, RING-type E3 ubiquitin transferase RNF31, Zinc in-between-RING-finger ubiquitin-associated domain protein) is encoded by the RNF31 (also known as ZIBRA) gene (Gene ID: 55072) in human. E3 ubiquitin-protein ligase RNF31 is a cytoplasmic protein that is a component of the linear ubiquitin chain assembly complex (LUBAC complex), which conjugates linear (Met-1-linked) polyubiquitin chains to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG (NEMO) and receptor interacting serine/threonine Kinase 1 (RIPK1) and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. LUBAC-mediated polyubiquitination interferes with TNF-induced cell death and thereby prevents inflammation. Together with OUTLIN deubiquitinase, the LUBAC complex is also reported to regulate the canonical Wnt signaling pathway during angiogenesis. E3 ubiquitin-protein ligase RNF31 is expressed in both normal and transformed breast epithelial cell lines. It contains a polyubiquitin-binding (PUB) domain (aa 71-142) that mediates interaction with the PCNA-interacting motifs of C-terminus of the AAA+ ATPase p97 (VCP) and RNF31, with a strong preference for RNF3. It also has a ubiquitin-associated (UBA) domain (aa 564-615) that mediates association with RanBP-type and C3HC4-type zinc finger-containing protein 1 (RBCK1/HOIL1) via interaction with its ubiquitin-like (UBL) domain. (Ref.: Elliot, PR et al (2014). Mol. Cell 54(3); 335-48).
Specificity
This rabbit polyclonal antibody detects E3 ubiquitin-protein ligase RNF31 in human cells. It targets an epitope within 17 amino acids from the C-terminal region. Immunogen sequence is conserved in all 3 isoforms.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-E3 ubiquitin-protein ligase RNF31

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 17 amino acids from the C-terminal region of human E3 ubiquitin-protein ligase RNF31.
Epitope: C-terminus

Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected E3 ubiquitin-protein ligase RNF31 in human adrenal gland and human uterus tissues.
Anti-E3 ubiquitin-protein ligase RNF31, Cat. No. ABS1486, is a rabbit polyclonal antibody that detects E3 ubiquitin-protein ligase RNF31 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Signaling
Quality
Evaluated by Western Blotting in Jurkat cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected E3 ubiquitin-protein ligase RNF31 in 10 µg of Jurkat cell lysate.
Target description
~120 kDa observed; 119.65 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
species reactivity (predicted by homology)	chimpanzee (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
NCBI accession no.	NP_060469.4,
UniProt accession no.	Q96EP0,
shipped in	ambient

E3 ubiquitin-protein ligase UBR1 (UniProt: Q8IWV7; also known as EC: 2.3.2.27, N-Recognin-1, RING-type E3 ubiquitin transferase UBR1, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein ligase E3-alpha-I) is encoded by the UBR1 gene (Gene ID: 197131) in human. E3 ubiquitin-protein ligase UBR1 is a component of the N-end rule pathway. It recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. It may also be involved in pancreatic homeostasis. Two isoforms of UBR1 have been described that are produced by alternative splicing. UBR1 is broadly expressed protein with highest levels reported in skeletal muscle, kidneys, and pancreas. UBR1 has two zinc finger domains. The UBR-type domain is localized to amino acids 97 to 168 and it forms a pocket that mediates recognition of type 1 N-degrons. It exhibits preference for arginine in first position and displays poor affinity for histidine. The second zinc finger domain, RING-type, atypical, is localized to amino acids 1098-1201. Mutations in UBR1 gene are causative factor in Johanson-Blizzard syndrome that is characterized by congenital exocrine pancreatic insufficiency, malformations such as nasal wing aplasia, and mental retardation.
Specificity
Clone 6H9.1 detects E3 ubiquitin-protein ligase UBR1 in human and rat cells. It targets an epitope within 101 amino acids from the internal region.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-E3 ubiquitin-protein ligase UBR1 Antibody, clone 6H9.1

GST/His-tagged recombinant fragment corresponding to 101 amino acids from the internal region of human E3 ubiquitin-protein ligase UBR1.

Anti-E3 ubiquitin-protein ligase UBR1, clone 6H9.1, Cat. No. MABS1180, is a mouse monoclonal that detects E3 ubiquitin-protein ligase UBR1 and has been tested for use in Immunohistochemistry (Paraffin) Western Blotting.
Research Category
Signaling
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected E3 ubiquitin-protein ligase UBR1 in human pancreas and human kidney tissue sections.
Western Blotting Analysis: 0.5 µg/mL from a representative lot detected E3 ubiquitin-protein ligase UBR1 in C6 cell lysate.
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected E3 ubiquitin-protein ligase UBR1 in HEK293 cell lysate.
Target description
~200 kDa observed; 200.21 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	6H9.1, monoclonal
species reactivity	rat, human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_777576,
UniProt accession no.	Q8IWV7,

Epstein-Barr nuclear antigen 1 (UniProt: P03211; also known as EBNA-1, EBV nuclear antigen 1) is encoded by the EBNA1 (also known as BKRF1) gene (Gene ID: 3783709) in Epstein-Barr virus (EBV). EBV is a gamma-herpesvirus, a causative agent of infectious mononucleosis. EBNA1, a multi-functional protein, plays an important role in maintaining EBV in the host cell and has been implicated in host cell immortalization. It plays an essential role in replication and partitioning of viral genomic DNA during latent viral infection. During this phase, the circular double-stranded viral DNA undergoes replication once per cell cycle and is efficiently partitioned to the daughter cells. EBNA1 activates the initiation of viral DNA replication through binding to specific sites in the viral latent origin of replication, oriP. It is also reported to direct the segregation of viral episomes by mediating their attachment to host cell metaphase chromosomes and is known to activate the transcription of several viral latency genes. By counteracting the stabilization of host p53, it also reduces apoptosis and increases host cell survival. EBNA1 is also a risk factor in a variety of malignancies and is the only viral protein found in all EBV-related malignancies. Its C-terminal region contains a dimerization domain and a DNA binding domain (aa 459-607). Although this domain is essential for its replication function of EBNA1, it is not sufficient for this activity and the N-terminal half of EBNA1 is also required. (Ref.: Sun, X., et al. (2010). Proc. Natl. Acad. Sci. USA. 107(7); 3146-3151; Duellman, SJ., and Burgess, RR. (2009). PLoS ONE 4(2): e4614; Wu, H., et al. (2002). J. Virol. 76(5); 2480-2490).
Specificity
Clone 1EB12 is a mouse monoclonal antibody that detects Epstein-Barr nuclear antigen 1 (EBNA-1). It targets an epitope within 26 amino acids from the N-terminal region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-EBNA-1 Antibody, clone 1EB12

His-tagged recombinant Epstein-Barr nuclear antigen 1 expressed in E. coli.

Quality Control Testing
Evaluated by Western Blotting in Raji cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected EBNA-1 in Raji cell lysate.
Tested Applications
Immunoprecipitation Analysis: A representative lot immunoprecipitated EBNA-1 in Immunoprecipitation application. (Duellman, S.J., et al. (2009). PLoS One. 4(2):e4614; Sun, X., et al. (2010). Proc Natl Acad Sci USA. 107(7):3146-51).
ELISA Analysis: A representative lot detected EBNA-1 in ELISA application. (Duellman, S.J., et al. (2009). PLoS One. 4(2):e4614).
Western Blotting Analysis: A representative lot detected EBNA-1 in Western Blotting application. (Duellman, S.J., et al. (2009). PLoS One. 4(2):e4614; Sun, X., et al. (2010). Proc Natl Acad Sci USA. 107(7):3146-51).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-EBNA-1, clone 1EB12, Cat. No. MABE1881, is a mouse monoclonal antibody that detects Epstein-Barr nuclear antigen 1 and is tested for use in ELISA, Immunoprecipitation, and Western Blotting.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.

Quality Level	200
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	1EB12, monoclonal
mol wt	calculated mol wt 56.43 kDa","observed mol wt ~56 kDa
purified by	using protein G
species reactivity	virus
packaging	antibody small pack of 100 µL
application(s)	ELISA: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
epitope sequence	N-terminal
conjugate	unconjugated
UniProt accession no.	P03211,
shipped in	2-8°C
Gene Information	vaccinia virus ... EBNA-1(3783774)

Envelope glycoprotein (UniProt: Q05320; also known as GP1,2; GP) is encoded by the GP gene (Gene ID: 911829) in Zaire Ebola virus. Ebola virus (EBOV) is a filovirus that is shown to cause severe viral hemorrhagic fever with high lethality. It has a single stranded, negative-sense RNA genome that encodes seven viral structural proteins including nucleoprotein, virion proteins, and glycoprotein. The glycoprotein is the most important protein involved in pathogenesis. It is a type I transmembrane surface protein shown to be responsible for receptor binding, viral entry, and cellular tropism. The GP gene is reported to undergo transcriptional editing to give rise to several glycosylated proteins, including the structural protein GP1,2, and the secreted non-structural glycoprotein (sGP). The GP is synthesized as a 676-amino acid polyprotein with a signal peptide (aa 1-32). This polyprotein is cleaved by the furin to yield two disulfide linked subunits known as GP1 (aa 33-501) and GP2 (aa 502-676), which together form the GP1,2 heterodimer. The GP1 acts as the receptor-binding subunit and GP2 as the membrane fusion subunit. The GP1 subunit is expressed on the cell surface with the C-terminus oriented toward the aqueous environment, while the N-terminus is bound to GP2 via disulfide bonds. The GP1 subunit contains the heavily glycosylated mucin-like domain (aa 305-485), which is responsible for its cytotoxic function. The glycoprotein contains two coiled coil regions (aa 554-595 and 615-634) that play a role in its oligomerization and fusion activity. Clone 1H3 recognizes the secreted glycoprotein form (sGP) and also recognizes glycoprotein lacking a large part of the mucin domain (GP1,2 Mucin333 458). It does not recognize VSV G/ZEBOVGP and subfragment D. When administered before virus challenge, it provides only a partial protection. (Ref.: Qiu, X., et al. (2011). Clin. Immunol. 141(2); 218-227).
Specificity
Clone 1H3 is a mouse monoclonal antibody that detects envelope glycoprotein of Zaire Ebola virus. It recognizes the secreted glycoprotein form (sGP) and binds to a conformational epitope in the first 295 amino acids.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-EBOV GP Antibody, clone 1H3

Glycoprotein from Zaire Ebola virus, strain Mayinga, expressed in VSV G. Reverse genetics technique was used to create the recombinant virus VSV G/ZEBOV glycoprotein.

Anti-EBOV GP clone 1H3, Cat. No. MABF2113, is a mouse monoclonal antibody that detects Ebola virus Envelope Glycoprotein and has been tested for use in ELISA and, Immunocytochemistry, Immunoprecipitation, and Neutralizing Applications.
ELISA Analysis: A representative lot detected EBOV GP in ELISA applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Immunoprecipitation Analysis: Immunoprecipitation Analysis: A representative lot detected EBOV GP in Immunoprecipitation applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Immunocytochemistry Analysis: Immunocytochemistry Analysis: A representative lot detected EBOV GP in Immunocytochemistry applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Neutralizing Analysis: A representative provided partial protection when administered prior to virus challenge. (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
ELISA Analysis: Various dilutions of this antibody detected Envelope glycoprotein in Recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP TM).
Research Category
Inflammation & Immunology
Quality
Evaluated by ELISA with recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP deltaTM).
ELISA Analysis: Various dilutions of this antibody detected EBOV GP in Recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP deltaTM).
Target description
74.46 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	1H3, monoclonal
species reactivity	virus, Ebola virus
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","neutralization: suitable
isotype	IgG2a
NCBI accession no.	NP_066246,
UniProt accession no.	Q05320,

Envelope glycoprotein (UniProt: Q05320; also known as GP1,2; GP) is encoded by the GP gene (Gene ID: 911829) in Zaire Ebola virus. Ebola virus (EBOV) is a filovirus that is shown to cause severe viral hemorrhagic fever with high lethality. It has a single stranded, negative-sense RNA genome that encodes seven viral structural proteins including nucleoprotein, virion proteins, and glycoprotein. The glycoprotein is the most important protein involved in pathogenesis. It is a type I transmembrane surface protein shown to be responsible for receptor binding, viral entry, and cellular tropism. The GP gene is reported to undergo transcriptional editing to give rise to several glycosylated proteins, including the structural protein GP1,2, and the secreted non-structural glycoprotein (sGP). The GP is synthesized as a 676-amino acid polyprotein with a signal peptide (aa 1-32). This polyprotein is cleaved by the furin to yield two disulfide linked subunits known as GP1 (aa 33-501) and GP2 (aa 502-676), which together form the GP1,2 heterodimer. The GP1 acts as the receptor-binding subunit and GP2 as the membrane fusion subunit. The GP1 subunit is expressed on the cell surface with the C-terminus oriented toward the aqueous environment, while the N-terminus is bound to GP2 via disulfide bonds. The GP1 subunit contains the heavily glycosylated mucin-like domain (aa 305-485), which is responsible for its cytotoxic function. The glycoprotein contains two coiled coil regions (aa 554-595 and 615-634) that play a role in its oligomerization and fusion activity. Clone 2G4 recognizes glycoprotein lacking a large part of the mucin domain (GP1,2 Mucin333 458). It does not recognize VSV G/ZEBOVGP and subfragment D. When administered before virus challenge, it provides only a partial protection. (Ref.: Qiu, X., et al. (2011). Clin. Immunol. 141(2); 218-227).
Specificity
Clone 2G4 s a mouse monoclonal antibody that detects envelope glycoprotein of Zaire Ebola virus. It binds to the GP2 region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-EBOV GP Antibody, clone 2G4

Glycoprotein from Zaire Ebola virus, strain Mayinga

Immunoprecipitation Analysis: Immunoprecipitation Analysis: A representative lot detected EBOV GP in Immunoprecipitation applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Immunocytochemistry Analysis: Immunocytochemistry Analysis: A representative lot detected EBOV GP in Immunocytochemistry applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Neutralizing Analysis: A representative lot provided partial protection when administed prior to virus challenge. (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
ELISA Analysis: Various dilutions of this antibody detected Envelope glycoprotein in Recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP TM).
ELISA Analysis: A representative lot detected EBOV GP in ELISA applications (Qiu, X., et. al. (2011). Clin Immunol. 141(2):218-27).
Anti-EBOV GP, clone 2G4, Cat. No. MABF2112, is a mouse monoclonal antibody that detects Ebola virus Envelope glycoprotein and has been tested for use in ELISA, Immunocytochemistry, Immunoprecipitation, and Neutralizing Applications.
Research Category
Inflammation & Immunology
Quality
Evaluated by ELISA in Recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP TM).
ELISA Analysis: Various dilutions of this antibody detected EBOV GP in Recombinant Ebola virus Glycoprotein minus the transmembrane region (EBOV rGP TM).
Target description
74.46 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.