Small Pack Antibodies

Recombinant His-tagged human SREBP-1a protein encompassing amino acids 301-407.

Anti-SREBP1 Antibody, clone 2121 is a Mouse Monoclonal Antibody for detection of SREBP1 also known as sterol regulatory element binding transcription factor 1 & has been validated in WB.
Quality
Routinely evaluated by immunoblot.
Target description
126 kDa
Physical form
100 μL (1 mg/mL) of protein A purified mouse monoclonal IgG1 in PBS with 0.1% sodium azide.
Format: Purified
Storage and Stability
Stable for 2 years at -20°C from date of shipment. Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol-containing solutions to become frozen during storage.

feature_concentration_valuePlease refer to lot specific datasheet.

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany

Quality Level	100
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	2121, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
Торговая марка	Upstate^®
application(s)	western blot: suitable
isotype	IgG1
NCBI accession no.	NM_001005291.1,","NM_004176.3,
UniProt accession no.	P36956,
shipped in	dry ice

Узнать цену

Подробнее

Anti-SRP68 antibody produced in rabbit

HPA023303 Human Protein Atlas characterization data

The gene SRP68 (signal recognition particle 68) is mapped to human chromosome 17q25.

Signal recognition particle 68 kDa protein recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
SRP68 (signal recognition particle 68) is a part of the SRP ribonucleoprotein complex. The complex is crucial for the co-translational transfer of secretory and membrane proteins to the endoplasmic reticulum (ER). SRP68 interacts with SRP72 and the heterodimer is needed for SRP-associated transfer of proteins to the ER. In addition, the heterodimer also binds to the chromatin and participates in transcriptional regulation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75779,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	DAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIV
conjugate	unconjugated
UniProt accession no.	Q9UHB9,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SRP68(6730)

Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase (UniProt: Q92185; also known as EC: 2.4.99.8, Alpha-2,8-sialyltransferase 8A, Ganglioside GD3 synthase, Ganglioside GT3 synthase, Sialyltransferase 8A, SIAT8-A, Sialyltransferase St8Sia I, ST8SiaI) I encoded by the ST8SIA1 (also known as SIAT8, SIAT8A) gene (Gene ID: 6489) in human. SIAT8-A is a single-pass type II membrane protein that is strongly expressed in melanoma cell lines, adult and fetal brain, and to a lesser extent in adult and fetal lung. It is involved in the production of gangliosides GD3 and GT3 from GM3. It catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce GD3 and GT3 in a successive manner. It is also involved in the pathway protein glycosylation. SIAT8-A contains a cytoplasmic domain (aa 1-29); a transmembrane domain (aa 30-48); and a lumenal domain (aa 49-356). Two isoforms of SIAT8-A have been described that are produced by alternative splicing. (Ref.: Dorrell, C., et al. (2016). Nat. Commun. 7; 11756).
Specificity
Clone HIC0-3C5 specifically detects human Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase (ST8SIA1).

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-ST8SIA1 Antibody, clone HIC0-3C5

eCl@ss:	32160702
NACRES:	NA.41

Trypsin-dissociated human pancreatic islet cells with low levels of exocrine and ductal cells.

Flow Cytometry Analysis: A representative lot detected ST8SIA1 in Flow Cytometry applications (Dorrell, C., et. al. (2016). Nat Commun. 7:11756).
Immunofluorescence Analysis: A representative lot detected ST8SIA1 in Immunofluorescence applications (Dorrell, C., et. al. (2016). Nat Commun. 7:11756).
Research Category
Signaling
Anti-ST8SIA1, clone HIC0-3C5, Cat. No. MABS1997, is a mouse monoclonal antibody that detects Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase and has been tested for use in Flow Cytometry, Immunoflurescence, and Immunohistochemistry.
Quality
Evaluated by Immunohistochemistry in human pancreatic tissue sections.
Immunohistochemistry Analysis: A 1:250 dilution of this antibody detected ST8SIA1 in human pancreatic tissue sections.
Target description
40.52 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgM in PBS with 0.05% sodium azide.
Format: Purified
Purified by ion-exchange chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Concentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

SSEA-1 is expressed on the surface of early mouse embryos, murine embryonal carcinoma cells (EC), murine embryonic stem cells (ES) and murine & human germ cells (EG). No immunoreactivity is evident with undifferentiated human EC and ES cells. Expression of SSEA-1 is down regulated following differentiation of murine EC and ES cells. In contrast, the differentiation of human EC and ES cells is characterized by an increase in SSEA-1 expression.
Specificity
This antibody reacts with the Stage-specific embryonic antigen-1 (SSEA-1) that is expressed upon the surface of early mouse embryos, murine embryonal carcinoma cells (EC), murine embryonic stem cells (ES) and murine & human germ cells (EG).

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	HIC0-3C5, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable
isotype	IgM
NCBI accession no.	NP_003025.1,
UniProt accession no.	Q92185,
Gene Information	human ... ST8SIA1(6489)

Узнать цену

Подробнее

Anti-Stage-Specific Embryonic Antigen-1 Antibody, clone MC-480

F9 tetracarcinoma stem cells (X-irradiated).

Research Sub Category
Pluripotent & Early Differentiation
Neural Stem Cells
Anti-Stage-Specific Embryonic Antigen-1 Antibody, clone MC-480 detects level of Stage-Specific Embryonic Antigen-1 & has been published & validated for use in FC, IF, IH & IP.
Immunohistochemistry:
A previous lot of this antibody was tested on IH.
Immunoprecipitation:
A previous lot of this antibody was tested on IP.
Immunofluorescence:
A previous lot of this antibody was tested on IF. 4% PFA fixed, 5-10 minutes room temperature. No detergent is required as epitope is external.
Flow Cytometry:
A starting range of 10-20 µg/mL is suggested.
Positive mouse EC lines include:
F9, PCC4, ND-1, SCC1, NG2, LT/SV, MH-15, FA-25.
Lines : PYS-2, OTT6050f, B3T3SV. C57SV, K129SV. KCA, QAIB, BW5147 were negative.
Optimal working dilutions must be determined by the end user.
Research Category
Stem Cell Research
Quality
Tested
Target description
220 kDa
Physical form
Format: Purified
Purified mouse monoclonal IgM in buffer containing 0.05M Potassium Phosphate, 0.3M NaCl, pH 8.0 with 0.05% Sodium Azide
Ammonium Sulfate Precipitation
Storage and Stability
Stable for 1 year at 2-8ºC from date of receipt.
Analysis Note
Control
P19 mouse embryonic carcinoma cells

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Staphylococcal toxin, a water soluble 33kD single polypeptide, is a cytotoxic agent secreted by Staphylococcus aureus. This protein has membrane damaging properties and accounts for erythrocyte lysis. Hence it is also referred to as lethal hemolytic toxin or -hemolysin . Anti-staphylococcal -toxin antibody can be used for studies of the toxin-membrane interaction. Rabbit anti-staphylococcal -toxin antibody reacts specifically with staphylococcal -toxin but not with staphylococcal enterotoxin A, cholera toxin or pseudomonas exotoxin A.

Quality Level	100
biological source	mouse
antibody form	saturated ammonium sulfate (SAS) precipitated
antibody product type	primary antibodies
clone	MC-480, monoclonal
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	flow cytometry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable
input	sample type: human embryonic stem cell(s) sample type: mouse embryonic stem cell(s) sample type induced pluripotent stem cell(s) sample type neural stem cell(s)
isotype	IgM
NCBI accession no.	NM_002033.2,
UniProt accession no.	P22083,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... FUT4(2526)

Узнать цену

Подробнее

Anti-Staphylococcal -Toxin antibody produced in rabbit

MDL number:	MFCD00162866
NACRES:	NA.46

-toxin (-hemolysin) from Staphylococcus aureus

Anti-staphylococcal α-toxin antibody can be used in indirect ELISA (1:50,000) and dot blot immunoassay (1: 20,000).
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Enzyme-linked immunosorbent assay (1 paper),
Quality
The antiserum has been treated to remove lipoproteins.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200,
antibody form	whole antiserum
antibody product type	primary antibodies
clone	polyclonal
mol wt	antigen 33 kDa
contains	15 mM sodium azide
species reactivity	Staphylococcus aureus
packaging	antibody small pack of 25 µL
application(s)	dot blot: 1:20,000, indirect ELISA: 1:50,000
conjugate	unconjugated
shipped in	dry ice
storage temp.	20°C

Stimulated by retinoic acid gene 6 protein (UniProt: O70491; also known as Retinoic acid-responsive protein, STRA6) is encoded by the Stra6 gene (Gene ID: 20897) in murine species. STRA6 is a multi-pass membrane protein that acts as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). It has one intramembrane and nine transmembrane helices in a dimeric assembly. It acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. Binds to RBP/RBP4 with high affinity. Increases cellular retinol uptake from the retinol-RBP complex. STRA6 is widely expressed in the embryo and it in adults it is expressed choroid plexus and the brain microvascular cells that form the blood-organ barrier. It is also expressed in the retinal pigment epithelium, seminiferous epithelium in testis, the yolk sac, and in chorioallantoic placenta. Its expression in Sertoli cells depends on the stage of the spermatogenic cycle. STRA6 can be induced by retinoic acid and it is shown to be synergistically up-regulated by Wnt1 and retinoid in mammary epithelial cells. Mutations in Stra6 gene have been linked to the Matthew-Wood syndrome that is characterized by pulmonary agenesis/hypoplasia; microphthalmia/anophthalmia; and congenital cardiac, digestive, and urogenital malformations. (Ref.: Sadowski, S et al. (2017). Birth Defects Res. 109(4); 251-253; Chen, Y et al. (2016). Science 353 (6302), aad8266).
Specificity
This rabbit polyclonal antibody detects murine Stimulated by retinoic acid gene 6 protein (STRA6). it targets an epitope within 109 amino acids from the C-terminal region.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-STRA6

eCl@ss:	32160702
NACRES:	NA.41

His-tggged recombinant fragment corresponding to 109 amino acids from the C-terminal region of murine Stimulated by retinoic acid gene 6 (STRA6) protein.
Epitope: C-terminus

Immunoprecipitation Analysis: A representative lot detected STRA6 in 293T cells transfected with an empty vector or pCMVTag2b-Stra6 (Courtesy of Dr. Noa Noy).
Western Blotting Analysis: A representative lot detected STRA6 in Western Blotting applications (Berry, D.C., et. al. (2012). Mol Cell Biol. 32(19):3851-9).
Western Blotting Analysis: A representative lot detected STRA6 in 293T cells transfected with an empty vector or pCMVTag2b-Stra6 (Courtesy of Dr. Noa Noy).
Flow Cytometry Analysis: A 1:100 dilution from a representative lot detected STRA6 in HT-29 cells.
Immunohistochemistry Analysis: A 1:250-1,000 dilution from a representative lot detected STRA6 in mouse testis and human liver cancer tissues.
Research Category
Neuroscience
Anti-STRA6, Cat. No. ABN1662, is a highly specific rabbit polyclonal antibody that targets Stimulated by retinoic acid gene 6 protein (STRA6) and has been tested for use in Flow Cytometry, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in NIH3T3/L1Adipocytes.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected STRA6 in NIH3T3/L1 Adipocytes.
Target description
~90 kDa observed; 73.77 kda calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse
packaging	antibody small pack of 25 µL
application(s)	flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_033317,
UniProt accession no.	O70491,
shipped in	ambient

Strep-Tag is a short amino acid-peptide sequence that exhibits specific binding to streptavidin. It is shown to reversibly occupy the same pocket where biotin is normally complexed. Hence, it is highly desirable for applications involving where efficient purification of fusion proteins. Use of this tag allows for easier detection of fusion proteins in various immunochemical assays. Strep-Tag is shown to be resistant to the action of proteases and can also be used in the presence of mild detergents. Clone C23.21 recognizes fusion proteins with Strep-Tag peptide sequence WSHPQFEK with picomolar affinity. It recognizes both the single and the double Strep-Tag sequence.
Specificity
Clone C23.21 is a mouse monoclonal antibody that detects Strep-Tagged proteins. It binds to WSHPQFEQ sequence with picomolar affinity.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Strep-Tag Antibody, clone C23.21

Recombinant ectodomain of glycoprotein E2 of GB virus (GBV-B), containing a double Strep-Tag (two Strep-Tags separated by a linker peptide)

Anti-Strep-Tag, clone C23.21, Cat. No. MAC143, is a mouse monoclonal antibody that detects Strep-Tagged proteins and is tested for use in Immunohistochemistry, Surface plasmon resonance, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting with Strep-Tagged VHH 9.
Western Blotting Analysis (WB): A 1:500 dilution of this antibody detected Strep-Tagged VHH9.
Tested Applications
Surface plasmon resonance: A representative lot detected Strep-Tag in Surface plasmon resonance application. (Meola, A., et al. (2015). J Virol. 89(4):2170-81).
Western Blotting Analysis: A representative lot detected Strep-Tag in human brain extract and GFAP in Western Blotting applications. (Li, T., et al. (2017). Immunol Lett. 188:89-95).
Immunohistochemistry Applications: A representative lot detected Strep-Tag in mouse brain tissue sections in Immunohistochemistry applications (Li, T., et al. (2017). Immunol Lett. 188:89-95).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	C23.21, monoclonal
mol wt	observed mol wt ~17 kDa
purified by	using protein G
species reactivity	all
packaging	antibody small pack of 100 µL
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable
isotype	IgG1
epitope sequence	Unknown
conjugate	unconjugated
UniProt accession no.	N/A,
shipped in	2-8°C

Striatin-3 (UniProt: Q13033; also known as Cell cycle autoantigen SG2NA, S/G2 antigen) is encoded by the STRN3 (also known as GS2NA, SG2NA) gene (Gene ID: 29966) in human. Striatin-3 is a calmodulin-binding protein that bonds calmodulin a calcium dependent manner and may function as scaffolding or signaling protein. Two isoforms of Striatin-3 have been reported that are produced by alternative splicing. Its calmoduln-binding region is located within amino acids 166-183. It also contains a caveolin-binding region (aa 71-79), six WD repeats, and a coiled coil region (aa 77-136). The coiled coil domain and the PP2A subunit can form a stable core complex with a 2:2 stoichiometry. The coiled coil domain of striatin-3 is a novel type of PP2A regulatory subunit that functions as a scaffold for the assembly of the STRIPAK complex. PP2A and certain kinases, such as germinal central kinase III (GCKIII) interact with striatin to form striatin-interacting phosphatase and kinase (STRIPAK) complex that are known to regulate multiple cellular events. Wild-type striatin-3 is shown to strongly suppress apoptosis in Jurkat cells induced by the GCKIII kinase MST3. However, mutant forms of striatin-3 fail to exhibit this effect. (Ref.: Lu, Q., et al. (2004). Proc. Natl. Acad. Sci. USA 101(49); 17126-17131; Chen, C., et al. (2014). J. Biol. Chem. 289(14); 9651-61).
Specificity
This rabbit polyclonal antibody detect Striatin-3 in human and murine cells. It targets an epitope within 17 amino acids from the N-terminal half.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-STRN3

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 17 amino acids from the N-terminal half of human Striatin-3. The immunogen sequence is conserved in both alpha and beta isoforms.
Epitope: unknown

Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected STRN3 in HeLa cells.
Research Category
Signaling
Anti-STRN3, Cat. No. ABS2099, is a rabbit polyclonal antibody that detects Striatin-3 and has been tested for use in Immunocytochemistry and Western Blotting.
Quality
Evaluated by Western Blotting in NIH3T3 cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected STRN3 in 10 µg of NIH3T3 cell lysate.
Target description
~87 kDa observed; 87.21 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human, mouse
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001077362,
UniProt accession no.	Q13033,
shipped in	ambient
Gene Information	human ... STRN3(29966)

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-STT3A antibody produced in rabbit

HPA030735 Human Protein Atlas characterization data

STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77889,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: 1:20-1:50
immunogen sequence	VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
conjugate	unconjugated
UniProt accession no.	P46977,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... STT3A(3703)

Substance P receptor (SPR), also known as neurokinin receptor 1 (NK-1 R), is a member of the G-protein-coupled class of seven transmembrane domain receptors. SPR gene with five exons, spanning 45-60kb on genomic DNA, is mapped to human chromosome 2. SPR is highly expressed in central nervous system.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Substance P Receptor antibody produced in rabbit

MDL number:	MFCD01634202
NACRES:	NA.41

synthetic peptide corresponding to the C-terminal of NK1R of rat origin (amino acids 393-407). This sequence is highly conserved in mouse, guinea pig, and human NK1R, but diverges in other tachykinin receptor subtypes NK2R and NK3R.

Anti-substance P receptor antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions
Substance P (SP) exhibits pro-inflammatory, endocrine, neuromodulatory and trophic activities. Substance P receptor (SPR) upon binding to its ligand SP, facilitates extravasation of granulocytes and in inflammation and tissue derangement. In addition, activation of this receptor also enhances metabolism of phosphoinositol, leading to synthesis of inositol-1,4,5-trisphosphate and diacylglycerol which results in release of Ca2+ from the endoplasmic reticulum and activation of protein kinase C. SPR along with its ligand stimulates tumoral angiogenesis and cell proliferation in a variety of cancer types. Inhibition of substance P receptor retards the growth of neuroblastoma (NB) cell lines. Thus, SPR might act as a potential therapeutic target for a large variety of patients with neuroblastoma. SP-SPR complex is also implicated in the regulation of the pain transmission.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen 46 kDa
species reactivity	human, rat, guinea pig, mouse
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry (frozen sections): 1:5,000 using 4% paraformaldehyde (with picric acid/glutaraldehyde)-fixed, frozen, rat brain sections.","microarray: suitable","western blot (chemiluminescent): 1:2,000 using a rat brain membrane fraction extract
conjugate	unconjugated
UniProt accession no.	P25103,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... TACR1(6869) mouse ... Tacr1(21336) rat ... Tacr1(24807)

Small ubiquitin-related modifier 1 (UniProt: P63165; also known as SUMO-1, GAP-modifying protein 1, GMP1, SMT3 homolog 3, Sentrin, Ubiquitin-homology domain protein PIC1, Ubiquitin-like protein SMT3C, Smt3C, Ubiquitin-like protein UBL1) is encoded by the SUMO1 (also known as SMT3C, SMT3H3, UBL1, OK/SW-cl.43) gene (Gene ID: 7341) in human. SUMO-1 is a ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in many cellular processes, such as nuclear transport, DNA replication and repair, mitosis and signal transduction. SUMO-1 can also covalently attach to the voltage-gated potassium channel KCNB1; this modulates the gating characteristics of KCNB1. Polymeric SUMO-1 chains are shown to be susceptible to polyubiquitination, which functions as a signal for proteasomal degradation of modified proteins. Two isoforms of SUMO-1 have been reported that are produced by alternative splicing. Mutations in SUMO1 gene are known to cause non-syndromic orofacial cleft 10, which is a birth defect consisting of cleft lips with or without cleft palate.
Specificity
Clone 21C7 detects SUMO-1 in multiple species. It targets an epitope with in 11 amino acids from the internal region.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SUMO-1 Antibody, clone 21C7

eCl@ss:	32160702
NACRES:	NA.41

His-tagged full length human recombinant Small ubiquitin-related modifier 1 (SUMO-1).

Immunohistochemistry Analysis: A representative lot detected SUMO-1 in Immunohistochemistry applications (Rogers, R.S., et. al. (2004). Chromosoma. 113(5):233-43; Costa, M.W., et. al. (2011). PLoA One. 6(9):e24812).
Immunocytochemistry Analysis: A representative lot detected SUMO-1 in Immunocytochemistry applications (Matunis, M.J., et. al. (1996). J Cell Biol. 135(6 Pt 1):1457-70; Zhang, X.D., et. al. (2008). Mol Cell. 29(6):729-41).
Immunoprecipitation Analysis: A representative lot immunopprecipitated SUMO-1 in Immunoprecipitation applications (Costa, M.W., et. al. (2011). PLoA One. 6(9):e24812; Becker, J., et. al. (2013). Nat Struct Mol Biol. 20(4):525-31; Girach, F., et. al. (2013). Cell Rep. 5(5):1294-301; Chanda, A., et. al. (2017). PLoS One. 12(5):e0177639).
Western Blotting Analysis: A representative lot detected SUMO-1 in Western Blotting applications (Zhang, X.D., et. al. (2008). Mol Cell. 29(6):729-41; Matunis, M.J., et. al. (1996). J Cell Biol. 135(6 Pt 1):1457-70; Rogers, R.S., et. al. (2004). Chromosoma. 113(5):233-43; Costa, M.W., et. al. (2011). PLoA One. 6(9):e24812; Becker, J., et. al. (2013). Nat Struct Mol Biol. 20(4):525-31).
Immunofluorescence Analysis: A representative lot detected SUMO-1 in Immunofluorescence applications (Girach, F., et. al. (2013). Cell Rep. 5(5):1294-301; Rogers, R.S., et. al. (2004). Chromosoma. 113(5):233-43; Matunis, M.J., et. al. (1996). J Cell Biol. 135(6 Pt 1):1457-70).
Research Category
Signaling
Anti-SUMO-1, clone 21C7, Cat. No. MABS2071, is a mouse monoclonal antibody that detects Small ubiquitin-related modifier 1 (SUMO-1) and has been tested for use in Immunocytochemistry, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in HCT116 cell lysate.
Western Blotting Analysis: 4 µg/mL of this antibody detected SUMO-1 in HCT116 cell lysate.
Target description
~17 kDa observed; 11.56 kDa calculated. SUMO-1/RanGAP1 band is observed AT ~ 75 kDa Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	21C7, monoclonal
species reactivity	rat, chicken, mouse, fish, zebrafish, human, Xenopus
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001005781,
UniProt accession no.	P63165,
Gene Information	human ... SUMO1(7341)

Small ubiquitin-related modifier 2 (UniProt P61956; also known as HSMT3, Sentrin-2, SMT3 homolog 2, Smt3B, SUMO-2, Ubiquitin-like protein SMT3B) and 3 (UniProt P55854; also known as SMT3 homolog 1, Smt3A, SUMO-3, Ubiquitin-like protein SMT3A) are encoded by the SUMO2 (also known as SMT3B, SMT3H2; Gene ID 6613) and SUMO3 (also known as SMT3A, SMT3H1; Gene ID 6612) genes in human. SUMOylation, protein post-translation modification by small ubiquitin-like modifier (SUMO), is a signaling event in many cellular processes. SUMO proteins are translated as immature precursors and subsequently converted to their mature forms through the activity of sentrin/SUMO-specific proteases (SENPs). SUMOylation is a reversible process. SUMO E1 activating enzyme, E2 conjugating enzyme, and E3 ligase mediate SUMOylation of substrate proteins, while SENPs are responsible for the de-SUMOylation. SUMOylation usually occurs at lysine residues in the consensus KxD/E motif, although not all such lysines become SUMOylated and SUMOylation can also occur on lysine residues outside of this motif. SUMO2 and 3 share 97% identity at the amino acid level, while SUMO1 shares only about 50% sequence homology with SUMO-2 and 3. In addition to difference in their target substrates, SUMO2/3 can be SUMOylated and form chains, whereas SUMO1 cannot and may serve as chain terminator. SUMO-2 can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Its covalent attachment to its substrate via an isopeptide bond requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2, CBX4 or ZNF451. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Although SUMO-2 functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system, however, unlike ubiquitin which targets proteins for degradation, SUMO-2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus (aa 94-95; propeptide) have been cleaved off.
Specificity
Clone 8A2 detects SUMO-2/3 in human cells.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SUMO-2/3 Antibody, clone 8A2

eCl@ss:	32160702
NACRES:	NA.41

GST-tagged full length recombinant human SUMO-2 protein.

Anti-SUMO-2/3, clone 8A2, Cat. No. MABS2039, is a mouse monoclonal antibody that detects SUMO-2 and SUMO-3 and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Signaling
Western Blotting Analysis: A representative lot detected SUMO-2/3 in Western Blotting applications (Zhang, X.D., et. al. (2008). Mol Cell. 29(6):729-41; Zhu, S., et. al. (2009). Mol Cell. 33(5):570-80).
Immunoprecipitation Analysis: A representative lot detected SUMO-2/3 in Immunoprecipitation applications (Zhu, S., et. al. (2009). Mol Cell. 33(5):570-80).
Western Blotting Analysis: A 1:500 dilution from a representative lot detected SUMO-2/3 in HeLa cell lysate (Courtesy of Christine Lee, Matunis Lab, John Hopkins University, Baltimore, Maryland USA).
Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected SUMO-2/3 in HeLa cells (Courtesy of Christine Lee, Matunis Lab, John Hopkins University, Baltimore, Maryland USA).
Immunocytochemistry Analysis: A representative lot detected SUMO-2/3 in Immunocytochemistry applications (Zhang, X.D., et. al. (2008). Mol Cell. 29(6):729-41; Rao, H.B., et. al. (2017) Science. 355(6323):403-407).
Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected SUMO-2/3 in HeLa cells.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 4 µg/mL of this antibody detected SUMO-2/3 in HeLa cell lysate.
Target description
~19 kDa observed; 10.87 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	8A2, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_008867.2,","NP_008868.3,
UniProt accession no.	P55854,","P61956,
shipped in	ambient
Gene Information	human ... SUMO2(6613)

The SOD2 (superoxide dismutase 2) gene is mapped to human chromosome 6q25.3. The encoded protein functions as a tetramer and is localized to mitochondria.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-Superoxide Dismutase (MnSOD) (DD-17)Cy3 antibody produced in rabbit

synthetic peptide corresponding to amino acid residues 183-199 of human superoxide dismutase (MnSOD), conjugated to KLH. The corresponding sequence is conserved in many eukaryotes.

Anti-Superoxide Dismutase (MnSOD) (DD-17)-Cy3 antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions
Superoxide dismutase 2 (SOD2) is an antioxidant enzyme and catalyzes the conversion of superoxide to hydrogen peroxide and molecular oxygen. The enzyme offers protection against oxidative damage induced by reactive oxygen species and is also radioprotective. The gene is associated with the metastasis and invasion process of salivary adenoid cystic carcinoma. Manganese SOD is involved in detoxification.
Physical form
Solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µL
concentration	1-2 mg/mL
application(s)	direct immunofluorescence: 2-5 µg/mL using human HeLa, rat NRK and mouse 3T3 cells.
conjugate	CY3 conjugate
UniProt accession no.	P04179,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SOD2(6648)

Superoxide Dismutase (SOD) is a family of metalloenzymes widely distributed in both plants and animals. Superoxide dismutases appear to protect cells against reactive free radicals by scavenging the superoxide radicals produced by ionization radiation or through other mechanisms. SOD enzyme catalyzes the conversion of single electron reduced species of molecular oxygen to hydrogen peroxide and oxygen. There are several classes of SOD that differ in their metal binding ability, distribution in different cell compartments, and sensitivity to various reagents. Among these, Cu, Zn superoxide dismutase (SOD1) is widely distributed and comprises 90% of the total SOD. This ubiquitous enzyme, which requires Cu and Zn for its activity, has great physiological significance and therapeutic potential.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Superoxide Dismutase (SOD) antibody, Mouse monoclonal

recombinant human copper-zinc superoxide dismutase (Cu-Zn-SOD).

Monoclonal Anti-Superoxide Dismutase (SOD) recognizes natural (human erythrocyte SOD), recombinant SOD (human Cu-Zn-SOD and human placental SOD) and the enzymatically inactive form of these enzymes. Reactivity has been observed with SOD from human, rat and dog origin, no reactivity was observed with SOD from bovine, bacillus stearothermophilus or E. coli (Fe or Mn) origin. The antibody is recommended to use in various immunological techniques, including ELISA, Immunohistochemistry and immunofluorescence.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.

This product is for R&D use only, not for drug, household, or other uses.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	SD-G6, monoclonal
form	buffered aqueous solution
species reactivity	rat, human, canine
packaging	antibody small pack of 25 µL
application(s)	indirect ELISA: 0.3-0.6 µg/mL using 5µg/ml Superoxide Dismutase from human erythrocytes for coating
isotype	IgG1
UniProt accession no.	P00441,
shipped in	dry ice
storage temp.	20°C

Switch-associated protein 70 (UniProt: Q9UH65; also known as SWAP-70) is encoded by the SWAP70 (also known as KIAA0640, HSPC321) gene (Gene ID: 23075) in human. SWAP-70 is a phosphatidylinositol 3,4,5-trisphosphate (PIP3)-dependent guanine nucleotide exchange factor (GEF) that, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP-70 regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion. It is expressed only in mature B-cells including those associated with mucosa-associated tissue and bronchus-associated tissue. In resting B-cells it is localized mainly in the cytoplasm and upon cell activation it is recruited to the plasma membrane and then translocates to the nucleus. In activated, class-switching B-cells it is associated with membrane IgG, but not IgM. It is also widely expressed in spleen, kidney, lung, and liver. SWAP-70 has an N-terminal putative EF-hand domain, a pleckstrin homology (PH) domain (aa 210-306) that binds phosphatidylinositol 3,4,5-trisphosphate and is responsible for membrane localization, a tri-partite coiled-coil region (aa 316-539), and a C-terminal F-actin-binding site through which it specifically binds non-muscle actin. (Ref.: Chacn-Martnez, CA et al. (2103). J. Biol. Chem. 288(40); 28687-28703).
Specificity
This rabbit polyclonal antibody detects human Switch-associated protein 70. It targets an epitope with in 12 amino acids from the N-terminal region.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SWAP-70

KLH-conjugated linear peptide corresponding to 12 amino acids from the N-terminal region of human Switch-associated protein 70.

Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected SWAP-70 in human tonsil and human lung tissue sections.
Anti-SWAP-70, Cat. No. ABC1688, is a rabbit polyclonal antibody that detects Switch-associated protein 70 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in Raji cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected SWAP-70 in Raji cell lysate.
Target description
~70 kDa observed; 69.00 kDa calculated. Uncharacterized bands may be observed in some lysate(s).

Concentration: Please refer to lot specific datasheet.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
species reactivity (predicted by homology)	bovine (based on 100% sequence homology), mouse (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
NCBI accession no.	NP_001284643,
UniProt accession no.	Q9UH65,
Gene Information	human ... SWAP70(23075)

Synemin is a 230kDa intermediate filament protein (IFp). It is expressed along with desmin and vimentin filaments in muscle cells. In mouse, synemin is encoded by the gene mapped in B5 region of chromosome 7. Alternative splicing of this gene produces three different isoforms with different molecular mass namely, high (180kDa), medium (150kDa) and low (41kDa). High and medium isoforms are expressed in embryonic mouse, whereas, low molecular weight protein is expressed in adult mouse. Synemin comprises 310-amino acid rod domain characteristic of IF proteins and 1,290 amino acid tail domain at its C- terminal.
Synemin exists in two isoforms, α and β.
Specificity
Anti-Synemin (C-terminal region) specifically recognizes rat synemin.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Synemin (C-terminal region) antibody produced in rabbit

Anti-Synemin (C-terminal region) antibody produced in rabbit is suitable for immunoblotting.
Biochem/physiol Actions
α-Synemin is essential for the stabilization of junctional complexes at sarcolemma, in neonates. β-Synemin controls the connection of desmin with Z-disks. Synemin is also involved in protein phosphorylation, for regulating key signaling cascades in the heart. Mild myopathy has been observed in synemin knockout mice.
Synemin in association with either desmin or vimentin plays a vital role in cytoskeletal organization and also facilitates function of intermediate filaments in erythrocytes and muscle. Interaction of synemin and vinculin aids in attachment of intermediate filaments (Ifs) to the cell membrane.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at -20 °C.For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers,is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation.Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	~170 kDa
species reactivity	rat
packaging	antibody small pack of 25 μL
concentration	~1.5 mg/mL
application(s)	western blot: 1.5-3.0 μg/mL using using rat bladder extract (S1 fraction).
conjugate	unconjugated
shipped in	dry ice
storage temp.	−20°C
Gene Information	rat ... Synm(233335)

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-T antibody produced in rabbit

HPA003322 Human Protein Atlas characterization data

Brachyury protein recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
T gene encodes a protein called Brachyury protein that belongs to the T-box family of transcription factors. It plays an essential role in the formation and differentiation of the mesoderm and the axial development during embryogenesis of all vertebrates. It binds to a specific palindromic T-site in the DNA via its N-terminus region called the T-box and regulates transcription of certain genes. Polymorphism in the gene has been associated with a risk of spina bifida. It plays an important role in notochord development and a duplication of this gene confers major susceptibility to familial chordoma. Defects in the gene cause SAVA (Sacral agenesis with vertebral anomalies) characterized by sacral agenesis, abnormal ossification of the vertebral bodies and a persistent notochordal canal.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84792,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL
immunogen sequence	QQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQY
conjugate	unconjugated
UniProt accession no.	O15178,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... T(6862)

TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (UniProt: Q9NYJ8; also known as Mitogen-activated protein kinase kinase kinase 7-interacting protein 2, TAK1-binding protein 2, TAB-2, TGF-beta-activated kinase 1-binding protein 2) is encoded by the TAB2 (also known as KIAA0733, MAP3K7IP2) gene (Gene ID: 23118) in human. TAB-2 is a peripheral membrane protein that serves as an adapter protein that links MAP3K7/TAK1 and TRAF6. Two isoforms of TAB-2 have been reported that are produced by alternative splicing. TAB-2 promotes MAP3K7 activation in the IL-1 signaling pathway. Following IL-1 stimulation it translocates from the membrane to cytosol. TAB-2 is widely expressed. In the embryo, it is expressed in the ventricular trabeculae, endothelial cells of the conotruncal cushions of the outflow tract and in the endothelial cells lining the developing aortic valves. TAB-2 contains a RanBP2-type zinc finger domain (aa 663-693) that mediates binding to two consecutive Lysine 63-linked ubituitins. The binding of Lysine 63-linked polyubiquitin chains to TAB-2 promotes autophosphorylation of MAP3K7 at Threonine 187. Mutations in TAB2 gene are reported to cause multiple congenital heart defects characterized by congenital developmental abnormalities involving structures of the heart, including left ventricular outflow tract obstruction, sub-aortic stenosis, atrial fibrillation, bicuspid aortic valve and aortic dilation.
Specificity
Clone 1D5.2 specifically detects human TGF-beta-activated kinase 1 and MAP3K7-binding protein 2. It targets an epitope within 133 amino acids from the C-terminal region.

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-TAB-2 Antibody, clone 1D5.2

GST/His-tagged recombinant fragment corresponding to 133 amino acids from the C-terminal region of human TAK1-binding protein 2 (TAB-2)

Western Blotting Analysis: 1 µg/mL from a representative lot detected TAB-2 in 10 µg of Raji cell lysate.
Anti-TAB-2, clone 1D5.2, Cat. No. MABS1894, is a mouse monoclonal antibody that detects TAK1-binding protein 2 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in TF-1 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected TAB-2 in 10 µg of TF-1 cell lysate.
Target description
~77 kDa observed; 76.49 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	1D5.2, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001278963,
UniProt accession no.	Q9NYJ8,
Gene Information	human ... TAB2(23118)

TATA-binding protein-associated factor 2N (UniProt: Q92804; also known as 68 kDa TATA-binding protein-associated factor, TAF(II)68, TAFII68, RNA-binding protein 56, TAF15) is encoded by the TAF15 (also known as RBP56, TAF2N) gene (Gene ID: 8148) in human. TAF15 is a ubiquitously distributed protein that is found in all fetal and adult tissues. It is a RNA and ssDNA-binding protein that plays specific roles during transcription initiation at distinct promoters and can enter the preinitiation complex together with the RNA polymerase II (Pol II). TAF15 shuttles between the nucleus and the cytoplasm. It can be dimethylated by protein arginine N-methyltransferase 1 (PRMT1) at Arg206 to asymmetric dimethylarginine. This methylation favors its nuclear localization and it also considered to be essential for its gene regulatory function. TAF15 contains an N-terminal activation domain, an RNA recognition motif (RRM) and many Arg-Gly-Gly (RGG) repeats at its C-terminal end. Its N-terminus serves as an essential transforming domain in the fusion oncoprotein created by chromosomal translocation in certain human chondrosarcomas. Depletion of TAF15 has a growth-inhibitory effect and results in increased apoptosis. (Ref.: Ballarino, M et al. (2013). Oncogene 32(39); 4646-4655; Jobert, L., et al. (2008). Exp. Cell res. 315(7);1273-1286).
Specificity
Clone 12F11 is a rat monoclonal antibody that detects human TATA-binding protein-associated factor 2N (TAF15). It targets an epitope with in 20 amino acids from the C-terminal half.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-TAF-15 Antibody, clone 12F11

Ovalbumin-conjugated linear peptide corresponding to 20 amino acids from the C-terminal half of human TATA-binding protein-associated factor 2N (TAF15).

Anti-TAF-15, clone 12F11, Cat. No. MABE1918, is a highly specific rat monoclonal antibody that targets TATA-binding protein-associated factor 2N and has been tested for use in ELISA and Western Blotting.
Western Blotting Analysis: A representative lot detected TAF-15 in Western Blotting applications (Suarez-Calvet, M., et. al. (2016). Acta Neuropathol. 131(4):587-604).
ELISA Analysis: A representative lot detected TAF-15 in ELISA applications (Suarez-Calvet, M., et. al. (2016). Acta Neuropathol. 131(4):587-604).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected TAF-15 in HEK293 cell lysate.
Target description
~68 kDa observed; 61.83 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified rat monoclonal antibody IgG2c in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	12F11, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","western blot: suitable
isotype	IgG2c
NCBI accession no.	NP_631961.1,
UniProt accession no.	Q92804,
Gene Information	human ... TAF15(8148)

CD81 antigen (UniProt: P60033; also known as 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28, Tspan-28, CD81) is encoded by the CD81 (also known as TAPA1, TSPAN28) gene (Gene ID: 975) in human. TAPA-1 is a nonglycosylated, homodimeric, multi-pass membrane protein of the tetraspanin (TM4SF) family. It is expressed in a wide range of cells, including hematolymphoid, neuroectodermal, and mesenchymal tumor cell lines and is reported to play a role in the regulation of lymphoma cell growth. It contains four transmembrane domains, two extracellular loops, and short amino and carboxyl termini that are intracellular. TAPA-1 is shown to affect cell adhesion, morphology, activation, proliferation, and differentiation of B, T, and other cells. On B cells it is a part of a complex involving CD21, CD19, and Leu13 and this complex is reported to reduce the threshold for B cell activation via the B cell receptor by bridging antigen specific recognition and CD21-mediated complement recognition. On T cells, it is shown to associate with CD4 and CD8 and provides a costimulatory signal with CD3. It is also reported to act as a receptor for hepatitis C virus (HCV) in hepatocytes. Mutations in CD81 gene cause common variable immunodeficiency 6 (CVID6) that is characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections, and an inability to mount an antibody response to antigen. (Levy S., et al. (1998). Annu. Rev. Immunol.16; 89-109; Oren, R., et al. (1990). Mol. Cell Biol. 10(8); 4007-15).
Specificity
Clone 5A6 detects TAPA-1 (CD81) in human cells.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-TAPA-1 (CD81) Antibody, clone 5A6

eCl@ss:	32160702
NACRES:	NA.41

OCI-LY8 whole cells (Cellosaurus cell line).

Anti-TAPA-1 (CD81), clone 5A6, Cat. No. MABF2061, is a mouse monoclonal antibody that detects TAPA-1 (CD81) and has been tested for use in Flow Cytometry, Inhibition assay, Immunoprecipitation and Western Blotting.
Western Blotting Analysis: A representative lot detected TAPA-1 (CD81) in Western Blotting applications (Clark, K.L., et. al. (2004). J Biol Chem. 279(19):19401-6).
Immunoprecipitation Analysis: A representative lot immunoprecipitated TAPA-1 (CD81) in Immunoprecipitation applications (Clark, K.L., et. al. (2004). J Biol Chem. 279(19):19401-6; Oren, R., et. al. (1990). Mol Cell Biol. 10(8):4007-15).
Flow Cytometry Analysis: A representative lot detected TAPA-1 (CD81) in Flow Cytometry applications (van Zelm, M.C., et. al. (2010). J Clin Invest. 120(4):1265-74; Oren, R., et. al. (1990). Mol Cell Biol. 10(8):4007-15).
Inhibition: A representative lot inhibited the growth and proliferation of OCI-LY8 cell line. (Oren, R., et. al. (1990). Mol Cell Biol. 10(8):4007-15).
Research Category
Inflammation & Immunology
Quality
Evaluated by Flow Cytometry in HUH-7 cells.
Flow Cytometry Analysis: 1 µg of this antibody detected TAPA-1 (CD81) in one million HUH-7 cells.
Target description
25.81 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG1 containing PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	5A6, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	flow cytometry: suitable","immunoprecipitation (IP): suitable","inhibition assay: suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_001284578,
UniProt accession no.	P60033,
shipped in	ambient
Gene Information	human ... CD81(975)

Tapasin (UniProt: Q9R233; also known as TPN, TPSN, TAP-associated protein, TAP-binding protein) is encoded by the Tapbp (also known as Tapa) gene (Gene ID: 21356) in the murine species. Tapasin is a single-pass type I membrane glycoprotein protein that is involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide. It is synthesized with a signal peptide of 23 amino acids, which is subsequently cleaved to generate mature Tapasin. It assists in loading of antigenic peptides on to class I molecules in the endoplasmic reticulum (ER). It is also reported to support the binding of high-affinity peptides to MHC class I in conjunction with ERp57. Defects in Tapasin expression are linked to destabilization of the MHC class I loading complex and diminution in the expression of MHC molecules at the cell surface. Tapasin is reportedly down-regulated in several human carcinomas and its re-expression in Tapasin-deficient cancer cells restores the expression of MHC class I antigen complexes and augment cancer cell immunogenicity, which helps in longer survival in animals bearing metastatic tumors. (Ref.: Lou, Y et al. (2008). Clin Cancer Res. 14(5); 1494-1501).
Specificity
This rabbit polyclonal antibody detects Tapasin in murine cells. It targets an epitope within 20 amino acids from the C-terminal region.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-Tapasin

eCl@ss:	32160702
NACRES:	NA.41

Epitope: C-terminus
KLH-conjugated linear peptide corresponding to 20 amino acids from the C-terminal region of murine Tapasin.

Anti-Tapasin Antibody, Cat. No. ABF1067, is a rabbit polyclonal antibody that detects Tapasin in murine cells and has been tested for use in Immunoprecipitation and Western Blotting.
Immunoprecipitation Analysis: A representative lot detected Tapasin in K42 cells (Lum, R., et. al. (2016). J Biol Chem. 291(37):19631-41) and L-cells and BW5147 thymoma cells (Suh, W.K., et. al. (1999). J Immunol. 162(3):1530-40).
Western Blotting Analysis: A representative lot detected Tapasin in CMT.64 cells treated with IFN- (Lou, Y., et. al. (2008). Clin Cancer Res. 14(5):1494-501).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in NIH/3T3 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Tapasin in 10 µg of NIH/3T3 cell lysate.
Target description
~51 kDa observed; 49.74 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse
packaging	antibody small pack of 25 µL
application(s)	immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_033344,
UniProt accession no.	Q9R233,

The transactivating response (TAR) RNA-binding protein (TRBP) (also known as TARBP2) gene is mapped to human chromosome 12q13.13. The encoded protein exists in two isoforms, TRBP1 and TRBP2, where TRBP2 has 21 additional amino acids. It is composed of two double stranded RNA binding domains (dsRBDs), a KR-helix motif within dsRBD2 and a Medipal domain that binds Moesin-ezrin-radixin-like protein (Merlin), Dicer and protein activator of the interferon-induced protein kinase (PACT). TRBP is a component of the RNA-induced silencing complex (RISC) loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), composed of Dicer and argonaute (Ago).
Specificity
Anti-TRBP2 recognizes human TRBP2.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-TARBP2 antibody produced in rabbit

MDL number:	MFCD08705573
NACRES:	NA.41

synthetic peptide corresponding to amino acids 183-195 of human TRBP2 conjugated to KLH. The corresponding sequence is identical in mouse and rat.

Anti-TARBP2 has been used in immunoblotting and might also be used in immunofluorescence.
Biochem/physiol Actions
The transactivating response (TAR) RNA-binding protein (TRBP) (also known as TARBP2) binds and activates the human immunodeficiency virus (HIV)-1 with TAR RNA. It plays a role in spermatogenesis, cell growth, oncogenesis and viral replication. Targeted disruption of the TARBP2 gene, causes growth defects, sterility problems and severe oligospermic effects in mice.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing is not recommended. Storage in “frost-free” freezers is also not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

antibody form	affinity isolated antibody
Quality Level	200
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~30 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	indirect immunofluorescence: 2.5-5 µg/mL using paraformaldehyde fixed HeLa cells","western blot: 2-4 µg/mL using lysates of HEK-293T cells
conjugate	unconjugated
UniProt accession no.	Q15633,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... TARBP2(6895) mouse ... 21357(21357) rat ... Tarbp2(363006)

NONH for all modes of transport

RIDADR

Узнать цену

Подробнее

Anti-TARDBP antibody produced in rabbit

HPA017284 Human Protein Atlas characterization data

TARDBP (TAR DNA binding protein) is a nuclear localized, heterogeneous, highly conserved ribonucleo protein. It is widely expressed in tissues, including heart, lung, liver, spleen, kidney, muscle, and brain. It consists of two RNA-recognition motifs and a glycine-rich C-terminal sequence.

TAR DNA-binding protein 43 recombinant protein epitope signature tag (PrEST)

Anti-TARDBP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
TARDBP (TAR DNA binding protein) functions as a transcriptional gene and is involved in various processes such as RNA splicing of the cystic fibrosis transmembrane conductance regulator gene. It has been reported that TARDBP may play an important role in neurodegeneration. Abnormal aggregation of TARDBP causes an adult-onset neurological disorder, amyotrophic lateral sclerosis (ALS), that leads to the degeneration of motor neurons.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71040,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN
conjugate	unconjugated
UniProt accession no.	Q13148,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... TARDBP(23435)

Microtubule-associated protein tau (UniProt: P10636; also known as Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau) is encoded by the MAPT (also known as MAPTL, MTBT1, TAU) gene (Gene ID: 4137) in human. Microtubule-associated protein tau is shown to be expressed in neurons. It is mostly found in axons, in the cytosol, and in association with plasma membrane components. Nine isoforms of Tau have been described that are generated by alternative splicing. Tau proteins promote microtubule assembly and stability and may also be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, thus serving as a linker protein between both. The short isoforms are reported to allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. In Alzheimer disease (AD), the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments (PHF) and straight filaments, mainly composed of hyperphosphorylated forms of Tau. In AD brain Tau accumulates in both the somatodendritic and axonal domains of neurons and it also accumulates in the soma as neurofibrillary tangles (NFTs). Tau oligomers are reported to be neurotoxic when applied extracellularly to cultured neuronal cells and can induce neurodegeneration and synaptic and mitochondrial dysfunction in vivo. It has been reported that most of the C-terminus of Tau (aa 243-406) in PHFs can be cleaved by trypsin, however the TauC4 region is highly resistant to trypsin action. (Ref.: Taniguchi Watanabe, S., et al. (2016). Acta Neuropathol. 131(2); 267-280; Ando K., et al. (2010). Biochem. Soc. Trans. 38(4); 1001-1005).
Specificity
This rabbit polyclonal antibody specifically detects TauC4 region in human Tau protein.

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Узнать цену

Подробнее

Anti-Tau (TauC4 Antibody, 354-369)

KLH-conjugated linear peptide corresponding to 16 amino acids from the C-terminal half of human Microtubule-associated protein tau, isoform 8 (Tau-F).
Epitope: unknown

Research Category
Neuroscience
Western Blotting Analysis: A representative lot detected Tau (TauC4, 354-369) in Western Blotting applications (Fitzpatrick, A.W.P., et. al. (2017) Nature. 547(7662):185-190; Taniguchi-Watanabe, S., et. al. (2016). Acta Neuropathol. 131(2):267-280).
Electron Microscopy Analysis: A representative lot detected Tau (TauC4, 354-369) in Immunogold negative-stain Electron Microscopy applications (Fitzpatrick, A.W.P., et. al. (2017) Nature. 547(7662):185-190).
Anti-Tau (TauC4, 354-369), Cat. No. ABN2178, is a highly specific rabbit polyclonal antibody that targets TauC4 region of Tau and has been tested for use in Electron Microscopy and Western Blotting.
Quality
Evaluated by Western Blotting in Recombinant full-length 4-repeat (4R) tau (human 4R1N).
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected TauC4 region in full length recombinant human tau (human 4R1N).
Target description
~55 kDa observed; 45.85 kDa calculated.
Physical form
Rabbit polyclonal antiserum with 0.1% sodium azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Microtubule-associated protein tau (UniProt: P10636; also known as Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau) is encoded by the MAPT (also known as MAPTL, MTBT1, TAU) gene (Gene ID: 4137) in human. Microtubule-associated protein tau is shown to be expressed in neurons. It is mostly found in axons, in the cytosol, and in association with plasma membrane components. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system. Nine isoforms of Tau have been described that are generated by alternative splicing. Tau proteins promote microtubule assembly and stability, and may also be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, thus serving as a linker protein between both. The short isoforms are reported to allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. In Alzheimer disease (AD), the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments (PHF) and straight filaments, mainly composed of hyperphosphorylated forms of Tau. In AD brain Tau accumulates in both the somatodendritic and axonal domains of neurons and it also accumulates in the soma as neurofibrillary tangles (NFTs). Tau oligomers are reported to be neurotoxic when applied extracellularly to cultured neuronal cells and can induce neurodegeneration and synaptic and mitochondrial dysfunction in vivo.
Specificity
Clone 2A1-2E1 detects Microtubule-associated protein tau in human and murine brain. It targets an epitope within 19 amino acids from the N-termnal half.

biological source	rabbit
antibody form	serum
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human
species reactivity (predicted by homology)	rat (based on 100% sequence homology), mouse (based on 100% sequence homology)
packaging	antibody small pack of 25 µL
application(s)	electron microscopy: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_005901,
UniProt accession no.	P10636-8,

Узнать цену

Подробнее

Anti-Tau Antibody, clone 2A1-2E1

KLH-conjugated linear peptide corresponding to 19 amino acids from the N-terminal half of human Microtubule-associated protein tau.

Anti-Tau, clone 2A1-2E1, Cat. No. MABN2472, is a highly specific mouse monoclonal antibody that targets Microtubule-associated protein tau and has been tested for use in Immunohistochemistry and Western Blotting.
Research Category
Neuroscience
Western Blotting Analysis: A representative lot detected Tau in Western Blotting applications (Ishigaki, S., et. al. (2017). Cell Rep. 18(5):1118-1131).
Immunohistochemistry Analysis: A representative lot detected Tau in Immunohistochemistry applications (Ishigaki, S., et. al. (2017). Cell Rep. 18(5):1118-1131).
Quality
Evaluated by Western Blotting in human Tau-441 recombinant protein lysates.
Western Blotting Analysis: 2 µg/mL of this antibody detected Tau in human Tau-441 recombinant protein lysates.
Target description
~70 kDa observed; 78.93 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	2A1-2E1, monoclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_058519,
UniProt accession no.	P10636,

Tau is a family of microtubule-associated proteins thought to regulate the stability and organization of microtubules in neuronal cells. The tau protein family is derived from alternative mRNA splice variants that originate from a single gene, and result in mature proteins that vary in size from 352 to 441 amino acids (45 to 60 kDa). Tau loses microtubule-binding activity and aggregates into paired helical filaments (PHFs) in neurodegenerative disorders. PHFs are the basic structural components of neurofibrillary tangles (NFTs). NFT accumulation correlates with the clinical progression of Alzheimer′s disease. Phosphorylation can affect the functional properties of tau and hyperphosphorylation of tau may result in the loss of taus microtubule binding activity and the formation of the insoluble aggregates. Hyperphosphorylation and nonenzymatic glycosylation are posttranslational modifications detected in PHF-tau, and numerous sites of hyperphosphorylation of both normal and PHF-tau have been identified.
Tau (τ), also known as MAPT (microtubule associated protein tau), is encoded by the gene mapped to human chromosome 17q21.3. It is highly expressed in neurons, but is most prominent in axons.
Specificity
Mouse monoclonal clone Tau46 anti-Tau antibody recognizes bovine, rat, human, and mouse Tau (approx. 45 to 60 kDa). The antibody recognizes a phosphorylation-independent epitope in amino acids 404-441 (human). The antibody recognizes all six isoforms of Tau and may cross react with MAP2 protein.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Tau antibody, Mouse monoclonal

MDL number:	MFCD07370943
NACRES:	NA.41

bovine Tau.

Anti-Tau antibody, Mouse monoclonal has been used in western blotting.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Mouse monoclonal clone Tau46 anti-Tau antibody is useful in ELISA, immunoblotting, immunogold labeling, immunopreciptation as well as immunohistochemistry. It is used as a probe to determine the presence and roles of Tau protein in the regulation of the stability and organization of microtubules in neuronal cells.
Biochem/physiol Actions
Tau (τ) plays an essential role in the assembly and maintenance of microtubule structure. Deletion of tau (τ) results in developmental delay and learning disability. The gene expression is associated with the development of Alzheimer′s disease (AD). Genetic variation in τ gene increases the risk of susceptibility to the sporadic tauopathies, progressive supranuclear palsy (PSP) and corticobasal degeneration.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	Tau46, monoclonal
form	buffered aqueous solution
species reactivity	bovine, rat, human, mouse
packaging	antibody small pack of 25 µL
concentration	~2 mg/mL
application(s)	immunohistochemistry: suitable","immunoprecipitation (IP): suitable","indirect ELISA: suitable","microarray: suitable","western blot: 0.5-1 µg/mL using mouse brain extract
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	P10636,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... MAPT(4137) mouse ... Mapt(17762) rat ... Mapt(29477)

Tau, a microtubulebinding protein which serves to stabilize microtubules in growing axons, is found to be hyperphosphorylated in paired helical filaments (PHF), the major fibrous component of neurofibrillary lesions associated with Alzheimer’s disease. Hyperphosphorylation of Tau is thought to be the critical event leading to the assembly of PHF. Six Tau protein isoforms have been identified, all of which are phosphorylated by glycogen synthase kinase 3 (GSK 3). Cellular and subcellular localization: In situ, anti-tau-1 has a stringent specificity for the axons of neurons. The antibody does not stain the cell bodies or dendrites of neurons, nor does it stain any other cell type (4). However, this in vivo intracellular specificity is not maintained in culture: anti-tau-1 stains the axon, cell bodies, and dendrites of rat hippocampal neurons grown in culture (5). The specificity of anti-tau-1 was originally thought to represent the restricted expression of tau to axons. Later studies revealed that this specificity is dependant on the state of phosphorylation. In dephosphorylated samples (samples treated with alkaline phosphatase) anti-tau-1 stains astrocytes, perineuronal glial cells, and the axons, cell bodies and dendrites of neurons, while in untreated samples, anti-tau-1 stains only axons (6). (The epitope recognized by anti-tau-1 is probably at or near a phosphorylated site.)
Specificity
Binds to all known electrophoretic species of tau in human, rat and bovine brain (one-dimensional SDS-PAGE). However there is some unphosphorylated bias with clone PC1C6 as it seem to recognize only dephosphorylated serine sites at 195, 198, 199, and 202 {Szendrei, et al 1993; http://www.ncbi.nlm.nih.gov/entrez/query.fcgi-cmd=Retrieve&db=pubmed&dopt=Abstract&list_uids=7680727}. Also see Billingsley & Kincaid, 1997 Biochem J 323:577-591 for additional mapping information on PC1C6.

RIDADR	NONH for all modes of transport
WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Tau-1 Antibody, clone PC1C6

eCl@ss:	32160702
NACRES:	NA.41

Purified denatured bovine microtubule associated proteins.

Western blot: Bovine brain microtubule proteins purified by two cycles of assembly and disassembly (9) are dissolved in SDS-PAGE sample buffer. Five micrograms of the microtuble preparation per lane is loaded onto a 4% to 20% SDS-PAGE gradient gel along side molecular weight markers (14.3 - 200 kD). After separation by electrophoresis, the proteins are blotted onto nitrocellulose. Tau is detected as a series of 5 bands (52-68 kD) with approximately 5 ng/mL of anti-tau1.
Immunofluorescence: A 1:1000 dilution of this antibody detected Tau in mouse primary neurons. (Basnet, N., et al. (2018). Nat. Cell Biol. 20(10); 1172-1180.
Immunohistochemistry: 5 µg/mL; stains axons in tissue primarily, however in culture Tau expression is not restricted to just axons.
Optimal working dilutions must be determined by end user.
Immunohistochemistry Protocol
Dephosphorylation of tissue sections (optional)
Dephosphorylation with alkaline phosphatase is recommended for staining neurofibrillary tangles in Alzheimers brain tissue with anti-tau-1 (6). This treatment changes the staining pattern of anti-tau-1 to include cell bodies, dendrites and axons of neurons. In untreated samples, anti-tau-1 stains axons only.
1. Incubate tissue sections at +32°C for 2.5 hours with constant agitation in the following solution: 100 mM Tris-HCl, pH 8.0; 130 units/mL alkaline phosphatase, 1 mM PMSF, 10 µg/mL pepstatin and 10 µg/mL leupeptin.
2. Rinse sections twice, 3 min per rinse, with 100 mM Tris-HCl, pH 8.0.
Anti-tau-1 staining
1. Block non-specific binding by incubating sections in PBS containing 1% (v/v) normal animal serum, and 0.03% (w/v) Triton X-100. The animal serum should be from the same species as the secondary antibody.
2. Rinse 3 times with PBS, 3 min per rinse.
3. Incubate sections with anti-tau-1, approximately 5 µg/mL, diluted in PBS containing 1% (v/v) normal animal serum.
4. Wash with PBS, changing the solution 3 times over a 3 min period.
5. Detect with a standard secondary antibody detection system (10-13).
Research Category
Neuroscience
Anti-Tau-1 Antibody, clone PC1C6 is an antibody against Tau-1 for use in IH & WB with more than 65 product citations.
Research Sub Category
Neurodegenerative Diseases
Target description
5 bands (52–68 kDa)

Replaces: AB1512
Physical form
Format: Purified
0.02M phosphate buffer, pH 7.6, 0.25M NaCl, and 0.1% sodium azide
Protein A purified
Storage and Stability
Maintain for 1 year at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Alzheimers brain tissue (dephosphorylation with alkaline phosphatase is recommended for staining neurofibrillary tangles in Alzheimer’s brain tissue) or human T98G glioblastoma cells

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

antibody small pack of 25 µg

Торговая марка

Chemicon^®

application(s)

immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable

isotype

IgG2a

NCBI accession no.

NM_005910.3,","NM_016834.2,","NM_016835.2,","NM_016841.2,

UniProt accession no.

Anti-TAZ Antibody, clone 11

WW domain-containing transcription regulator protein 1 (UniProt: Q9EPK5; also known as Transcriptional coactivator with PDZ-binding motif, TAZ) is encoded by the Wwtr1 (also known as Taz) gene (Gene ID: 97064) in murine species. TAZ is an oncogenic transcriptional activator that acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. TAZ is highly expressed in kidney, heart, placenta, and lung tissues. Two isoforms of TAZ have been reported that are produced by alternative splicing. TAZ is concentrated along specific portions of the plasma membrane and also accumulates in punctate nuclear bodies. The ability of TAZ to regulate gene transcription is very tightly regulated through the phosphorylation-dependent binding of 14-3-3 protein. Upon phosphorylation TAZ is retained in cytoplasm by 14-3-3 zeta. Expression of NPHP9 is reported to inhibit the interaction of wild-type TAZ with 14-3-3 and NPHP9 is reported to abolish the phosphorylation of TAZ at Serine 89. TAZ is shown to be involved in non-small-cell lung cancer and its higher expression levels are observed in breast cancer and in breast cancer stem cells. It also regulates embryonic stem-cell self-renewal and promotes cell proliferation and epithelial-mesenchymal transition. TAZ binds to transcription factors via its WW domain, which is localized to amino acids 124-157. Its PZD-binding motif is located in amino acids 389-395 and this motif is essential for stimulated gene transcription.
Specificity
Clone 11 specifically detects WW domain-containing transcription regulator protein 1 (TAZ) in murine species.

His-tagged Recombinant Protein corresponding to Mouse WW domain-containing transcription regulator protein 1 (TAZ).

Western Blotting Analysis: 1 ug/mL from a representative lot detected TAZ in mouse lung tissue lysate.
Immunoprecipitation Analysis: A representative lot immunoprecipitated TAZ in Immunoprecipitation applications (Habbig, S., et. al. (2012). Hum Mol Genet. 21(26):5528-38).
Western Blotting Analysis: A representative lot detected TAZ in Western Blotting applications (Habbig, S., et. al. (2012). Hum Mol Genet. 21(26):5528-38).
ELISA Analysis: A representative lot detected TAZ in ELISA applications (Habbig, S., et. al. (2012). Hum Mol Genet. 21(26):5528-38).
Anti-TAZ, clone 11, Cat. No. MABS1913, is a mouse monoclonal antibody that detects WW domain-containing transcription regulator protein 1 (TAZ) and has been tested for use in ELISA, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in mouse kidney tissue lysate.
Western Blotting Analysis: 1 ug/mL of this antibody detected TAZ in mouse kidney tissue lysate.
Target description
~55 kDa observed; 43.62 and 49.83 kDa for isoform 1 and 2, respectively. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified

Concentration: Please refer to lot specific datasheet.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	11, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_001161753.1,
UniProt accession no.	Q9EPK5,

Monoclonal Anti-TBL1X (mouse IgG2b isotype) is derived from the hybridoma TX22 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a recombinant fusion protein. Transducin β-like protein 1X-linked (TBL1X) belongs to the tryptophan-aspartic acid (WD)-40 repeat proteins. This protein is found as a subunit in the corepressor silencing mediator for retinoid and thyroid receptors (SMRT) complex along with histone deacetylase 3 protein. The TBL1X gene is mapped on the human chromosome at Xp22.31.
Specificity
Monoclonal Anti-TBL1X recognizes human, bovine, and dog TBL1X.

Anti-TBL1X antibody, Mouse monoclonal

Anti-TBL1X antibody, Mouse monoclonal may be used in immunoblotting.
Biochem/physiol Actions
Transducin β-like protein 1X-linked (TBL1X) gene is universal and is obliterated in late-onset sensorineural deafness which is linked to X-linked syndrome of ocular albinism.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2-8 °C for up to one month. For extended storage, freeze at -20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	TX22, monoclonal
form	buffered aqueous glycerol solution
mol wt	antigen ~55 kDa
species reactivity	canine, bovine, human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	western blot: 0.2-0.4 µg/mL using HeLa nuclear cell extracts
conjugate	unconjugated
UniProt accession no.	O60907,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... TBL1X(6907) mouse ... Tbl1x(21372) rat ... Tbl1x(302711)

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Eomesodermin homolog (UniProt: O54839; also known as T-box brain protein 2, T-brain-2, TBR-2) is encoded by the Eomes (also known as Tbr2) gene (Gene ID: 13813) in murine species. T-box genes are a family of transcription factors have a highly conserved DNA binding domain named the T-domain. TBR-2 functions as a transcriptional activator that plays a crucial role during gastrulation, mesodermal specification, and limb patterning. It plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. It is also shown to be involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes. Its DNA-binding region is localized to amino acids 278-458. Conditional inactivation of TBR-2 during early brain development is known to cause microcephaly and severe behavior deficits. Two isoforms of TBR-2 have been described that are produced by alternative splicing. Isoform 2 lacks amino acids 463-481. (Ref.: Bulfone, A., et al. (1999). Mech. Dev. 84 (1-2); 133-138).
Specificity
This rabbit polyclonal antibody detects T-box brain protein 2 (TBR-2) in murine species. It targets an epitope with in 20 amino acids from the C-terminal region.

Anti-TBR-2

eCl@ss:	32160702
NACRES:	NA.41

Conjugated linear peptide corresponding to 20 amino acids from the C-terminal region of murine TBR-2.
Epitope: C-terminus

Immunofluorescence Analysis: A representative lot detected TBR-2 in Immunofluorescence applications (Nelson, B.R., et. al. (2013). J Neurosci. 33(21):9122-39; Hodge, R.D., et. al. (2013). J Neurosci. 33(9):4165-80).
Immunohistochemistry Analysis: A representative lot detected TBR-2 in Immunohistochemistry applications (Yoon, K.J., et. al. (2008). Neuron. 58(4):519-31).
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected TBR-2 in mouse hippocampus, embryonic mouse brain, and embryonic mouse gut tissue sections.
Anti-TBR-2, Cat. No. ABN1687, is a highly specific rabbit polyclonal antibody that targets Eomesodermin homolog (Tbr2) and has been tested in Immunohistochemistry (Paraffin), Immunofluorescence, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in mouse E13-14 brain.
Western Blotting Analysis: A 1:500 dilution of this antibody detected TBR-2 in mouse E13-14 brain.
Target description
~63 kDa observed; 74.80 kDa calculated.
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in PBS with 0.02% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	mouse
species reactivity (predicted by homology)	rat (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG
NCBI accession no.	NP_034266,
UniProt accession no.	O54839,

Tyrosine-protein phosphatase non-receptor type 2 (UniProt: P17706; also known as EC: 3.1.3.48, T-cell protein-tyrosine phosphatase, TCPTP) is encoded by the PTPN2 (also known as PTPT) gene (Gene ID: 5771) in human. TCPTP is a non-receptor type tyrosine-specific phosphatase that dephosphorylates a variety of receptor protein tyrosine kinases. It is also reported to dephosphorylate non-receptor tyrosine kinases, such as JAK 1, 2, 3, Src kinases, STAT1, 3, 5, 5B, and 6. TCPTP is ubiquitously expressed and two isoforms have been reported. Isoform 1 is expressed in T-cells and in placenta and is targeted to the endoplasmic reticulum by its C-terminal hydrophobic region. Isoform 2 is reported to be the major isoform that predominantly localizes to chromatin and is able to shuttle between the nucleus and the cytoplasm and to plasma membrane to dephosphorylate receptors. It doing so it negatively regulates numerous signaling pathways and biological processes, including hematopoiesis, inflammatory response, cell proliferation and differentiation, and glucose homeostasis. It is also reported to play a multifaceted and important role in the development of the immune system. In T-cell receptor signaling, it functions through dephosphorylation of FYN and LCK to control T-cell differentiation and activation. It also dephosphorylates CSF1R and thereby negatively regulates its downstream signaling and macrophage differentiation.
Specificity
Clone 9E9.1 detects human T-cell protein-tyrosine phosphatase. It targets an epitope within 79 amino acids from the C-terminal half.

Anti-TC PTPase (PTPN2) Antibody, clone 9E9.1

eCl@ss:	32160702
NACRES:	NA.41

GST/His-tagged recombinant fragment corresponding to 79 amino acids from the C-terminal half of human T-cell protein-tyrosine phosphatase.

Anti-TC PTPase (PTPN2), clone 9E9.1, Cat. No. MABS1753, is a mouse monoclonal antibody that detects T-cell protein-tyrosine phosphatase and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Signaling
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected TC PTPase (PTPN2) in human liver, human tonsil, and human cervical cancer tissues.
Western Blotting Analysis: 0.5 µg/mL from a representative lot detected TC PTPase (PTPN2) in 10 µg of Jurkat cell lysate.
Quality
Evaluated by Western Blotting in K562 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected TC PTPase (PTPN2) in 10 µg of K562 cell lysate.
Target description
~48 KDa observed; 48.47 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	9E9.1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_002819,
UniProt accession no.	P17706,
shipped in	ambient
Gene Information	human ... PTPN2(5771)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

The H57-597 antibody is specific for the beta chain of the mouse T cell Receptor (TCR). This cell surface protein combines with a second protein chain (alpha chain) to form the alpha-beta TCR that is expressed by NK1.1+ thymocytes, NKT cells, and the majority of peripheral T cells. A small number of T cells may express an alternative heteromer of gamma and delta protein chains, known as the gamma-delta TCR. These receptors participate in a complex with CD3, and with the co-receptors CD4 or CD8, to recognize and respond to antigens bound to MHC molecules on antigen-presenting cells. Such interactions promote T cell receptor signaling (T cell activation) and can result in a number of cellular responses including proliferation, differentiation, production of cytokines or activation-induced cell death. The H57-597 antibody is used as a phenotypic marker for T cells expressing the alpha-beta TCR. It is also widely used to cross-link surface TCR and thereby mimic TCR-mediated cell activation or induction of apoptosis. The antibody does not cross-react with cells expressing the gamma-delta TCR.

Anti-TCR beta chain (mouse), APC, clone H57-597 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
Anti-TCR beta chain (mouse), APC, clone H57-597 Antibody is an antibody against TCR beta chain for use in Flow Cytometry.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.125 µg from a representative lot detected TCR beta chain in one million C57Bl/6 splenocytes.
Physical form
Purified by size-exclusion chromatography
Purified Armenian Hamster monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

biological source	hamster (Armenian)
Quality Level	100
antibody form	purified antibody
antibody product type	primary antibodies
clone	H57-597, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG
conjugate	Allophycocyanin conjugate
UniProt accession no.	P0C6B2,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

The H57-597 antibody is specific for the beta chain of the mouse T cell Receptor (TCR). This cell surface protein combines with a second protein chain (alpha chain) to form the alpha-beta TCR that is expressed by NK1.1+ thymocytes, NKT cells, and the majority of peripheral T cells. A small number of T cells may express an alternative heteromer of gamma/delta protein chains, known as the g/d TCR. These receptors participate in a complex with CD3, and with the co-receptors CD4 or CD8, to recognize and respond to antigens bound to MHC molecules on antigen-presenting cells. Such interactions promote T cell receptor signaling (T cell activation) and can result in a number of cellular responses including proliferation, differentiation, production of cytokines or activation-induced cell death.The H57-597 antibody is used as a phenotypic marker for T cells expressing the alpha-beta TCR. It is also widely used to cross-link surface TCR and thereby mimic TCR-mediated cell activation or induction of apoptosis. The antibody does not cross-react with cells expressing the g/d TCR.

Anti-TCR beta chain (mouse), PerCP-Cy5.5, clone H57-597 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Anti-TCR beta chain (mouse), PerCP-Cy5.5, clone H57-597 Antibody is an antibody against TCR beta chain for use in Flow Cytometry.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.125 µg from a representative lot detected TCR beta chain in one million C57Bl/6 splenocytes.
Physical form
Purified by size-exclusion chromatography
Purified Armenian Hamster monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

biological source	hamster (Armenian)
Quality Level	100
antibody form	purified antibody
antibody product type	primary antibodies
clone	H57-597, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG
conjugate	PerCP-Cy5.5
UniProt accession no.	P0C6B2,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

The H57-597 antibody is specific for the beta chain of the mouse T cell Receptor (TCR). This cell surface protein combines with a second protein chain (alpha chain) to form the alpha-beta TCR that is expressed by NK1.1+ thymocytes, NKT cells, and the majority of peripheral T cells. A small number of T cells may express an alternative heteromer of gamma/delta protein chains, known as the g/d TCR. These receptors participate in a complex with CD3, and with the co-receptors CD4 or CD8, to recognize and respond to antigens bound to MHC molecules on antigen-presenting cells. Such interactions promote T cell receptor signaling (T cell activation) and can result in a number of cellular responses including proliferation, differentiation, production of cytokines or activation-induced cell death.The H57-597 antibody is used as a phenotypic marker for T cells expressing the alpha-beta TCR. It is also widely used to cross-link surface TCR and thereby mimic TCR-mediated cell activation or induction of apoptosis. The antibody does not cross-react with cells expressing the g/d TCR.

Anti-TCR beta chain (mouse), violetFluor® 450, clone H57-597 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
This armenian hamster monoclonal Anti-TCR beta chain Antibody (mouse), violetFluor® 450, clone H57-597, Cat. No. MABF1458 is validated for use in Flow Cytometry, for the detection of TCR beta chain.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected TCR beta chain in one million C57Bl/6 splenocytes.
Physical form
Purified by size-exclusion chromatography
Purified Armenian Hamster monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.

violetFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	hamster (Armenian)
Quality Level	100
antibody form	purified antibody
antibody product type	primary antibodies
clone	H57-597, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG
conjugate	violetFluor^® 450
UniProt accession no.	P0C6B2,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

T cell receptor (TCR) is a single-pass membrane protein that associates with CD3 to form a CD3/TCR complex. It can be a heterodimer of either alpha and beta chains or gamma and delta chains. CD3/RCR complex plays major role in antigen recognition and activation of T cells. The V gamma 1 gene almost exclusively rearranges to the J gamma 4-C gamma 4 gene. V-gamma 1- J gamma 4-C gamma 4 expressing cells form a major population of gamma/delta T cells in thymus and peripheral lymphoid organs in adult mice. However, during early development they are present in lower numbers. This antibody (clone 2.11) recognizes the V gamma 1.1 chain of the heterodimeric gamma/delta T-cell receptor, but does react with TCR alpha/beta bearing cells.
Specificity
Clone 2.11 detects T-cell receptor gamma chain C region C10.5 in lymphocytes.

Anti-TCR V1.1 Antibody, clone 2.11

Irradiated TCR gamma/delta expressing T3 .13.1 hybridoma cells.

Anti-TCR V 1.1, clone 2.11, Cat. No. MABF930, is an armenian hamster monoclonal antibody that detects T-cell receptor gamma chain C region C10.5. and has been tested for use Flow Cytometry, and Immunoprecipitation.
Flow Cytometry Analysis: A representative lot detected TCR V gamma 1.1 in Flow Cytometry applications (Pereira, P., et. al. (1995). J Exp Med. 182(6):1921-30; Pereira, P., et. al. (2004). J Immunol. 173(5):3261-70).
Flow Cytometry Analysis: A 1:500 dilution from a representative lot detected TCR V gamma 1.1 in Lymphocytes isolated from TcrdH2BeGFP reporter mice (Courtesy of Dr rer. nat. Inga Sandrock, Hannover Medical School, Germany).
Immunoprecipitation Analysis: A representative lot detected TCR V gamma 1.1 in Immunoprecipitation applications (Pereira, P., et. al. (1995). J Exp Med. 182(6):1921-30).
Research Category
Inflammation & Immunology
Quality
Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG.
Target description
19.10 kDa calculated.
Physical form
Format: Purified
Purified armenian hamster monoclonal antibody IgG in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	hamster (Armenian)
Quality Level	100
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	2.11, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunoprecipitation (IP): suitable
isotype	IgG
UniProt accession no.	P01853,

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

T cell receptor gamma, variable 7 (UniProt: A0A0A6YYE8; also known as TCR Vg7) is encoded by the Trgv7 (also known as Tcrg-V7) gene (Gene ID: 21641) in murine species. The T-cell receptor (TCR) is a protein complex found on the surface of T cells that is responsible for recognizing fragments of antigen as peptides bound to major histocompatibility complex (MHC) molecules. The TCR is a heterodimer of a and b chain and over 95% of T cells express these two chains and only about 5% of T cells carry g and d chains, which are the first T lymphocytes of innate immunity to arise in ontogeny. The diversity of TCR arises from genetic recombination of the DNA-encoded segments in individual somatic T cells by somatic V(D)J recombination using RAG1 and RAG2 recombinases. This recombination process is reported to be unique to lymphocytes during the early stages of their development in primary lymphoid organs. The generation of the TCR g chain involves VJ recombination. There are seven Vg gene segments have been described in the TCRg chain loci of mice. TCR Vg7 is localized on the external side of plasma membrane. It is synthesized with a signal peptide (aa 1-17), which is subsequently cleaved off to produce the mature form. In most inbred strains of mice, T cells expressing Vg7- or Vg1- encoded TCRs make up 90% of intestinal intraepithelial lymphocytes. These cells are reported to be essential to limit parasite invasion and their dissemination from the intestinal mucosa. (Ref.: Li, C., et al. (2012). Cell. Immunol. 279(2); 151-159; Dalton, JE., et al. (2006). Gatroenterol.131(3); 818-829; Pereira, ,P., et al. (2000). Eur. J. Immunol. 30(7); 1988-1997).
Specificity
Clone F2.67 is a mouse monoclonal antibody generated in TCR delta knockout mice. It detects murine T cell receptor g, variable 7.

Anti-TCR V7 Antibody, clone F2.67

Mouse hybridoma expressing anti V 7V 5 TCR.

Quality Control Testing
Evaluated by Flow Cytometry in Balb/c mouse thymocytes.
Flow Cytometry Analysis: 1.0 µg of this antibody detected T-cell Vg 7 in one million Balb/c mouse thymocytes.
Tested Applications
Flow Cytometry Analysis: A representative lot detected TCR Vg7 in Flow Cytometry applications (Pereira, P., et al. (2000). Eur J Immunol.;30(7):1988-97; Dalton, J.E., et al. (2006). Gastroenterology.;131(3):818-29; Newton, D.J., et al. (2006). Infect Immun.;74(2):1097-105; Hamada, S. et al. (2008). Immunology.;125(2):170-7; Li, C., et al. (2012). Cell Immunol.;279(2):151-9; Walker, C.R., et al. (2013). PLoS One.;8(12):e84553).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-TCR Vg7, clone F2.67, Cat. No. MABF2676, is a mouse monoclonal antibody that detects T cell receptor g, variable 7 and is tested for use in Flow Cytometry.
Physical form
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.

Quality Level	200
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	F2.67, monoclonal
mol wt	calculated mol wt 13.53 kDa
purified by	using protein G
species reactivity	mouse
packaging	antibody small pack of 100 µL
application(s)	flow cytometry: suitable
isotype	IgG2a
epitope sequence	Unknown
conjugate	unconjugated
UniProt accession no.	A0A0A6YYE8,
shipped in	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Transmembrane protein 150C (UniProt: Q8C8S3; also known as Tentonin, TTN3) is encoded by the Tmem150c gene (Gene ID: 231503) in murine species. TTN3 is a multi-pass membrane protein of the DRAM/TMEM150 family. Two isoforms of TTN3 have been described that are produced by alternative splicing. It belongs to a new class of mechanotransduction channel that is expressed in muscle spindle afferents and contribute to proprioception (touch sensation). It is activated by mechanical stimuli with distinctly slow inactivation kinetics. Mice with deficiency in TTN3 display loss of coordinated movements and abnormal gait. It is reported to mediate slow adapting currents in DRG neurons.
Specificity
This rabbit polyclonal antibody detects Transmembrane protein 150C in mouse and rat cells. it targets an epitope within 38 amino acids from the C-terminal region.

Anti-Tentonin 3/TMEM150c

eCl@ss:	32160702
NACRES:	NA.41

A linear peptide corresponding to 38 amino acids from the C-terminal region of murine Transmembrane protein 150C.
Epitope: C-terminus

Anti-Tentonin 3/TMEM150c, Cat. No. ABN2266, is a highly specific rabbit polyclonal antibody that targets Transmembrane protein 150C and has been tested in , Immunocytochemistry, Immunofluorescence, Immunohistochemistry, and Western Blotting.
Research Category
Neuroscience
Immunohistochemistry Analysis: A representative lot detected Tentonin 3/TMEM150c in muscle spindle from mouse (Hong, G.S., et. al. (2016). Neuron. 91(1):107-18).
Immunocytochemistry Analysis: A representative lot detected Tentonin 3/TMEM150c in HEK293T cells transfected with TTN3. (Hong, G.S., et. al. (2016). Neuron. 91(1):107-18).
Western Blotting Analysis: A representative lot detected Tentonin 3/TMEM150c in F11 rat DRG cells (untransfected and TTN3 transfected cells) (Hong, G.S., et. al. (2016). Neuron. 91(1):107-18).
Quality
Evaluated by Western Blotting in F11 cell lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected Tentonin 3/TMEM150c in 10 µg of F11 cell lysate.
Target description
~25 kDa observed; 27.76 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat, mouse
packaging	antibody small pack of 25 µL
application(s)	immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_878261,
UniProt accession no.	Q8C8S3,
shipped in	ambient

Flash Point F	does not flash
Flash Point C	does not flash

The TER-119 antibody is named for the antigen to which it binds, a 52 kDa surface protein that is associated with glycophorin-A. TER-119 is considered to be a lineage marker for later stages of erythroid cell development, as its expression begins at the pro-erythroblast stage. TER-119 antigen is not expressed at either BFU-E or CFU-E stages, i.e. prior to the pro-erythroblast stage.

Anti-TER-119 (mouse), APC, clone TER-119 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Immunogen information for this antibody is proprietary information.

Research Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-TER-119 Antibody (mouse), APC, clone TER-119 Antibody, Cat. No. MABF1430 is validated for use in Flow Cytometry, for the detection of TER-119.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg from a representative lot detected TER-119 in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	TER-119, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
conjugate	Allophycocyanin conjugate
UniProt accession no.	Q9ES52,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Immunogen information for this antibody is proprietary information.

Anti-TER-119 (mouse), redFluor® 710, clone TER-119 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Research Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-TER-119 Antibody (mouse), redFluor® 710, clone TER-119 Antibody, Cat. No. MABF1442 is validated for use in Flow Cytometry, for the detection of TER-119.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.125 µg from a representative lot detected TER-119 in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.

redFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	TER-119, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	redFluor^® 710
UniProt accession no.	Q9ES52,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Immunogen information for this antibody is proprietary information.

Anti-TER-119 (mouse), violetFluor® 450, clone TER-119 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Research Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-TER-119 Antibody (mouse), violetFluor® 450, clone TER-119 Antibody, Cat. No. MABF1440 is validated for use in Flow Cytometry, for the detection of TER-119.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 1 µg from a representative lot detected TER-119 in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.

Concentration: Please refer to lot specific datasheet.

Quality Level	100
biological source	rat
antibody form	purified antibody
antibody product type	primary antibodies
clone	TER-119, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable
isotype	IgG2b
conjugate	violetFluor^® 450
UniProt accession no.	Q9ES52,

WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Monoclonal Anti-TES (mouse IgG3 isotype) is derived from the hybridoma TES75 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide. Testin LIM domain protein (TES) comprises cysteine-rich zinc-binding motifs called LIM domains and is a component of focal adhesions. TES gene is mapped to a common fragile site on chromosome 7q31.2 is designated as FRA7G.
Specificity
Monoclonal Anti-TES recognizes human, monkey, bovine, and mouse TES

Anti-TES antibody ,Mouse monoclonal

Anti-TES antibody, mouse monoclonal may be used in immunoblotting.
Biochem/physiol Actions
Testin LIM domain protein (TES), a putative tumor-suppressor gene, is essential for motility and is key for the tumor cell anchorage and metastasis. TES mRNA expression is found in several cancer-derived cell lines, particularly hematopoietic, breast and ovarian cancer cell lines as well as in primary tumors. This was correlated with methylation of TES CpG island. Furthermore, TES gene knockout revealed its role as a tumor suppressor gene as well as in actin stress fibre organization.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze at –20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200
biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	TES75, monoclonal
form	buffered aqueous solution
mol wt	antigen ~48 kDa
species reactivity	mouse, human, bovine, monkey
packaging	antibody small pack of 25 µL
concentration	~1.5 mg/mL
application(s)	western blot: 0.5-1.0 µg/mL using whole extract of mouse thymus
isotype	IgG3
conjugate	unconjugated
UniProt accession no.	Q9UGI8,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... TES(26136) mouse ... Tes(21753)

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Tetranectin (UniProt: P05452; also known as TN, C-type lectin domain family 3 member B, Plasminogen kringle 4-binding protein) is encoded by the CLEC3B (also known as TNA) gene (Gene ID: 7123) in human. Tetranectin is a tetrameric plasminogen-binding protein that is synthesized with a signal peptide (aa 1-21), which is subsequently removed in the mature form that is composed of three identical, noncovalently linked subunits each of 181 amino acids. The polypeptide consists of a short a-helical segment (aa 47-72) at the amino terminus that is involved in trimerization, followed by a C-type lectin domain (aa 77-198). It is present in both serum and the extracellular matrix and is expressed most abundantly in the lung. The blood concentrations of tetranectin in healthy adults are about 10-12 mg/mL. However, in septic subjects its levels are significantly reduced and supplementation with exogenous tetranectin confers dose-dependent protection against lethal endotoxemia and sepsis. Its levels are shown to be significantly reduced in patients with cardiac failure. Hence, it is also used as a biomarker for risk of heart failure. (Ref.: Chen, W., et al. (2020). Sci. Transl. Med. 12(539); eaaz3833; McDonald, K., et al. (2020). Sci. Rep. 10; 7507).
Specificity
Clone mAb10 is a mouse monoclonal antibody that detects Tetranectin. It targets an epitope within 24 amino acids from the C-terminal half.

Anti-Tetranectin/CLEC3B Antibody, clone mAb10

Purified human Tetranectin.

Anti-Tetranectin/CLEC3B, clone mAb10, Cat. No. MABT1444, is a mouse monoclonal antibody that detects Tetranectin and is tested for use in Dot Blot, ELISA, and Western Blotting.
Quality Conrol Testing
Evaluated by Western Blotting in Human lung tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Tetranectin/CLEC3B in Human lung tissue lysate.
Tested Applications
Western Blotting Analysis: A representative lot detected Tetranectin/CLEC3B in Western Blotting applications (Chen, W., et al. (2020). Sci Transl Med. 12(539):eaaz3833).
Dot Blot: A representative lot detected Tetranectin/CLEC3B in Dot Blot applications (Chen, W., et al. (2020). Sci Transl Med. 12(539):eaaz3833).
ELISA Analysis: A representative lot detected Tetranectin/CLEC3B in ELISA applications (Chen, W., et al. (2020). Sci Transl Med. 12(539):eaaz3833).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.

Quality Level	200
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	mAb10, monoclonal
mol wt	calculated mol wt 22.54 kDa","observed mol wt ~25 kDa
purified by	using protein G
species reactivity	human
packaging	antibody small pack of 100 µg
application(s)	ELISA: suitable","dot blot: suitable","western blot: suitable
isotype	IgG2b
epitope sequence	C-terminal half
conjugate	unconjugated
Protein ID accession no.	NP_003269,
UniProt accession no.	P05452,
shipped in	2-8°C
Gene Information	human ... CLEC3B(7123)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Testis-expressed protein 19.1 (UniProt: Q99MV2; also known as mTex19.1, Testis-expressed protein 19A) is encoded by the Tex19.1 (also known as Tex19, Tex19a) gene (Gene ID: 73679) in murine species. Tex19.1 resides in the germline to repress transposable genetic elements and maintain genomic stability. It is expressed in testis, placenta, ovary, and in pluripotent stem cells. In testis its expression is highest in mitotic spermatogonia and decreases as spermatocytes progress through meiosis. Tex19.1 expression is reported to be down-regulated by Deleted in azoospermia-like (DAZL) protein, which binds to 3UTR of Tex19.1 mRNAs and repress its translation. Tex19.1 is required during spermatogenesis and placenta development where it participates in the repression of retrotransposable elements and prevents their mobilization. Tex19.1, along with its paralog, Tex19.2, is shown to collaborate with the Piwi-interacting RNA (piRNA) pathway, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins. Embryos with mutations in Tex19.1 gene exhibit intra-uterine growth retardation and have small placentas due to a reduction in the number of spongiotrophoblast, glycogen trophoblast and sinusoidal trophoblast giant cells. Loss of Tex19.1 is shown to cause growth defect and early post-natal lethality. Male animals with deficiency of both Tex19.1 and Tex19.2 display impaired spermatogenesis, small testes, and are infertility.
Specificity
Clone 7TEX-1F11 detects murine Testis-expressed protein 19.1 (Tex 19).

Anti-Tex19.1 Antibody, clone 7TEX-1F11

His-tagged full-length recombinant mouse Testis-expressed protein 19.1 (Tex 19).

Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected Tex19.1 in embryonic mouse brain and embryonic mouse gut tissue sections.
Immunocytochemistry Analysis: A representative lot detected Tex19.1 in Immunocytochemistry applications (Tarabay, Y., et. al. (2013). Hum Reprod. 28(8):2201-14).
ELISA Analysis: A representative lot detected Tex19.1 in ELISA applications (Tarabay, Y., et. al. (2013). Hum Reprod. 28(8):2201-14).
Immunoprecipitation Analysis: A representative lot immunoprecipitated Tex19.1 in Immunoprecipitation applications (Tarabay, Y., et. al. (2017). J Cell Sci. 130(8):1463-1474).
Western Blotting Analysis: A representative lot detected Tex19.1 in Western Blotting applications (Tarabay, Y., et. al. (2013). Hum Reprod. 28(8):2201-14;Tarabay, Y., et. al. (2017). J Cell Sci. 130(8):1463-1474).
Anti-Tex19.1, clone 7TEX-1F11, Cat. No. MABC1596, is a mouse monoclonal antibody that detects Testis-expressed protein 19.1 and has been tested for use in ELISA, Immunocytochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Research Category
Signaling
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse testis tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected Tex19.1 in mouse testis tissue sections.
Target description
40.40 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	7TEX-1F11, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	ELISA: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_082878,
UniProt accession no.	Q99MV2,

Transcription factor binding to IGHM enhancer 3 or transcription factor E3 (TFE3) gene is mapped to human chromosome Xp11.23. TFE3 belongs to helix-loop-helix leucine zipper family of transcription factors.

Anti-TFE3 antibody produced in rabbit

MDL number:	MFCD01865065
Human Protein Atlas Number:	HPA023881 Human Protein Atlas characterization data

Transcription factor binding to ighm enhancer 3 recombinant protein epitope signature tag (PrEST).
Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS

Anti-TFE3(Transcription factor binding to IGHM enhancer 3) antibody produced in rabbit has been used:

in immunofluorescence
in immunocytochemistry studies
in immunostaining

Biochem/physiol Actions
Transcription factor binding to IGHM enhancer 3 (TFE3) interacts with other transcription factors and plays a key role in cell growth and proliferation. It promotes renal adenocarcinoma progression. TFE3 gene locus is also involved in translocations events resulting in a TFE3 fusion protein, which is a potential marker for screening their prevalence in renal cell carcinomas. It interacts and regulates expression of G-protein Gα16 and favors regulation of claudin 14.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74277,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µL
enhanced validation	RNAi knockdown
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000","western blot: 0.04-0.4 µg/mL
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P19532,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... TFE3(7030)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Transcription factor E3 (TFE3), also known as Class E basic helix-loop-helix protein 33 (bHLHe33), is a transcriptional activator that mediates the enhancer-promoter interactions. TFE3 belongs to the MiT family of helix-loop-helix leucine zipper transcription factors, it is ubiquitously expressed and can directly associate with DNA as either homodimer or heterodimer which are formed with two other MiT family members, TFEB or TFEC.
TFE3 serve an important role in cell growth, cell proliferation, cellular adaptation to starvation and cellular response to ER stress. Under nutrient-rich conditions, TFE3 is located in the cytoplasm, and under starvation conditions or treatment with ER stressors, TFE3 rapidly translocates to the nuclear. In the nuclear localization, TFE3 mediates cellular adaptation to stress by simultaneously promoting lysosomal biogenesis, autophagy induction, as well as expression of critical mitochondrial and metabolic regulators. It been shown that TFE3 also participate in the transcriptional regulation of the innate immune response.
Pathogen infections promote TFE3 nuclear translocation, thus inducing In vivo expression of several cytokines and chemokines.

Anti-TFE3 antibody, Mouse monoclonal

Anti-TFE3 antibody specifically recognizes TFE3 from human, mouse, rat, bovine and canine origin. The antibody may be used in various immunochemical techniques including Immunoblotting (~60 kDa). Detection of the TFE3 band by Immunoblotting is specifically inhibited by the immunizing peptide.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.

Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Disclaimer
This product is for R&D use only, not for drug, household, or other uses.

biological source	mouse
antibody form	purified from hybridoma cell culture
clone	TFE3-37, monoclonal
form	buffered aqueous solution
mol wt	60 kDa
species reactivity	mouse, canine, human, rat, bovine
packaging	antibody small pack of 25 µL
concentration	~1 mg/mL
application(s)	immunoblotting: 1.5-3 µg/mL using human A549 cells extract
isotype	IgG1
UniProt accession no.	P19532,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... TFE3(7030)

WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

The thioredoxin system consists of thioredoxin, thioredoxin-reductase and NADPH. Thioredoxin from E. coli consists of a single polypeptide chain of 108 amino acids with a molecular weight of 11,700. The protein contains no prosthetic group or bound metals.
Specificity
Specific for natural E. coli and recombinant thioredoxin. It may be used to identify and purify the expression of thioredoxin fusion proteins.

Anti-Thioredoxin antibody produced in rabbit

recombinant E. coli thioredoxin.

Anti-Thioredoxin antibody produced in rabbit has been used in:

immunohistochemistry
immunoblotting
dot blot immunoassay
ouchterlony double diffusion
immunodetection
western blotting

Immunofluorescence was carried out on the cerivcal cancer cell lines SiHa, CaSki, and HeLa using an antibody against the redox proteinThioredoxin.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Biochem/physiol Actions
Thioredoxin is a small electron transport protein that serves as the hydrogen donor in the enzymatic reduction of ribonucleotides to deoxyribonucleotides. The thioredoxin system is involved in other reductive processes such as the enzymatic reduction of methionine sulfoxide and sulfate. The oxidation-reduction function of thioredoxin is linked to a single intra-molecular disulfide bridge, forming a 14 member ring. The system is particularly useful for high level production of soluble fusion proteins in the E. coli cytoplasm. In many cases, these fusion proteins fold correctly and thus display full biological activity.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200,
antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
packaging	antibody small pack of 25 µL
application(s)	dot blot: 1:5,000 using purified recombinant thioredoxin, western blot: 1:5,000 using E. coli extract
conjugate	unconjugated
shipped in	dry ice
storage temp.	20°C

RIDADR	NONH for all modes of transport
WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Specificity
Directed against the Thy 1.1 antigenic determinant which is a monomorphic determinant within rat strains but polymorphic in the mouse (positive to AKR strain, negative to CVA and BALB/c). Thy-1 antigen is present on a variety of cell types including thymocytes, neuronal cells, T-lymphocytes (mouse), stem cells and immature B cells (rat) and connective tissue (Campbell, 1981). Thy-1 is a glycoprotein, 112 amino acids, which is homologous to immunoglobulin domains (Williams & Gagnon, 1982). MAB1406 can be coupled to sepharose 4-B and used to purify mouse Thy-1.1 and rat Thy-1 antigens (Campbell, 1981; Williams & Gagnon, 1982). MAB1406 can also be used to study the killing of Thy-1 tumor cells with antibody-toxin conjugates (Neville, 1982).

Anti-Thy-1.1 Antibody, clone OX-7

Rat Thy-1

Anti-Thy-1.1 Antibody, clone OX-7 detects level of Thy-1.1 & has been published & validated for use in FC, IC, IH.
Flow Cytometry: 1:10-1:100. Use 10 µl per 10E6 thymocytes.
Immunohistochemistry on frozen sections.
Immunocytochemistry
Optimal working dilutions must be determined by end user.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
Tested
Physical form
Format: Purified
Protein A Purified mouse immunoglobulin in 20 mM sodium phosphate, 250 mM NaCl, pH. 7.6, with 0.1% sodium azide as a preservative.
Protein A purified
Storage and Stability
Maintain for 1 year at 2–8°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Thymocytes, T-lymphocytes

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	OX-7, monoclonal
species reactivity	rat
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable
isotype	IgG1
NCBI accession no.	NM_006288.2,
UniProt accession no.	P04216,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... THY1(7070)

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

UV light induces the formation of thymine dimers that subsequently leads to DNA damage in cells. Monoclonal antibodies that bind to thymine dimers enable the study of cell death and UV-induced DNA damage during photocarcinogenesis . Monoclonal Anti-Thymine Dimer binds to the (5-6) cyclobutane type of homothymine or thyminecytosine heterodimers in single-stranded DNA. The antibody has a decreased affinity for the dimer in short oligonucleotides (an oligonucleotide of atleast 10-20 thymine residues is required for the labeling of the probes). The product facilitates the use of a sensitive and non-radioactive technique for the analysis of thymine dimerization.

Anti-Thymine Dimer antibody, Mouse monoclonal

tetra nucleotide containing cyclobutane thymine dimer (GTTG) conjugated to chicken gamma globulin.

May be used in Southern blotting at 0.5-1μg/mL using UV induced thymine dimers of λ phage DNA fragments.
Monoclonal Anti-Thymine Dimer antibody is suitable for use in dot blot (0.5-1 mg/mL), immunocytochemistry (1:100) and capture ELISA.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.

Distributed under license.
Patents WO87/01134, EP 0233 177 B1
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	200,
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	H3, monoclonal
form	buffered aqueous solution
species reactivity	chicken, wide range
packaging	antibody small pack of 25 μL
concentration	~2 mg/mL
application(s)	capture ELISA: suitable, dot blot: 0.5-1 μg/mL, immunocytochemistry: suitable
isotype	IgG1
conjugate	unconjugated
shipped in	dry ice
storage temp.	−20°C

RIDADR	NONH for all modes of transport
WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable