Small Pack Antibodies

His-tagged full length human recombinant Serpin B9.

ELISA Analysis: A representative lot detected Serpin B9 in ELISA applications (Hirst, C.E., et. al. (2001). Mol Hum Peprod. 7(12):1133-42).
Flow Cytometry Analysis: A representative lot detected Serpin B9 in Flow Cytometry applications (Hirst, C.E., et. al. (2003). J Immunol. 170(2):805-15).
Immunocytochemistry Analysis: A representative lot detected Serpin B9 in Immunocytochemistry applications (Hirst, C.E., et. al. (2003). J Immunol. 170(2):805-15).
Immunofluorescence Analysis: A representative lot detected Serpin B9 in Immunofluorescence applications (Hirst, C.E., et. al. (2003). J Immunol. 170(2):805-15).
Immunohistochemistry Analysis: A representative lot detected Serpin B9 in Immunohistochemistry applications (Hirst, C.E., et. al. (2001). Mol Hum Peprod. 7(12):1133-42).
Western Blotting Analysis: A 1:100 dilution from a representative lot detected Serpin B9 in YT and Jurkat cell lysates (Courtesy of Prof. Phillip Bird, Ph.D., Monash University, Victoria Australia).
Western Blotting Analysis: A representative lot detected Serpin B9 in Western Blotting applications (Hirst, C.E., et. al. (2001). Mol Hum Peprod. 7(12):1133-42; Hirst, C.E., et. al. (2003). J Immunol. 170(2):805-15; Mangan, M.S., et. al. (2015). J Biol Chem. 291(7):3626-38).
Immunocytochemistry Analysis: A representative lot detected Serpin B9 in COS-1 cells (Courtesy of Prof. Phillip Bird, Ph.D., Monash University, Victoria Australia).
Anti-Serpin B9, clone 7D8, Cat. No. MABS1911, is a mouse monoclonal antibody that detects Serpin B9 and has been tested for use in ELISA, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry in human spleen tissue sections.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected Serpin B9 in human spleen tissue sections.
Target description
42.40 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Concentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	7D8, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	ELISA: suitable","flow cytometry: suitable","immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_004146,
UniProt accession no.	P50453,

N-lysine methyltransferase SETD6 (UniProt: Q8TBK2; also known as SET domain-containing protein 6) is encoded by the SETD6 gene (Gene ID: 79918) in human. N-lysine methyltransferase SETD6 is a SET domain protein that specifically monomethylates lysine 310 of NF-kappa B-p65 that leads to down-regulation of NF-kappa B transcription factor activity. It can also monomethylate lysine 8 of H2AZ (H2AZK8me1). SETD6 is required for the maintenance of embryonic stem cell self-renewal. Primary urothelial cells and normal bladder tissue have almost undetectable SETD6 levels that are shown to increase in transformed urothelial cells and is further increased in bladder cancer cells and tissues. Overexpression of SETD6 in transformed urothelial cells increases their survival and colony formation. SETD6 is shown to interact with the oxidative stress sensor protein DJ1, which is required for Nrf2-dependent transcription of antioxidant target genes. Under basal conditions, SETD6 and DJ1 are associated at chromatin and SETD6 inhibits DJ1 activity, which leads to the repression of Nrf2-dependent transcription. However, under conditions of oxidative stress SETD6 mRNA and protein levels decline that leads to elevation in Nrf2 expression and diminish interaction between SETD6 and DJ1. Two isoforms of SETD6 have been described that are produced by alternative splicing. (Ref.: Mukherjee, N., et al. (2017). Oncotarget. 8(9); 15114-15125; Chen, A., et al. (2016). Biochim. Biophys. Acta. 1859(2):420-427).
Specificity
This rabbit polyclonal antibody detects N-lysine methyltransferase SETD6 in human cells. it targets an epitope within 18 amino acids from the N-terminal region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SETD6

Epitope: N-terminus
KLH-conjugated linear peptide corresponding to 18 amino acids from the N-terminal region of human N-lysine methyltransferase SETD6, isoform 1.

Anti-SETD6, Cat. No. ABE1337, is a highly specific rabbit polyclonal antibody that targets N-lysine methyltransferase SETD6 and has been tested for use in Immunocytochemistry and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected SETD6 in HEK293 cells.
Quality
Evaluated by Western Blotting in human kidney tissue lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected SETD6 in human kidney tissue lysate.
Target description
~53 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","western blot: suitable
NCBI accession no.	NP_001153777.1,
UniProt accession no.	Q8TBK2,

Histone-lysine N-methyltransferase SETDB1 (UniProt: O88974; also known as EC: 2.1.1.43, ERG-associated protein with SET domain, ESET, SET domain bifurcated 1) is encoded by the Setdb1 (also known as Eset, Kiaa0067) gene in human. SETDB1 is ubiquitously expressed, but a strong expression is observed in liver and testis. It is a histone methyltransferase that specifically trimethylates Histone 3 Lysine 9 (H3K9). H3K9 trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. It mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. SETDB1 is reported to inhibit adipogenesis. It has also been shown that H3K4/H3K9me3 bivalent chromatin signature keeps expression of Cebpa and Pparg genes very low. Depletion of SETDB1 can induce adipogenesis in mesenchymal stem cells and in preadipocytes. SETDB1 contains two Tudor domains (aa 257-320 and 347-403) and one MBD domain (aa 611-682). It also has a SET domain (aa 820-1282), a pre-SET (aa 744-817), and a post-SET domain (aa 1291-1307). The pre-SET, SET and post-SET domains are required for its methyltransferase activity. In the pre-SET domain, Cys residues bind 3 zinc ions that are arranged in a triangular cluster; some of these Cys residues contribute to the binding of two zinc ions within the cluster. (Ref.: Matsumura, Y., et al., (2015), Mol. Cell 60(4); 584- 596).
Specificity
Clone F0838 recognizes SETDB1 in murine embryonic stem cells. It targets an epitope with in 213 amino acids from the N-terminal half of isoform 1 and 7.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SETDB1 Antibody, clone F0838

His-tagged recombinant fragment corresponding to 213 amino acids from the N-terminal half of murine Histone-lysine N-methyltransferase SETDB1.

Anti-SETDB1, clone F0838, Cat. No. MABE1066, is a highly specific mouse monoclonal antibody that detects SETDB1 and has been tested for use in Western Blotting.
Research Category
Epigenetics & Nuclear Function
Western Blotting Analysis: A representative lot detected SETDB1 in Western Blotting applications (Matsumura, Y, et. al. (2015). Mol Cell. 60(4):584-96).
Quality
Evaluated by Western Blotting in 129/S6/SvEv mouse embryonic stem cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected SETDB1 in 129/S6/SvEv mouse embryonic stem cell lysate.
Target description
~160 and 180 kDa observed; 144.55 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG1 in PBS with 0.01% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

SH3 domain-containing kinase-binding protein 1 (UniProt: Q925Q9; also known as Regulator of ubiquitous kinase, Ruk, SH3-containing expressed in tumorigenic astrocytes, SH3KBPI,) is encoded by the Sh3kbp1 (also known as Ruk, Seta) gene (Gene ID: 84357) in rat. SH3KBPI is a peripheral membrane protein that serves as an adapter protein involved in regulating diverse signal transduction pathways. It localizes in endocytic vesicles containing clustered receptors. It is shown to be highly expressed in the spinal cord. It can self-associate and form homotetramers. It contains three SH3 domains (aa 1-58; 98-157; and 311-372). SH3KBPI is involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through an association with CBL and endophilins. It can attenuate phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. It is also reported to plays a role in the regulation of cell morphology and cytoskeletal organization. Seven different isoforms of SH3KBP1 have been described that are produced by alternative splicing.
Specificity
Clone 179.1.E1 is a mouse monoclonal antibody that specifically detects SH3 domain-containing kinase-binding protein 1.

biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	F0838, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG1
UniProt accession no.	O88974,

Узнать цену

Подробнее

Anti-SH3KBPI Antibody, clone 179.1.E1

His-tagged full-length recombinant rat SH3 domain-containing kinase-binding protein 1.

Anti-SH3KBPI, clone 179.1.E1, Cat. No. 05-731-I, is a mouse monoclonal antibody that detects SH3 domain-containing kinase-binding protein 1 and has tested for use in Western Blotting.
Western Blotting Analysis: A representative lot from this antibody detected SH3KBPI in NG108-15 cell lysate.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in THP-1 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected SH3KBPI in THP-1 cell lysate.
Target description
~85 kDa observed; 78.09 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Serine hydroxymethyltransferase, mitochondrial (UniProt: P34897; also known as EC: 2.1.2.1, SHMT, Glycine hydroxymethyltransferase, Serine methylase) is encoded by the SHMT2 gene (Gene ID: 6472) in human. SHMT is involved in the de novo mitochondrial thymidylate biosynthesis pathway via its role in glycine and tetrahydrofolate metabolism. Thymidylate biosynthesis is required to prevent uracil accumulation in mtDNA. SHMT catalyzes the reversible conversion of serine and glycine. It uses pyridoxal-5 -phosphate as a cofactor. SHMT is synthesized with a transit peptide (aa 1-29) that is needed for its mitochondrial translocation. In eukaryotes two forms of SHMT have been reported: cytosolic and mitochondrial. In the presence of bound pyridoxal 5-phosphate it is present in a homotetrameric form and in the absence of pyridoxal 5-phosphate it exists as a homodimer. Pyridoxal 5-phosphate binding mediates an important conformation change, which is essential for its tetramerization. Three isoforms of SHMT have been reported that are produced by alternative splicing.
Specificity
Clone 4D2.1 detects human mitochondrial Serine hydroxymethyltransferase. It targets an epitope within 107 amino acids from the C-terminal half.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	179.1.E1, monoclonal
species reactivity	human, rat, mouse
packaging	antibody small pack of 25 µg
application(s)	western blot: suitable
isotype	IgG2b
NCBI accession no.	NP_445812,
UniProt accession no.	Q925Q9,

Узнать цену

Подробнее

Anti-SHMT Antibody, clone 4D2.1

eCl@ss:	32160702
NACRES:	NA.41

GST/His-tagged recombinant fragment corresponding to 107 amino acids from the C-terminal half of human mitochondrial Serine hydroxymethyltransferase.

Research Category
Signaling
Anti-SHMT, clone 4D2.1, Cat. No. MABS1822, is a mouse monoclonal antibody that detects mitochondrial Serine hydroxymethyltransferase and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:50-250 dilution of this antibody from a representative lot detected SHMT in human colon, human liver, and human pancreas tissue sections.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected SHMT in Jurkat cell lysate.
Quality
Evaluated by Western Blotting in Raji cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected SHMT in Raji cell lysate.
Target description
~56 kDa observed; 55.99 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	4D2.1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_005403,
UniProt accession no.	P34897,
shipped in	ambient
Gene Information	human ... SHMT2(6472)

Siglec-H (UniProt: Q3Y597; also known as Sialic acid binding Ig-like lectin H) is encoded by the Siglech gene (Gene ID: 233274) in murine species. Siglecs are sialic acid-binding immunoglobulin-like lectins that are expressed mostly in the immune system and may be involved in both adhesive and signaling functions. Siglec-H is a type I, CD33-related siglec-like transmembrane glycoprotein that is synthesized with a signal peptide (aa 1-18), which is subsequently cleaved off in the mature form. The mature form has to ig-like domains (aa 32-141 and 151-234) in its extracellular region. Unlike other CD33-related siglecs, it lacks tyrosine-based signaling motifs in its cytoplasmic tail. Siglec-H is shown to be expressed on plasmaocytoid dendritic cells (pDCs) and can serve as a reliable marker for these cells. Siglec-H is also reported to serve as an endocytic receptor expressed on murine pDCs. Action of Siglec-H depends on a 12 kDa DNAX-activating protein (DAP). (Ref.: Zhang, J., et al. (2006). Blood 107(9); 3600-3608; Yun, TJ., et al., (2016), Cell Metabolism 23(5); 852-866).
Specificity
Clone 551 is a rat monoclonal antibody that detects murine Siglec-H. It targets an epitope with in the extracellular domain.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-Siglec-H Antibody, clone 551

Bone marrow-derived Type 1 interferon-producing cells.
Epitope: extracellular domain

Immunohistochemistry Analysis: A representative lot detected Siglec-H in Immunohistochemistry applications (Yun, T.J., et. al. (2016). Cell Metab. 23(5):852-66).
Flow Cytometry Analysis: A representative lot detected Siglec-H in Flow Cytometry applications (Yun, T.J., et. al. (2016). Cell Metab. 23(5):852-66).
Anti-Siglec-H, clone 551, Cat. No. MABF2045, is a rat monoclonal antibody that detects Sialic acid binding Ig-like lectin H and has been tested for use in Flow Cytometry and Immunohistochemistry.
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry in frozen mouse spleen tissue sections.
Immunohistochemistry Analysis: A 1:25 dilution of this antibody detected Siglec-H in frozen mouse spleen tissue sections.
Target description
34.35 kDa calculated.
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	551, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µg
application(s)	flow cytometry: suitable","immunohistochemistry: suitable
isotype	IgG1
NCBI accession no.	NP_848821.2,
UniProt accession no.	Q3Y597,

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SIGLEC1 antibody produced in rabbit

HPA053457 Human Protein Atlas characterization data

sialic acid binding Ig-like lectin 1, sialoadhesin recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST85314,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: 1:200-1:500
immunogen sequence	CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
conjugate	unconjugated
UniProt accession no.	Q9BZZ2,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SIGLEC1(6614)

Signal peptide peptidase-like 3 (UniProt: Q8TCT6; also known as SPP-like 3, Intramembrane protease 2, IMP-2, Presenilin homologous protein 1, PSH1, Presenilin-like protein 4, SPPL3) is encoded by the SPPL3 (also known as IMP2) gene (Gene ID: 121665) in human. SPPL3 is a multi-pass transmembrane protein that is shown to be widely expressed and is highly conserved in multicellular eukaryotes. Three isoforms of SPPL3 have been described that are produced by alternative splicing. It is a member of the intramembrane-cleaving GxGD proteases. It acts as an intramembrane protease that cleaves type II membrane protein substrates in or close to their luminal transmembrane domain boundaries. It can also act as a sheddase by mediating the proteolytic release and secretion of active site-containing ectodomains of glycan-modifying glycosidases and glycosyltransferases. It is also shown to catalyze the intramembrane cleavage of the envelope glycoprotein gp130 and/or the leader peptide gp18LP of the simian foamy virus independent of prior ectodomain shedding by furin or furin-like proprotein convertase-mediated cleavage proteolysis. The first transmembrane domain of SPPL3 may act as a type I signal anchor. SPPL3 also contains a PAL motif (aa 342-344) that is required for normal active site conformation.
Specificity
Clone 7F9 detects Signal peptide peptidase-like 3 in human cells. it targets an epitope within 15 amino acids from the C-terminal half. Immunogen sequence is conserved in all three isoforms.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Signal peptide peptidase-like 3 Antibody, clone 7F9

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal half of human Signal peptide peptidase-like 3.

Western Blotting Analysis: A representative lot detected Signal peptide peptidase-like 3 in Western Blotting applications (Voss, M., et. al. (2012). J Biol Chem. 287(52):43401-9; Voss, M., et. al. (2014). EMBO J. 33(24):2890-905; Fleck, D., et. al. (2016). J Biol Chem. 291(1):318-33).
Immunoprecipitation Analysis: A representative lot detected Signal peptide peptidase-like 3 in Immunoprecipitation applications (Voss, M., et. al. (2012). J Biol Chem. 287(52):43401-9).
Anti-Signal peptide peptidase-like 3, clone 7F9, Cat. No. MABS1910, is a mouse monoclonal antibody that detects Signal peptide peptidase-like 3 and has been tested for use in Immunoprecipitation and Western Blotting.
Research Category
Signaling
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Signal peptide peptidase-like 3 in HEK293 cell lysate.
Target description
~42 kDa observed; 42.56 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	7F9, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
NCBI accession no.	NP_620584,
UniProt accession no.	Q8TCT6,
shipped in	ambient
Gene Information	human ... SPPL3(121665)

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-SIKE1 antibody produced in rabbit

HPA025726 Human Protein Atlas characterization data

The gene SIKE1 (suppressor of IKBKE 1) is mapped to human chromosome 1p13. It is widely expressed and the protein localizes in the cytoplasm.

Suppressor of IKK-epsilon recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
SIKE1 (suppressor of IKBKE 1) forms a complex with TBK1 (TANK-binding kinase 1) and suppresses TBK1-mediated phosphorylation of IRF3 (interferon regulatory factor 3). This modulates the innate immunity response.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST76492,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100,
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 μL
application(s)	immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200
immunogen sequence	AEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMD
conjugate	unconjugated
shipped in	wet ice
storage temp.	−20°C
Gene Information	human ... RP5-1000E10.4(80143)

Sir2 belongs to a family of proteins that is found in organisms ranging from bacteria to complex eukaryotes. Members of this family contain a 250 amino acid core domain that shares about 25-60% sequence identity.
Specificity
Anti-Sir2 polyclonal antibody specifically recognizes mouse Sir2 (AS-16). Staining of the Sir2 band is specifically inhibited by the immunizing peptide.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Sir2 (AS-16) antibody produced in rabbit

MDL number:	MFCD03792039
NACRES:	NA.41

synthetic peptide corresponding to mouse Sir2 sequence (amino acids 722-737 with N-terminal added lysine), conjugated to KLH. This sequence is 62% homologous to the corresponding human sequence.

Anti-Sir2 (AS-16) antibody produced in rabbit has been used in

western blotting
immunoprecipitation
antibody microarray

Biochem/physiol Actions
Sir2, one of the silent information regulator genes, encodes a protein that promotes a compact chromatin structure, thereby preventing or silencing gene transcription at selected loci. Silencing occurs as a series of events initiated by formation of Sir complexes (Sir2, Sir3, Sir4). Sir2 protein is an NAD-dependent histone deacetylase. Sir2 transfers acetyl groups from its protein substrates to ADP-ribose and synthesizes o-acetyl ADP-ribose. Through histone deacetylation, Sir2 may silence chromatin. It appears that Sir2 NAD requirement makes this protein an important player in the pathway that leads to increased life span of several species through calorie restriction.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% bovine serum albumin and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~110 kDa
species reactivity	mouse
packaging	antibody small pack of 25 µL
application(s)	indirect immunofluorescence: 1:50 using mouse NIH3T3 cells","microarray: suitable","western blot: 1:2,000 using mouse NIH/3T3 cells
conjugate	unconjugated
UniProt accession no.	Q923E4,
shipped in	dry ice
storage temp.	20°C
Gene Information	mouse ... Sirt1(93759)

Sir2 is short for Silent mating type Information Regulation-2. Sir2 (whose homolog in mammals is known as SIRT1, SIR2L1 or Sir2α) is the namesake of a family of closely related enzymes, the sirtuins. Members of this family have been found in nearly all organisms studied. Sirtuins are hypothesized to play a key role in an organism′s response to stresses (such as heat or starvation) and to be responsible for the lifespan-extending effects of calorie restriction. Sirtuins act by removing acetyl groups from proteins in the presence of NAD+; they are thus classified as "NAD+-dependent deacetylases". In mammals, SIRT1 (the mammalian homolog of Sir2) has been shown to deacetylate and thereby deactivate the p53 protein.
Specificity
This antibody recognizes SIRT1.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SIRT1 Antibody, clone 10E4

eCl@ss:	32160702
NACRES:	NA.41

Epitope: Unknown
His-tagged recombinant protein corresponding to human SIRT1.

Use Anti-SIRT1 Antibody, clone 10E4 (mouse monoclonal antibody) validated in WB, IP, ICC, IHC, ChIP to detect SIRT1 also known as sirtuin (silent mating type information regulation 2 homolog) 1, sirtuin 1.
Research Sub Category
Histones
Does not react in mouse in IHC. Mouse sequence is 100% identical to immunogen, so it is predicted to work in western blotting.
Research Category
Epigenetics & Nuclear Function
Immunoprecipitation: Reported by independent researcher using representative lot.
Chromatin Immunopreiciptiation: Reported by independent researcher using representative lot.
Immunohistochemistry: Reported by independent researcher using representative lot.
Quality
Evaluated by Western Blot in HeLa cell lysate.
Western Blot Analysis: 0.5 µg/ml of this antibody detected SIRT1 on 10 µg of HeLa cell lysate.
Target description
~ 110 kDa
Physical form
Protein G Purified
Purified mouse monoclonal IgGκ in buffer containing 0.1 M Tris-Glycine (pH 7.4, 150 mM NaCl) with 0.05% sodium azide.
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
HeLa cell lysate

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

NAD-dependent protein deacetylase sirtuin-1 (UniProt: Q923E4; also known as Regulatory protein SIR2 homolog 1, SIR2-like protein 1, SIR2alpha, Sir2, mSIR2a, Sirt-1) is encoded by the Sirt1 (also known as Sir2l1) gene (Gene ID: 93759) in murine species. Sirt1 is a NAD-dependent protein deacetylase that is widely expressed and links transcriptional regulation directly to intracellular energetics. In liver, Sirt1 is expressed in a circadian manner with maximal and minimal levels reaching at around Zeitgeber time (ZT) 16 and ZT4, respectively and its deacetylase activity is also regulated in a circadian manner that peaks at ZT15. It participates in the coordination of several cellular functions such as cell cycle, response to DNA damage, metabolism, apoptosis, and autophagy. It is shown to modulate chromatin function through deacetylation of histones and can promote alterations in the methylation of histones and DNA, leading to transcriptional repression. It deacetylates a broad range of transcription factors and coregulators, thereby regulating target gene expression in both positive and negative manner. Sirt1 serves as a sensor of the cytosolic ratio of NAD+/NADH, which is altered by glucose deprivation and metabolic changes associated with caloric restriction. Sirt1 has four nucleotide (NAD)-binding regions and four zinc binding sites. It is reported to shuttle between nucleus and cytoplasm. Sir1 is proteolytically cleaved by cathepsin B upon TNF-alpha treatment to yield a catalytic inactive but stable 75 kDa fragment (aa 2-525). Sirt1 can be phosphorylated by multiple protein kinases. It is phosphorylated by STK4/MST1 that results in inhibition of SIRT1-mediated p53/TP53 deacetylation and phosphorylation by MAPK8/JNK1 at serine 46 and threonine 522 is reported to increase its nuclear localization and enzymatic activity. Sirt1 phosphorylation at threonine 522 by DYRK1A and DYRK3 activates its deacetylase activity and can promote cell survival.
Specificity
Clone 3-10 specifically detects murine Sirt1.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	10-E-4, monoclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µL
application(s)	ChIP: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
NCBI accession no.	NP_036370.2,
UniProt accession no.	Q96EB6,
shipped in	ambient
Gene Information	human ... SIRT1(23411)

Узнать цену

Подробнее

Anti-Sirt1(Sir2) Antibody, clone 3-10 Antibody, rabbit monoclonal

His-tagged full-length recombinant mouse NAD-dependent protein deacetylase sirtuin-1 (Sirt1).

Anti-Sirt1(Sir2), clone 3-10, Cat. No. MABE426-I, is a highly specific rabbit monoclonal antibody that targets NAD-dependent protein deacetylase sirtuin-1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected Sirt1(Sir2) in mouse cerebral cortex tissue sections.
Quality
Evaluated by Western Blotting in NIH/3T3 cell lysate.
Western Blotting Analysis: A 1:5,000 dilution of this antibody detected Sirt1(Sir2) in NIH/3T3 cell lysate.
Target description
~110 kDa observed; 80.37 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Rabbit monoclonal antibody in cell culture supernatant with 0.05% sodium azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Rabbit polyclonal anti-Sirt2 antibody recognizes mouse, rat (37/43 kDa), and human (43 kDa) Sirt2. Detection of the Sirt2 bands by immunoblotting is specifically inhibited with the immunizing peptide.
Sirtuin 2 (SIRT2) is a cytoplasmic protein, which is part of the sirtuin family of proteins. SIRT2 colocalizes with microtubules. This gene is located on human chromosome 19q13.2.
Sirt2 is an NAD+-dependent tubulin deacetylase. Two Sirt2 isoforms exist as the result of alternative splicing. Sirt2 is overexpressed during mitosis and is multiply phosphorylated at the G2/M transition of the cell cycle, indicating that it plays a role in the control of mitotic exit in the cell cycle. Although Sirt2 resides predominantly in the cytoplasm, it becomes enriched in the nucleus during the cell cycle where it is associated with mitotic structures. Sirt2 was found to be an oligodendroglial protein that affects cell differentiation through deacetylating α-tubulin.

biological source	rabbit
antibody form	unpurified
antibody product type	primary antibodies
clone	3-10, monoclonal
species reactivity	mouse
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG
NCBI accession no.	NP_062786,
UniProt accession no.	Q923E4,

Узнать цену

Подробнее

Anti-Sirt2 antibody produced in rabbit

MDL number:	MFCD07784768
NACRES:	NA.41

synthetic peptide corresponding to amino acids 341-352 of mouse Sirt2, conjugated to KLH. The corresponding sequence is identical in rat and differs by one amino acid in human Sirt2.

Rabbit polyclonal anti-Sirt2 antibody may be used in several applications including immunoblotting, immunoprecipitation, and immunofluorescence.
Anti-Sirt2 antibody has been used in western blotting and immunofluorescence.
Biochem/physiol Actions
Sirtuin 2 (SIRT2) maintains the integrity of the genome. Inhibition of SIRT2 can lead to neuroprotection in cellular and invertebrate models of Huntington′s disease. SIRT2 can deacetylate lys40 of α-tubulin both in vitro and in vivo. Knockdown of SIRT2 by small interfering RNA (siRNA) leads to tubulin hyperacetylation.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen 37:43 kDa (rat)","antigen 43 kDa (human)
species reactivity	mouse, human, rat
packaging	antibody small pack of 25 µL
application(s)	immunoprecipitation (IP): 2-5 µg using extract of COS7 cells or 293 cells expressing recombinant human SIRT2 protein.","indirect immunofluorescence: 5-10 µg/mL using human HeLa cells.","western blot: 1-2 µg/mL using whole extracts of mouse and rat brain.
conjugate	unconjugated
UniProt accession no.	Q8IXJ6,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SIRT2(22933) mouse ... Sirt2(64383) rat ... Sirt2(361532)

Sirtuin 6 (Sirt6) is a nuclear and chromatin-associated protein that belongs to the mammalian Sir2 gene family. It is broadly expressed with the highest levels in muscle, brain and heart.
Specificity
Anti-Sirt6 (N-terminal) recognizes human and mouse Sirt6. The detection of the Sirt6 band by immunoblotting is specifically inhibited with the immunizing peptide.

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport

Узнать цену

Подробнее

Anti-Sirt6 (N-terminal) antibody produced in rabbit

synthetic peptide corresponding to amino acids 19-33 of human Sirt6 via a C-terminal cysteine residue. The sequence is identical in mouse and differs by one amino acid in rat.

Anti-Sirt6 (N-terminal) antibody produced in rabbit has been used in immunoblotting.
Biochem/physiol Actions
Sirtuin 6 (Sirt6) plays a key role in DNA repair and maintenance of genomic stability in cells. Sirt6 is enzymatically inactive as a NAD+ -dependent protein deacetylase but displays auto-ADP-ribosyltransferase activity. Loss of Sirt6 leads to the development of an acute degenerative aging-like phenotype.
Physical form
Solution in 0.01 M phosphate buffered, saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~40 kDa
species reactivity	human, mouse, rat (predicted)
packaging	antibody small pack of 25 µL
concentration	~1 mg/mL
application(s)	western blot: 2-4 µg/mL using whole extracts of human 293 cells transfected with Sirt6","western blot: 2-4 µg/mL using whole extracts of mouse 3T3 cells
conjugate	unconjugated
UniProt accession no.	Q8N6T7,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SIRT6(51548) rat ... Sirt6(299638)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SIX4 antibody produced in rabbit

HPA031794 Human Protein Atlas characterization data

SIX homeobox 4 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77710,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL
immunogen sequence	DGSTFTSESTTVQQGKVFLSSLAPSAVVYTVPNTGQTIGSVKQEGLERSLVFSQLMPVNQNAQVNANLSSENISGSGLHPLASSLVNVSPTH
conjugate	unconjugated
UniProt accession no.	Q9UIU6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SIX4(51804)

SLAM family member 7 (UniProt: Q9NQ25; also known as SLAMF7, CD2 subset 1, CD2-like receptor-activating cytotoxic cells, CRACC, Membrane protein FOAP-12, Novel Ly9, Protein 19A, CD319) is encoded by the SLAMF7 (also known as CS1, UNQ576/PRO1138) gene (Gene ID: 57823) in human. SLAMF-7 is a single-pass type I membrane protein that is expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression has also been detected in multiple myeloma cells, NK cells, activated B-cells, and NK-cell line, but not in promyelocytic, B-, or T-cell lines. It serves as a receptor on immune cells, including natural killer (NK) cells. SLAMF7 is reported to mediate both activating and inhibitory effects on NK cells, depending on the expression of adaptor EAT-2. In cells lacking EAT-2 it mediates inhibition via SHIP-1, which is recruited via Tyr 261 of SLAMF7. SLAMF7 is shown to be involved in phagocytosis of hematopoietic tumor cells independent of signaling lymphocyte activation molecule-associated protein (SAP) adaptors, but depends on its ability to interact with integrin Mac-1 and utilizes signals involving ITSM motif (aa 302-307). SLAMF7 is synthesized with a signal peptide (aa 1-22), which is subsequently removed to generate the mature form that has an extracellular domain (aa 23-226), a short transmembrane domain (aa 227-247), and a cytoplasmic tail (aa 248-335). Seven different isoforms of SLAMF7 have been described that are produced by alternative splicing. Clone 162 is shown to block the augmented capacity of human blood-derived macrophages to engulf Raji cells in response to Anti-CD47 antibodies. (Ref.: Guo, H., et al. (2015). Mol. Cell. Biol. 35 (1); 41-51; Chen, J., et al. (2017). Nature 544 (7651); 493-497).
Specificity
Clone 162 is a mouse monoclonal antibody that detects SLAM family member 7 (SLAMF7) in human cells. It targets an epitope with in the extracellular domain.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SLAMF7 (CD319) Antibody, clone 162

Epitope: extracellular domain
Recombinant protein fragment corresponding to 204 amino acids from the extracellular domain of human SLAM family member 7 fused with human IgG1 constant region.

Anti-SLAMF7 (CD319), clone 162, Cat. No. MABF2093, is a mouse monoclonal antibody that detects SLAM family member 7 and has been tested for use in Flow Cytometry, Function Analysis, Immunohistochemistry (Paraffin), Immunoprecipitation, and Inhibition studies.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected SLAMF7 (CD319) in human bone marrow tissue sections.
Flow Cytometry Analysis: A representative lot detected SLAMF7 (CD319) in Flow Cytometry applications (Bouchon, A., et. al. (2001). J Immunol. 167(10):5517-21).
Affects Function Analysis: A representative lot stimulated SLAMF7, which resulted in an increase SHIP-1 tyrosine phosphorylation in OPM2 and MM1S cells expressing EGFR-CD45. (Guo, H., et. al. (2015). Mol Cell Biol. 35(1):41-51).
Inhibition Analysis: A representative lot blocked the augmented capacity of human blood-derived macrophages to engulf Raji cells in response to anti-CD47 antibodies. (Chen, J., et. al. (2017). Nature. 544(7651):493-497).
Immunoprecipitation Analysis: A representative lot immunoprecipitated SLAMF7 (CD319) in Immunopreciptation applications (Bouchon, A., et. al. (2001). J Immunol. 167(10):5517-21; Tassi, I., et. al. (2005). J Immunol. 175(12):7996-8002).
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry (Paraffin) in human tonsil tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected SLAMF7 (CD319) in human tonsil tissue sections.
Target description
37.42 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	162, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	cell analysis: suitable (function assay)","flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","inhibition assay: suitable
isotype	IgG2b
NCBI accession no.	NP_067004.3,
UniProt accession no.	Q9NQ25,
Gene Information	human ... SLAMF7(57823)

Узнать цену

Подробнее

Anti-SLC16A1 antibody produced in rabbit

HPA071055 Human Protein Atlas characterization data

solute carrier family 16 (monocarboxylate transporter), member 1

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST90318,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL
immunogen sequence	KEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTDGGPKEEESPV
conjugate	unconjugated
UniProt accession no.	P53985,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SLC16A1(6566)

pictograms	GHS07
signalword	Warning
hcodes	H315 - H319
pcodes	P305 + P351 + P338
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SLC23A2 antibody produced in rabbit

HPA052825 Human Protein Atlas characterization data

solute carrier family 23 (nucleobase transporters), member 2 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST85933,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL
immunogen sequence	DKWKCNTTDVSVANGTAELLHTEHIWYPRI
conjugate	unconjugated
UniProt accession no.	Q9UGH3,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SLC23A2(9962)

The solute carrier family 9 member A1 (SLC9A1) gene is mapped to human chromosome 1p36.11. The encoded protein is widely expressed in many tissues and is localized to the plasma membrane. SLC9A1 is the only isoform found in mammalian cardiomyocytes. This gene encodes a 815 amino acid protein containing 12 transmembrane spanning domain and a cytoplasmic domain with many regulatory sites.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SLC9A1 antibody produced in rabbit

Anti-SLC9A1 antibody produced in rabbit has been used in western blotting.
Biochem/physiol Actions
Solute carrier family 9 member A1 (SLC9A1) mediates the electroneutral exchange of Na+-H+ in response to intracellular acidosis. It drives extracellular Na+ uptake in exchange for intracellular H+. SLC9A1 maintains the pH and cell volume regulation of vertebrate cells. It is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors, mitogens, neurotransmitters, tumor promoters and cell shrinkage.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~95 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	western blot: 2.5-5.0 µg/mL using whole extract of human platelets
conjugate	unconjugated
UniProt accession no.	P19634,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SLC9A1(6548)

SMAD2 or Mothers against decapentaplegic homolog 2 is a polypeptide that, as its name describes, is a homolog of the Drosophila gene: "Mothers against decepentaplegic". It belongs to the SMAD family of proteins, which belong to the TGFbeta superfamily of modulators. Like many other TGFβ family members SMAD2 is involved in cell signalling. SMAD2 modulates signals of activin and TGFbeta′s. It interacts with SMAD anchor for receptor activation (SARA). The binding of ligands causes the phosphorylation of the SMAD2 protein and the dissociation from SARA and the association with SMAD4. It is subsequently transferred to the nucleus where it forms complexes with other proteins and acts as a transcription factor. SMAD2 is a receptor regulated SMAD (R-SMAD) and is activated by bone morphogenetic protein type 1 receptor kinase.
Specificity
Recognizes human Smad2 Mr 55-60 kDa and Smad3 Mr 50 kDa as determined by using Smad2 and Smad3 transfected Cos cells.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Smad2/3 Antibody

eCl@ss:	32160702
NACRES:	NA.41

Fusion protein corresponding to amino acids 186-273 of human Smad2.

Research Sub Category
Transcription Factors
Immunoblot Analysis: 1:1000-1:2000 dilution detected Smad2/3 in RIPA lysates of HepG2 cells.
Optimal working dilutiuons must be determined by end user.
Research Category
Epigenetics & Nuclear Function
Anti-Smad2/3 Antibody is a Rabbit Polyclonal Antibody for detection of Smad2/3 also known as MAD-mothers against decapentaplegic-homolog 2 & has been validated in WB.
Quality
Routinely evaluated by Western Blot on Hela lysates.
Western Blot Analysis:
1:500 dilution of this lot detected SMAD2/3 on 10 µg of Hela lysates.
Target description
50-60 kDa

Replaces: 04-1029
Physical form
Purified rabbit polyclonal IgG in buffer containing 0.07 M Tris-glycine, pH 7.4, 0.105 M NaCl, 0.035% sodium azide and 30% glycerol.
ImmunoAffinity Purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variabillity in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.
Analysis Note
Control
HepG2 cell lysate.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	mouse, rat, human
packaging	antibody small pack of 25 µL
Торговая марка	Upstate^®
application(s)	western blot: suitable
isotype	IgG
NCBI accession no.	NP_001003652,
UniProt accession no.	Q15796,
shipped in	ambient
Gene Information	human ... SMAD2(4087)

Узнать цену

Подробнее

Anti-SMARCAL1 antibody produced in rabbit

HPA020337 Human Protein Atlas characterization data

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a-like 1 (SMARCAL1) takes part in the sustenance of the replication forks during transcription and double stranded break (DSB) repair which is regulated by non-homologous end-joining (NHEJ). At single-stranded unwound regions, it interacts with replication protein A (RPA) and enhances the annealing process at the ends. Mutations in the gene encoding this protein have been associated with Schimke immuno-osseous dysplasia (SIOD). Studies have shown that disruption in the gene encoding this protein increased the sensitivity to chemotherapeutic topoisomerase 2 inhibitors.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73717,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	SYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKGKCVRNGDRFQVLIGYNAELIAVFKTLPSKNYDPDTKTWNFS
conjugate	unconjugated
UniProt accession no.	Q9NZC9,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SMARCAL1(50485)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SMARCC2 antibody produced in rabbit

HPA021213 Human Protein Atlas characterization data

The gene SMARCC2 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2) is mapped to human chromosome 12q13.2. SMARCC2 is commonly referred to as BAF170 (BRG1-associated factor 170).

SWI/SNF complex subunit SMARCC2 recombinant protein epitope signature tag (PrEST)

Anti-SMARCC2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
SWI/SNF (SWItch/Sucrose Non-Fermentable) chromatin-remodeling complexes are important for binding of transcription factors to nucleosomal DNA. SMARCC2 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2) is a core subunit of SWI/SNF. It is suggested that SMARCC2 is required for interaction of SWI/SNF complex with zinc finger DNA-binding domain structures, thereby bringing the complex to nucleosomal sites. SMARCC2 and BAF155 (BRG1-associated factor 155) regulate the protein levels of BAF57 and also support the stoichiometry of the SWI/SNF complex. SMARCC2 is up-regulated in HIV (human immunodeficiency virus)-1 infected cells. Absence of SMARCC2 inhibits viral activation in promyelocytic cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73718,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	AFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAA
conjugate	unconjugated
UniProt accession no.	Q8TAQ2,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SMARCC2(6601)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SMIM1 antibody produced in rabbit

HPA069088 Human Protein Atlas characterization data

small integral membrane protein 1 (Vel blood group)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88238,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: 1:50- 1:200
immunogen sequence	QPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKL
conjugate	unconjugated
UniProt accession no.	B2RUZ4,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SMIM1(388588)

Systemic lupus erythematosus (SLE) is a chronic autoimmune disease with a wide range of clinical manifestations and the presence of multiple autoantibodies. Anti-Smith antibodies are highly specific for SLE and are reported to be of importance in the classification of this disease. Smith antigens (Sm) are RNase resistant, non-histone nuclear proteins that are composed of several polypeptides of differing molecular weights. They include B, B , D1, D2, D3, E, F, and G polypeptides and associate with small ribonucleoproteins U1, U2, U4, U5, and U6. They are reported to be essential for the splicing of pre-mRNA in eukaryotes. Of these D1 and D3 are the most common antigens recognized by anti-Sm antibodies found in SLE subjects. Although Sm proteins are antigenically conserved and exist as RNA-protein complex, RNA does not play a major role in its antigenicity. Clone Y12 is reported to strongly react with native D1, D3, and B in immunoblot applications, but not with recombinantly expressed D1. It requires symmetrical dimethylarginines (sDMAs) for antigen recognition. This clone is reported to recognize an linear epitope (aa 95-119) in human D1 protein. (Ref.: Brahms, H., et al. (2000). J. Biol. Chem. 275(22); 17122-17129; Pettersson, I., et al. (1984). J. Biol. Chem. 259(9); 5907-5914; Dang, H., et al. (1983). J. Immunol 130(6); 2782-2785).
Specificity
Clone Y12 is a mouse monoclonal antibody that detects Smith Antigen.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Smith Antigen Antibody, clone Y12

Quality Level	200
biological source	mouse
antibody form	purified antibody
antibody product type	primary antibodies
clone	Y12, monoclonal
mol wt	calculated mol wt 25 kDa","observed mol wt ~25 kDa
purified by	using protein G
species reactivity	mouse, human
packaging	antibody small pack of 100 µL
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG3
conjugate	unconjugated
UniProt accession no.	N/A,
shipped in	2-8°C

Histone-lysine N-methyltransferase SMYD3 (UniProt: Q9H7B4; also known as EC: 2.1.1.43, SET and MYND domain-containing protein 3, Zinc finger MYND domain-containing protein 1) is encoded by the SYMD3 (also known as ZMYND1, ZNFN3A1) gene (Gene ID: 64754) in human. SMYD3 is a member of the class V-like SAM-binding methyltransferase superfamily that specifically methylates Lys-4 of histone H3, inducing di- and tri-methylation, but not monomethylation. The SET domain of SMYD3 shows histone H3-lysine 4 (H3-K4)-specific methyltransferase activity, which is enhanced in the presence of HSP90A. SMYD3 also contains a MYND-type zinc finger domain (aa 49-87). It plays an important role in transcriptional activation as a member of an RNA polymerase II complex. SMYD3 is mainly cytoplasmic when cells are arrested at G0/G1, but accumulates in the nucleus at S phase and G2/M phases. It is expressed in skeletal muscles and testis and its overexpression has been shown in a majority of colorectal and hepatocellular carcinomas. Introduction of SMYD3 into NIH3T3 cells is reported to enhance cell growth and the knockdown of this gene with SiRNA induces growth suppression in cancer cells. (Ref.: Hamamoto, R et al. (2004). Nat. Cell Biol. 6(8); 731-740; Sarris, ME et al. (2016). Cancer Cell 29(3); 354-366).
Specificity
This rabbit polyclonal antibody detects Histone-lysine N-methyltransferase SMYD3 in human and murine cells.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SMYD3

eCl@ss:	32160702
NACRES:	NA.41

His-tagged full length recombinant human Histone-lysine N-methyltransferase SMYD3.
Epitope: unknown

Anti-SMYD3, Cat. No. ABE2870, is a highly specific rabbit polyclonal antibody that targets Histone-lysine N-methyltransferase SMYD3 and has been tested in Chromatin Immunoprecipitation (ChIP) and Western Blotting.
Chromatin Immunoprecipitation Analysis: A representative lot detected SMYD3 in livers of 8.5 months old DEN-treated wild-type and Smyd3-KO mice (Sarris, M.E., et. al. (2016). Cancer Cell. 29(3):354-66).
Western Blotting Analysis: A representative lot detected SMYD3 in whole cell and nuclear extracts from the livers of 8.5 months-old untreated and DEN-treated (Sarris, M.E., et. al. (2016). Cancer Cell. 29(3):354-66).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HEPG2 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected SMYD3 in 10 µg of HEPG2 cell lysate.
Target description
~49 kDa observed; 49.10 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human, mouse
packaging	antibody small pack of 25 µL
application(s)	ChIP: suitable (ChIP-seq)","western blot: suitable
isotype	IgG
NCBI accession no.	NP_001161212,
UniProt accession no.	Q9H7B4,

SNAP-25 (Synaptosome-associated protein of 25 kDa) is a membrane bound, presynaptic nerve terminal protein, that plays an essential role in synaptic vesicle fusion and exocytosis. The gene encoding SNAP-25 is mapped to human chromosome 20.
Anti-SNAP-25 is developed in rabbit using a synthetic peptide corresponding to the N-terminus of human SNAP-25 conjugated to KLH as immunogen. This sequence is identical in SNAP-25 alternatively spliced forms SNAP-25A and SNAP-25B, in mouse, rat and chicken SNAP-25 and highly conserved (80-85%) in goldfish and zebrafish SNAP25. Whole antiserum is fractionated and then further purified by ion-exchange chromatography to provide the IgG fraction of antiserum that is essentially free of other rabbit serum proteins. Anti-SNAP-25 recognizes mouse SNAP-25 (25 kD). The antibody cross-reacts with rat SNAP-25. Applications include the detection and localization of SNAP-25 (25 kDa) by immunoblotting and immunohistochemistry. Staining of SNAP-25 in immunoblotting is specifically inhibited with SNAP-25 immunizing peptide (SNAP-25, mouse)
Specificity
The immunogen sequence is identical in SNAP-25A and SNAP-25B splice variants in mouse, rat and chicken SNAP-25, and is highly conserved (70-80%) in bovine, goldfish, torpedo and Drosophila SNAP-25.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SNAP-25 antibody produced in rabbit

MDL number:	MFCD00675279
NACRES:	NA.46

Synthetic peptide corresponding to the N-terminal of human SNAP-25 (synaptosome-associated protein-25) amino acids conjugated to KLH.

Anti-SNAP-25 antibody produced in rabbit has been used in:

the primary detection of SNAP-25
enzyme-linked immunosorbent assay in human neuroblastoma cell lines
immunohistochemistry
in human neuronal cells using western blotting

Biochem/physiol Actions
Synaptosome-associated protein of 25 kDa codes for a protein impacting axonal growth, synaptic plasticity, and presynaptic neurons necessary for the regulation of neurotransmitter release.
The molecular events leading to neurotransmitter release in the synaptic cleft are complex, involving multiple interacting proteins, generically termed SNAP receptors (SNAREs). It has been suggested that SNAP-25 and syntaxin on the neuronal plasma membrane (t-SNARE) and synaptobrevin/VAMP on the synaptic vesicle (v-SNARE) form a stable ternary complex. This core complex serves as a docking complex for two additional membrane fusion proteins, -SNAP and NSF. ATP hydrolysis by NSF causes dissociation of the complex during priming of the exocytosis machinery. SNAP-25 induced reassembly and interaction with synaptotagmin (Syt), is thought to drive the Ca2+ -triggered vesicle-plasma membrane fusion and exocytosis. SNAP-25 has a key role in both developing and mature neurons. During development, SNAP-25 expression correlates with synaptogenesis, axonal growth and neuronal maturation and is found mainly in cell bodies of neonatal brain. In the adult nervous system, SNAP-25 is localized to presynaptic nerve terminals where it is conveyed by fast axonal transport.
SNAP-25 consists of two alternatively spliced isoforms SNAP-25a and SNAP-25b, differentially expressed in neurons and neuroendocrine cells. SNAP-25a and SNAP-25b differ by nine amino acids in the central domain. Two of these residues alter the relative positioning of clustered cysteine residues that are required for post-translational palmitoylation implicated in membrane anchoring, suggesting that the two SNAP-25 isoforms may play distinct roles in vesicular fusion events.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. Storage in "frost-free" freezers is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen 25 kDa
species reactivity	mouse, rat
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:5,000 using rat cerebellum sections","microarray: suitable","western blot: 1:10,000 using rat pheochromocytoma PC12 cell extract","western blot: 1:5,000 using mouse brain extract
conjugate	unconjugated
UniProt accession no.	P60879,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SNAP25(6616) mouse ... Snap25(20614) rat ... Snap25(25012)

Sodium-coupled neutral amino acid transporter 2 (UniProt: Q9JHE5; also known as Amino acid transporter A2, Solute carrier family 38 member 2, System A amino acid transporter 2, System A transporter 1, System N amino acid transporter 2) is encoded by the Scl38a2 (also known as Ata2, Sa1, Sat2, Snat2) gene (Gene ID: 29642) in rat. Sodium-coupled neutral amino acid transporter 2 is a multi-pass membrane protein that functions as a sodium-dependent amino acid transporter and mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. It may also function in the transport of amino acids at the blood-brain barrier and in the supply of maternal nutrients to the fetus through the placenta. Its transport action is reported to be inhibited by N-methyl-D-glucamine and choline. It is enriched in the somatodendritic compartment of neurons and is also detected at the axonal shaft, but is excluded from the nerve terminal. It is also expressed in skeletal muscle and adipose tissue. Its levels are up-regulated upon amino acid deprivation that results from increased transcription and protein stabilization.
Specificity
This polyclonal antibody detects sodium-coupled neutral amino acid transporter 2 (SNAT2) in rat brain. It targets an epitope within the first 65 amino acids.

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	nwg
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SNAT2

eCl@ss:	32160702
NACRES:	NA.41

Epitope: N-terminus
GST-tagged recombinant fragment corresponding to the first 65 amino acids from te N-terminal region of rat Sodium-coupled neutral amino acid transporter 2 (SNAT2).

Anti-SNAT2, Cat. No. ABN1734, is a highly specific rabbit polyclonal antibody that targets Sodium-coupled neutral amino acid transporter 2 and has been tested in Immunocytochemistry, Immunofluorescence, Immunohistochemistry, and Western Blotting.
Research Category
Neuroscience
Immunofluorescence Analysis: A 1:150 dilution from a representative lot detected SNAT2 in rat cerebral cortex and human cerebellum tissue sections.
Immunocytochemistry Analysis: A representative lot detected SNAT2 in Immunocytochemistry applications (Grewal, S., et. al. (2009). J Biol Chem. 284(17):11224-36).
Western Blotting Analysis: A representative lot detected SNAT2 in Western Blotting applications (Yao, D., et. al. (2000). J Biol Chem. 275(30):22790-7; Melone, M., et. al. (2006). Neuroscience. 140(1):281-92; Grewal, S., et. al. (2009). J Biol Chem. 284(17):11224-36).
Immunohistochemistry Analysis: A representative lot detected SNAT2 in Immunohistochemistry applications (Melone, M., et. al. (2006). Neuroscience. 140(1):281-92).
Quality
Evaluated by Immunofluorescence in rat brain sections.
Immunofluorescence Analysis: A 1:150 dilution of this antibody detected SNAT2 in rat brain tissue sections.
Target description
55.55 kDa calculated.
Physical form
Format: Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Stable for 1 year at -20°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat
packaging	antibody small pack of 25 µL
application(s)	immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_851604,
UniProt accession no.	Q9JHE5,
shipped in	ambient

The SWI-SNF complex is involved in the activation of transcription via the remodeling of nucleosome structure in an ATP-dependent manner. Brm (also designated SNF2α) and Brg-1 (also designated SNF2β) are the ATPase subunits of the mammalian SWI-SNF complex. Brm, Brg-1, Ini1 (integrase interactor 1, also designated SNF5), BAF155 (also designated SRG3) and BAF170 are thought to comprise the functional core of the SWI-SNF complex. Addition of Ini1, BAF155 and BAF170 to Brg-1 appears to increase remodeling activity. Other complex subunits are thought to play regulatory roles. hSNF2L and hSNF2H both appear to be homologs of Drosophila ISWI, a Brm related ATPase that is present in chromatin remodeling complexes other than SWI/SNF, including the NURF (nucleosome remodeling factor).
The SNF2 family of proteins are ATP dependant chromatin remodeling enzymes. The gene encoding this protein is also refered to as SMARCA4.
Specificity
This antibody recognizes the Near N-Terminus of SNF2B

WGK Germany

WGK 1

Узнать цену

Подробнее

Anti-SNF2/BRG1 Antibody

eCl@ss:	32160702
NACRES:	NA.41

GST-tagged recombinant protein corresponding to the Near N-Terminus of human SNF2β.

Immunocytochemistry Analysis: A 1:250 dilution from a representative lot detected BRG1 in HeLa cells.
Research Sub Category
Cell Cycle, DNA Replication & Repair
Transcription Factors
Research Category
Epigenetics & Nuclear Function
Use Anti-SNF2β/BRG1 Antibody (rabbit polyclonal antibody) validated in IP, WB to detect SNF2β/BRG1 also known as Probable global transcription activator SNF2L4, ATP-dependent helicase SMARCA4, SNF2-beta, BRG-1.
Quality
Evaluated by Western Blotting in HELA NE cell lysate.
Western Blotting Analysis: A 1:4,000 dilution of this antibody detected SNF2B/BRG1 in 10 µg of HELA NE cell lysate.
Target description
200 kDa
Physical form
Unpurified
Rabbit polyclonal in buffer containing with 0.05% sodium azide with 30% glycerol.
Storage and Stability
Maintain for 2 years at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
HeLa Nuclear Extract.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Snurportin 1 contains an N-terminal importin β binding (IBB) motif, 2,2,7-trimethylguanosine (TMG) cap-binding domain, an ill-defined region and a Cterminal m3Gcap-binding region. The SNUPN gene is mapped on the human chromosome at 15q24.2.
Specificity
Anti-Snurportin 1 recognizes human snurportin 1.

biological source	rabbit
Quality Level	100
antibody form	serum
antibody product type	primary antibodies
clone	polyclonal
species reactivity	rat, mouse, human
packaging	antibody small pack of 25 µL
Торговая марка	Upstate^®
application(s)	immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NM_003072,
UniProt accession no.	P51532,
shipped in	ambient
Gene Information	human ... SMARCA4(6597)

Узнать цену

Подробнее

Anti-Snurportin 1 (C-terminal) antibody produced in rabbit

Anti-Snurportin 1 (C-terminal) antibody produced in rabbit may be used in immunoblotting and immunoprecipitation.
Biochem/physiol Actions
Snurportin 1 mediates the nuclear import of 5′2,2,7terminal trimethylguanosine (m3G)-capped uridine-rich small nuclear RNPs (U snRNPs), an important step in the maturation of the spliceosome. This protein binds with importin β that mediates the interaction with the nuclear pore complex (NPC). It also interacts with m3G-cap but not with 5′terminal 7monomethylguanosine (m7G)-cap structures and chromosomal maintenance 1 (Crm1)/exportin 1. Snurportin 1 was found to accumulate in Cajal bodies after the import of U2 but not U1 snRNPs.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~41 kDa
packaging	antibody small pack of 25 μL
concentration	~1.0 mg/mL
application(s)	immunoprecipitation (IP): 2.5-5 μg using lysates of HEK-293T cells over expressing human Snurportin 1, western blot: 1-2 μg/mL using lysates of HEK-293T cells over expressing human Snurportin 1
conjugate	unconjugated
shipped in	dry ice
storage temp.	−20°C
Gene Information	human ... SNUPN(10073)

Snurportin 1 (also known as RNA U transporter 1, SPN1 and SNUPN) comprises three known functional domains: an N-terminal importin-β binding domain (IBB) motif and trimethylguanosine (TMG) cap-binding domain. SNUPN is mapped to human chromosome 15q24.2.
Specificity
Anti-Snurportin 1 (N-terminal) recognizes human snurportin 1.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Snurportin 1 (N-terminal) antibody produced in rabbit

Anti-Snurportin 1 (N-terminal) antibody produced in rabbit may be used in immunoblotting and immunoprecipitation.
Biochem/physiol Actions
Snurportin 1 (also known as RNA U transporter 1, SPN1 and SNUPN), mediates nuclear import of 7-methylguanosine (m7G) and trimethylguanosine (TMG)-capped uridine-rich small nuclear RNPs (U snRNPs), an important step in the maturation of the spliceosome. The N-terminal importin- binding domain (IBB) motif, which binds importin that mediates the interaction with the nuclear pore complex (NPC). The TMG cap-binding domain interacts specifically with m3G-cap but not with m7G-cap structures, and an ill-defined region responsible for binding to exportin 1. The active nuclear import, entry of spliceosomal U snRNPs into the nucleus by the importin b/Snurportin1/U snRNP complex does not require RanGTP. Snurportin 1 accumulates in Cajal bodies after import of U2 but not U1 snRNPs.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~41 kDa
packaging	antibody small pack of 25 μL
concentration	~1.0 mg/mL
application(s)	immunoprecipitation (IP): 2.5-5 μg using lysates of HEK-293T cells over expressing human Snurportin 1, western blot: 1-2 μg/mL using lysates of HEK-293T cells over expressing human Snurportin 1
conjugate	unconjugated
shipped in	dry ice
storage temp.	−20°C
Gene Information	human ... SNUPN(10073)

Sorting nexin-9 (UniProt: Q9Y5X1; also known as SH3 and PX domain-containing protein 1, Protein SDP1, SH3 and PX domain-containing protein 3A, SNX9) is encoded by the SNX9 (also known as SH3PX1, SH3PXD3A) gene (Gene ID: 51429) in human. SNX9 is widely expressed, with highest levels reported in heart and placenta, and lowest levels in thymus and peripheral blood leukocytes. SNX9 is localized at sites of endocytosis at the cell membrane and is detected on newly formed macropinosomes. It is transiently recruited to clathrin-coated pits at a late stage of clathrin-coated vesicle formation. SNX9 can exist as a homo dimer or homo oligomer and can also heterodimerize with SNX18. It displays four phosphatidylinositol 4,5-bisphosphate binding sites. It has a SH3 domain (aa 1-63), a SNX-type Phox homology (PX) domain (aa 250-361), and a BAR domain (aa 292-595). The PX domain mediates its interaction with membranes enriched in phosphatidylinositol phosphate. SNX9 can stimulate the GTPase activity of dynamin and both its SH3 domain and more C-terminal domains are required to efficiently stimulate this GTPase activity. Although it has high affinity for phosphatidylinositol 4,5-bisphosphate, but can also bind to membranes enriched in other phosphatidylinositol phosphates. SNX9 can be phosphorylated on tyrosine residues by TNK2 and phosphorylation promotes its activity in the degradation of EGFR. SNX9 is shown to be involved in endocytosis and intracellular vesicle trafficking, both during interphase and at the end of mitosis. It is required for efficient progress through mitosis and cytokinesis and also for normal formation of the cleavage furrow at the end of mitosis. (Ref.: Schobel, S., et al. (2008). J. Biol. Chem.283(21); 14257-14268).
Specificity
Clone 6C6 is a rat monoclonal antibody that detects human Sorting nexin 9 (SNX9). It targets an epitope with in the SH3 domain.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SNX9 Antibody, clone 6C6

GST-tagged full-length recombinant human Sorting Nexin-9 protein.

Anti-SNX9, clone 6C6, Cat. No. MABT1538, is a rat monoclonal antibody that detects human Sorting nexin-9 protein and has been tested for use in Western Blotting.
Research Category
Cell Structure
Western Blotting Analysis: A representative lot detected SNX9 in Western Blotting applications (Schobel, S., et. al. (2008). J Biol Chem. 283(21):14257-68).
Quality
Evaluated by Western Blotting in HCT116 cell lysate.
Western Blotting Analysis: A 1:250 dilution of this antibody detected SNX9 in HCT116 cell lysate.
Target description
~74 kDa observed; 66.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Sodium/iodide cotransporter (UniProt: Q92911; also known as Na(+)/I(-) cotransporter, Sodium-iodide symporter, Na(+)/I(-) symporter, Solute carrier family 5 member 5) is encoded by the SLC5A5 (also known as NIS) gene (Gene ID: 6528) in human. Sodium/iodide cotransporter is a multi-pass membrane protein that mediates iodide uptake in thyroid gland. It is expressed primarily in thyroid tissue, but is present in lower levels in mammary gland and ovary. It is found in the basolateral membrane of thyroid follicular cells where it mediates efficient iodide uptake from the bloodstream into the thyroid using the sodium gradient generated by Na+/K+-ATPase. It transports one iodide ion along with two sodium ions following the inwardly directed sodium gradient. Sodium/iodide cotransporter expression is significantly reduced in tumors. The presence of symporter in mammary glands leads to secretion of iodine in milk that is required for thyroid function in neonatal animals. NIS gene and protein expression is stimulated by thyroid-stimulating hormone. Both human and rat NIS contain N-glycosylation sites, however, glycosylation is not required for its full activity. Mutations in SLC5A5 gene are known to cause thyroid dyshormonogenesis (TDH1) that is characterized by the inability of the thyroid to maintain a concentration difference of readily exchangeable iodine between the plasma and the thyroid gland, leading to congenital hypothyroidism. Autoantibodies to NIS adversely affect iodide transport.
Specificity
Clone ARN1 is a mouse monoclonal antibody that detects Sodium/iodide cotransporter in human cells. It targets an epitope within 13 amino acids from the C-terminal region.

biological source	rat
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	6C6, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	western blot: suitable
isotype	IgG1
NCBI accession no.	NP_057308.1,
UniProt accession no.	Q9Y5X1,

Узнать цену

Подробнее

Anti-Sodium-Iodide Symporter Antibody, clone ARN1

Epitope: C-terminus
KLH-conjugated linear peptide corresponding to 13 amino acids from the C-terminal region of human Sodium/iodide cotransporter.

Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected Sodium-Iodide Symporter in human stomach tissue sections.
Immunohistochemistry (Paraffin) Analysis: A representative lot detected Sodium-Iodide Symporter in Immunohistochemistry applications (Tazebay, U.H., et. al. (2000). 6(8):871-8).
Anti-Sodium-Iodide Symporter, clone ARN1, Cat. No. MABC1191, is a mouse monoclonal antibody that detects Sodium/iodide cotransporter and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in MDCK cells transduced with human WT NIS.
Western Blotting Analysis: 1 µg/mL of this antibody detected Sodium-Iodide Symporter in MDCK cells transduced with human WT Sodium-Iodide Symporter (NIS).
Target description
~68 kDa observed; 68.67 kda calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 140 mM Tris and 180 mM Glycine (pH 7.4) without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Sodium/hydrogen exchanger 3 (UniProt: Q28362; also known as Na(+)/H(+) exchanger 3, NHE-3, Solute carrier family 9 member 3) is encoded by the SLC9A3 (also known as NHE3) gene in Didelphis virginiana (North American opossum). NHE-3 is a multi-pass membrane protein that is involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. NHE-3 is predominantly expressed in kidney and gut, where it is found on the apical membranes of polarized epithelial cells and plays a central role in transepithelial reabsorption of sodium ions and secretion of hydrogen ions. Renal NHE-3 is essential in maintaining blood pressure and steady-state plasma sodium levels when dietary sodium chloride intake is modified. In the intestine epithelial cells, it localizes to the ileal brush border. Dysfunction of NHE-3 in intestine is associated with a variety of diarrheal diseases. HNE-3 can be phosphorylated by SGK1 at Ser669 that increases its abundance at the cell membrane. (Ref.: D Souza, S et al. (1998). J. Biol. Chem. 273(4); 2035 2043; Fenton, RA et al (2017). Kidney Int. doi: 10.1016/j.kint.2017.02.001. [Epub ahead of print]).
Specificity
Clone CH3 detects Sodium/hydrogen exchanger 3 in human, opossum, and rat kidney cells. It targets an epitope within 356 amino acids from the C-terminal half.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	ARN1, monoclonal
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_000444.1,
UniProt accession no.	Q92911,

Узнать цену

Подробнее

Anti-sodium/hydrogen exchanger 3 Antibody, clone 3H3

eCl@ss:	32160702
NACRES:	NA.41

MBP-conjugated recombinant fragment corresponding to 356 amino acids from the C-terminal half of Opossum sodium/hydrogen exchanger 3.

Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected NHE3 in human kidney and human stomach tissue sections.
Western Blotting Analysis: A representative lot detected NHE3 in Western Blotting applications (Wang, D., et. al. (2006). Am J Physiol Renal Physiol. 290(2):F428-37; Queiroz-Leite, G.D., et. al. (2011). Biochem Biophys Res Commun. 409(3):470-6; Goyal, S., et. al. (2005). Am J Physiol Renal Physiol. 288(3):F530-8; Kocinsky, H.S., et. al. (2005). Am J Physiol Renal Physiol. 289(2):F249-58; Di Sole, F., et. al. (2008). J Cell Physiol. 216(1):221-33; Baum, M., et. al. (2012). Am J Physiol Renal Physiol. 303(11):F1495-502; Lessa, L.M., et. al. (2012). Am J Physiol Renal Physiol. 303(10):F1399-408).
Immunohistochemistry Analysis: A representative lot detected NHE3 in Immunohistochemistry applications (Pao, A.C., et. al. (2010). Am J Physiol Renal Physiol. 299(6):F1496-506).
Immunoprecipitation Analysis: A representative lot detected NHE3 in Immunoprecipitation applications (Girardi, A.C., et. al. (2004). Am J Physiol Renal Physiol. 287(5):C1238-45).
Anti-NHE3, clone 3H3, Cat. No. MABN1813, is a highly specific mouse monoclonal antibody that targets Sodium/hydrogen exchanger 3 and has been tested for use in Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in COS-7 cells transfected with wild type NHE3 plasmid DNA.
Western Blotting Analysis: 0.25 µg/mL of this antibody detected NHE3 in lysates from COS-7 cells transfected with wild type NHE3 plasmid DNA.
Target description
~75 kDa observed; 94.77 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	3H3, monoclonal
species reactivity	opossum, rat, human, mouse
species reactivity (predicted by homology)	porcine (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
UniProt accession no.	Q28362,
shipped in	ambient

Target description
SORBS2 (C-terminal), sorbin and SH3 domain containing 2, encodes the sorbin and SH3 domain containing 2 protein. It has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-SORBS2 (C-terminal) antibody produced in rabbit

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~85 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.5 mg/mL
application(s)	indirect immunofluorescence: 20-40 µg/mL using HeLa cells","western blot: 0.2-0.4 µg/mL using HEK-293T cell lysates expressing human SORBS2
conjugate	unconjugated
UniProt accession no.	O94875,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SORBS2(8470)

SORBS2 or ArgBP2 is an adapter protein that regulates actin-dependent cell adhesion and migration. ArgBP2 facilitates the ubiquitination and degradation of c-Abl. In heart muscle cells, ArgBP2 is localized at Z-disks of sarcomeres and may regulate elasticity of cardiac sarcomeres, whereas in the epithelial cells ArgBP2 may modulate the assembly of signaling complexes in stress fibers . Anti-SORBS2 antibody is specific for human SORBS2 (85 kDa). Staining of the SORBS2 band in immunoblotting is specifically inhibited with the immunizing peptide.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SORBS2 antibody, Mouse monoclonal

synthetic peptide corresponding to amino acids 29-46 of human SORBS2, conjugated to KLH.

Anti-SORBS2 antibody is suitable for use in western blot (5-10 μg/mL using HeLa total cell extracts) and immunocytochemistry.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	S13N, monoclonal
form	buffered aqueous solution
mol wt	antigen ~85 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	immunocytochemistry: suitable","western blot: 5-10 µg/mL using HeLa total cell extracts
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	O94875,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SORBS2(8470)

Monoclonal Anti-SORBS3 (mouse IgG1 isotype) is derived from the hybridoma SORB132 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide. The gene for sorbin and SH3 domain containing 3 (SORBS3) protein, also known as vinexin is mapped to human chromosome 8p21.3. This protein belongs to a family of adaptor proteins. All the family members share a sorbin homology (SoHo) domain in the N-terminal region, which has been shown to bind the lipid raft-associated protein flotillin1. These proteins also contain three Src homology 3 (SH3) domains in the C-terminal region, which allows the binding of specific signaling and cytoskeletal molecules, including vinculin. There are three different isoforms of SORBS3 (, and ) protein have been characterized. Isoform and contain three SH3 domains while the isoform does not include the N-terminal SoHo domain. The isoform of vinexin has been characterized in mouse fetal gonads. It differs from the isoform in a few amino acids that are missing from the N-terminal region. Vinexin is ubiquitously expressed but vinexin and show tissue specific expression.
Specificity
Monoclonal Anti-SORBS3 recognizes human and monkey SORBS3.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SORBS3 antibody ,Mouse monoclonal

Anti-SORBS3 antibody, Mouse monoclonal is suitable for immunoblotting.
Biochem/physiol Actions
Vinexin and participates in cell signaling and the cytoskeletal structure. The isoform is known to induce actin stress fiber formation. Vinexin might enhance the activation of c-Jun N-terminal kinase/stress-activated protein kinase (JNK/SAPK) in response to epidermal growth factor (EGF) stimulation by using its third SH3 domain. The growth-factor-induced signal transductions are controlled by the vinexin-son of sevenless (SOS) interactions.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze at –20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	mouse
antibody form	purified from hybridoma cell culture
antibody product type	primary antibodies
clone	SORB132, monoclonal
form	buffered aqueous solution
mol wt	antigen 37 kDa
species reactivity	human, monkey
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	western blot: 2-4 µg/mL using A431 total cell extracts
isotype	IgG1
conjugate	unconjugated
UniProt accession no.	O60504,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SORBS3(10174)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Anti-SORL1 (C-terminal) antibody produced in rabbit has been used in immunoblotting.
Biochem/physiol Actions
Sortilin related receptor 1 (SORL1) protein plays a key role in intracellular protein transport and endocytosis, cell signaling and the proliferation and migration of smooth muscle cells. It acts as a receptor for lipoproteins, glial cell-line-derived neurotrophic factor (GDNF) and platelet-derived growth factor (PDGF). Expression of this protein is developmentally regulated, with high transcript levels found during morphogenesis. SORLA is involved in development of atherosclerosis and in Alzheimer′s disease (AD). It mediates the uptake of apolipoprotein E (ApoE)-rich lipoproteins and is markedly induced in atheroma. SORL1 is known to play a regulating role in trafficking and processing of the amyloid precursor protein (APP) in neuronal cells. In the Golgi, SorLA/LR11 binding of APP leads to sequestration of APP and thereby it blocks the processing to the beta-amyloid peptide.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR	NONH for all modes of transport
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SORL1 (C-terminal) antibody produced in rabbit

biological source	rabbit
Quality Level	200
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen ~250 kDa
species reactivity	human, rat
packaging	antibody small pack of 25 µL
concentration	~1.0 mg/mL
application(s)	western blot: 1-2 µg/mL using rat cerebellum (S1 fraction)
conjugate	unconjugated
UniProt accession no.	Q92673,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... SORL1(6653) mouse ... Sorl1(20660) rat ... Sorl1(300652)

Sox-2 plays a key role in embryonic stem cell development, and has been shown to help stem cells maintain pluripotent potential. It has also been shown to be associated with uncommitted dividing stem cell and precursor cells of the developing CNS.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SOX-2 Antibody

Recombinant GST Fusion protein.

Research Category
Epigenetics & Nuclear Function
Research Sub Category
Transcription Factors
Anti-SOX-2 Antibody detects level of SOX-2 & has been published & validated for use in IC, IH & WB.
Quality
Tested
Target description
~34 kDa
Physical form
Purified Immunoglobulin by protein A affinity chromatography and presented as a liquid in 0.02 M phosphate buffer, pH 7.6, with 0.25 M NaCl. Contains 0.1% sodium azide.
Format: Purified
Storage and Stability
Maintain refrigerated at 2-8°C in undiluted aliquots for up to 12 months.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Quality Level	100
biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	6F1.2, monoclonal
species reactivity	mouse, human
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable","western blot: suitable
input	sample type neural stem cell(s) sample type: mouse embryonic stem cell(s) sample type: human embryonic stem cell(s) sample type induced pluripotent stem cell(s)
isotype	IgG2b
NCBI accession no.	NM_003106.2,
UniProt accession no.	P48431,
shipped in	ambient
storage temp.	2-8°C

Transcription factor SOX-9 (UniProt P48436; also known SOX-9) is encoded by the SOX9 gene (Gene ID 6662) in human. SOX family of genes are related to the mammalian sex determining gene SRY. These genes contain sequences encoding for the HMG-box domains that mediate sequence-specific DNA binding. SOX genes encode transcriptional regulators involved in cell fate decision during development and the control of diverse developmental processes. The highly complex group of SOX genes cluster at about 40 genomic loci and at least 30 SOX genes have been identified. SOX-9 contains one HMG box DNA-binding domain and acts as a key regulator of developmental processes, including male sex determination, normal skeletal development, chondrogenesis, neurogenesis, and neural crest development. SOX-9 is acts downstream of sonic hedgehog signaling and is shown to be essential for the maintenance of multipotent neural stem cells in embryonic and adult central nervous system (CNS). It is not detected in neuroblasts of the adult subependymal zone (SEZ); however, it is expressed by transit amplifying cells and ependymal cells in the same region. SOX-9 is also shown to be essential for the switch from neurogenesis to gliogenesis in caudal regions of the developing CNS. SOX-9 up-regulation is reported in cancers of various origins, including breast, colon, prostate, and lung, where its expression correlates with malignancy and patient survival. (Ref.: Scott, CE et al. (2010). Nat. Neurosci. 13(10): 1181-89).
Specificity
This rabbit ployclonal antibody detects SOX-9 in human, mouse, and rat cells. It targets an epitope with in 24 amino acids from the C-terminal end. This antibdy does not recognize Sox10.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Sox-9

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 24 amino acids from the C-terminal end of human Sox-9.
Epitope: C-terminus

Research Category
Epigenetics & Nuclear Function
Anti-Sox-9, Cat. No. ABE2868, is a highly specific rabbit polyclonal antibody that targets Transcription factor SOX-9 and has been tested in Immunocytochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, and Western Blotting.
Western Blotting Analysis: A 1:500 dilution from a representative lot detected SOX-9 in 10 µg of HepG2 cell lysate.
Western Blotting Analysis: A representative lot detected SOX-9 in Western Blotting applications (Augereau, C., et. al. (2016). Hum Mol Genet. Epub ahead of print).
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected SOX-9 in HEK293T cells transfected with Sox-9 (Courtesy of Dr. Patrick Jacquemin atUniversit catholique de Louvain).
Immunofluorescence Analysis: A representative lot detected SOX-9 in PFA-fixed, paraffin-embedded pancreatic sections from an adult mouse; ductus (Augereau, C., et. al. (2016). Hum Mol Genet. 25(22):5017-5026).
Immunohistochemistry Analysis: A representative lot detected SOX-9 in PFA-fixed, paraffin-embedded liver (left) and pancreatic sections (right) of E14.5 mouse embryo, PFA-fixed, paraffin-embedded intestine sections of E14.5 mouse embryo (Augereau, C., et. al. (2016). Hum Mol Genet. 25(22):5017-5026).
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected SOX-9 in e14.5 mouse liver and e14.5 mouse pancreas tissues.
Immunocytochemistry Analysis: A representative lot detected SOX-9 in PFA-fixed 3T3 cells overexpressing Sox9 (Augereau, C., et. al. (2016). Hum Mol Genet. 25(22):5017-5026).
Quality
Evaluated by Western Blotting in L6 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected SOX-9 in 10 µg of L6 cell lysate.
Target description
~65 kDa observed; 56.14 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Rabbit polyclonal antiserum with 0.02% sodium azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

biological source	rabbit
Quality Level	100
antibody form	unpurified
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human, rat, mouse
packaging	antibody small pack of 25 µL
application(s)	immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG
NCBI accession no.	NP_000337,
UniProt accession no.	P48436,
Gene Information	human ... SOX9(6662)

Transcription factor SOX-17 (UniProt: Q61473; also known as SOX-17) is encoded by the Sox-17 gene (Gene ID: 20671) in murine species. Sox17 protein is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. It binds to the sequences 5-AACAAT-3 or 5-AACAAAG-3 and modulates transcriptional regulation via WNT3A. Sox17 is reported to act upstream of the Notch system and downstream of the canonical Wnt system and acts as a link between the canonical Wnt and Notch signaling systems. It is involved in the regulation of the formation of cells that go on to develop into endodermal tissues like pancreatic and liver cells. SOX17 is the key regulator of human primordial germ cells (hPGSc) fate and is considered as one of the earliest markers. It is also shown to be the transcription factor for the regulation of oligodendrocyte progenitor cells, maintenance of fetal hematopoeitic stem cells, and in the mediation of cardiac muscle cell formation. SOX17 is selectively expressed in arterial endothelial cells at the early stages of embryonic development and maintains the same distribution postnatally and in the adult. Inactivation of SOX17 in endothelial cells in mouse embryo leads to a lack of arterial differentiation and vascular remodeling, which that results in embryo death in utero. (Ref.: Corada, M., et al. (2013). Nat. Communications 4, 2609; Niakan, KK et al. (2010). Gene Dev. 24(3): 312-326).
Specificity
This polyclonal antibody detects Sox17 in human, mouse, and rat. It targets an epitope within 17 amino acids from the N-terminal region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SOX17

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to 17 amino acids from the N-terminal region of murine Sox17.

Western Blotting Analysis: 2 µg/mL from a representative lot detected SOX17 in 10 µg of human spinal cord tissue lysate.
Immunofluorescence Analysis: A 1:150-300 dilution from a representative lot detected SOX17 in human testis and rat colon tissues.
Immunohistochemistry Analysis: A 1:50-250 dilution from a representative lot detected SOX17 in human prostate, mouse stomach, and rat uterus tissues.
Anti-SOX17, Cat. No. 09-038-I-25UG, is a highly specific rabbit polyclonal antibody, that targets Transcription factor SOX-17 and has been tested in Western Blotting and Immunofluorescence and Immunohistochemistry (Paraffin).
Western Blotting Analysis: 2 µg/mL from a representative lot detected SOX17 in 10 µg of human spinal cord tissue lysate.
Immunofluorescence Analysis: A 1:150-300 dilution from a representative lot detected SOX17 in human testis and rat colon tissues.
Immunohistochemistry Analysis: A 1:50-250 dilution from a representative lot detected SOX17 in human prostate, mouse stomach, and rat uterus tissues.
Research Category
Neuroscience
Anti-SOX17, Cat. No. 09-038-I, is a highly specific rabbit polyclonal antibody that targets Transcription factor SOX-17 and has been tested in Immunohistochemistry (Paraffin), Immunofluorescence, and Western Blotting.
Quality
Evaluated by Western Blotting in H9 human stem cells.
Western Blotting Analysis: 2 µg/mL of this antibody detected SOX17 in 10 µg of H9 human stem cells lysate.
Target description
~40 kDa observed; 44.65 kDa calculated. Uncharacterized bands may be observed in some lysate(s).

Replaces: 09-038
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Stable for 1 year at 2-8°C from date of receipt.

Transcription factor SOX-2 (UniProt: P48431; also known as SOX-2, Sex determining region Y-box 2, SRY-related HMG-box gene 2) is encoded by the SOX2 gene (Gene ID: 6657) in human. SOX-2 is a transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. It is shown to be critical for early embryogenesis and for embryonic stem cell pluripotency. It may function as a switch in neuronal development. It allows neural cells in undifferentiated state by counteracting the activity of proneural proteins and suppresses neuronal differentiation. Sumoylation of SOX-2 is shown to inhibit binding on DNA and negatively regulate the FGF4 transactivation. Defects in SOX2 gene are linked to microphthalmia that is characterized by eye malformation ranging from small eye size of a single eye to complete bilateral absence of ocular tissue.
Specificity
This antibody recognizes Sox2 C-terminal region.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	rat, mouse, human
packaging	antibody small pack of 25 µg
application(s)	immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable
NCBI accession no.	NP_035571,
UniProt accession no.	Q61473,
shipped in	ambient

Узнать цену

Подробнее

Anti-Sox2 Antibody

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to a C-terminal region sequence of human Sox2.

Anti-SOX2 Antibody, Cat. No. AB5603, is a highly specific rabbit polyclonal antibody SOX2 and has been tested for use in Immunocytochemistry, and Immunohistochemistry (Paraffin), and Western Blotting.
Immunocytochemistry Analysis: 10 µg/mL from a representative lot detected Sox2 in H9 human stem cells.
Immunocytochemistry Analysis: A representative lot detected nuclear Sox2 immunoreactivity in 4% paraformaldehyde-fixed, 0.1% Triton X-100-permeabilized human embryonic stem cells (hESCs) by fluorescent immunocytochemistry (Kingham, E., et al. (2013). Small. 9(12):2140-2151).
Immunocytochemistry Analysis: A representative lot detected Sox2 immunoreactivity by fluorescent immunocytochemistry staining of 4% paraformaldehyde-fixed iPSCs generated from human kidney tubular renal epithelial cells (Montserrat, N., et al. (2012). J. Biol. Chem. 287(29):24131-24138).
Immunocytochemistry Analysis: A representative lot detected Sox2 immunoreactivity by fluorescent immunocytochemistry staining of 4% paraformaldehyde-fixed, 0.5% Triton X-100-permeabilized iPSCs generated from the skin cells of patients with Parkinsons disease (Snchez-Dans, A., et al. (2012). EMBO Mol. Med. 4(5):380-395).
Immunocytochemistry Analysis: Representative lots detected Sox2 immunoreactivity by fluorescent immunocytochemistry staining of 4% paraformaldehyde-fixed, 0.2% Triton X-100-permeabilized iPSCs generated from mouse ear cells and MEF (Burns, J.C., et al. (2012). PLoS One. 7(10):e48704; Hadadeh, O., et al. (2012). PLoS One. 7(11):e49065).
Western Blotting Analysis: A representative lot detected Sox2 in mouse embryonic stem cell (mESC) nuclear extracts (Banaszynski, L.A., et al. (2013). Cell. 155(1):107-120).
Immunofluorescence Analysis: A representative lot detected Sox2-positive cells in 4% paraformaldehyde-fixed, 0.3% Triton X-100-permeabilized mouse brain vibratome sections by fluorescent immunohistochemistry (Matsuda, S., et al. (2012). J. Neurosci. 32(36):12543-12557).
Immunohistochemistry Analysis: A representative lot detected Sox2 immunoreactivity in 4% paraformaldehyde-fixed whole mount mouse embryo sections (van Rooijen, C., et al. Development. 139(14):2576-2583).
Quality
Evaluated by Western Blotting in mouse embryonic stem cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected SOX2 in 10 µg of mouse embryonic stem cell lysate.
Target description
~39 kDa observed. 34.31 kDa (human) and 34.45 (mouse) calculated. Uncharacterized band(s) may appear in some lysates

Replaces: AB5770
Analysis Note
Control
Immunoblot: Mouse or human embryonic stem cell lysate, mouse embryonic germ cell lysate
Immunocytochemistry: Human embryonic stem cells (H9 line)

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Quality Level	300","100
biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human, mouse
species reactivity (predicted by homology)	rhesus macaque (based on 100% sequence homology), rat (based on 100% sequence homology), bovine (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable
NCBI accession no.	NP_003097,
UniProt accession no.	P48431,
shipped in	ambient
storage temp.	2-8°C

Sox genes comprise a family of genes that are related to the mammalian sex determining gene SRY. These genes similarly contain sequences that encode for the HMG-box domain, which is responsible for the sequence-specific DNA binding activity. Sox genes encode putative transcriptional regulators implicated in the decision of cell fates during development and the control of diverse developmental processes. The highly complex group of Sox genes cluster at a minimum of 40 different loci that rapidly diverged in various animal lineages. At present 30 Sox genes have been identified, and members of this family have been shown to be conserved during evolution and to play key roles during animal development. Some are involved in human diseases, including sex reversal.
Specificity
Recognizes Sox9.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Sox9 Antibody

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linear peptide corresponding to the C-terminal sequence of human Sox9.
Epitope: C-terminal

Replaces: AB5809
Physical form
ImmunoAffinity Purified
Purified rabbit polyclonal antibody in buffer containing PBS with 0.05% sodium azide
Storage and Stability
Stable for 6 months at 2-8°C in undiluted aliquots from date of receipt.
Analysis Note
Control
Embryonic tissue, Adult chondrocytes.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Anti-Sp1 Antibody

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	rat, chicken, mouse, human
species reactivity (predicted by homology)	sheep (based on 100% sequence homology), equine (based on 100% sequence homology), feline (based on 100% sequence homology), bovine (based on 100% sequence homology)
packaging	antibody small pack of 25 µg
Торговая марка	Chemicon^®
application(s)	ChIP: suitable (ChIP-seq)","immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable
NCBI accession no.	NP_000337,
UniProt accession no.	P48436,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... SOX9(6662), SRA1(10011)

eCl@ss:	32160702
NACRES:	NA.41

Sp1 is a human transcription factor involved in gene expression in the early development of an organism. The protein is 785 amino acids long, with a molecular weight of 95 kDA. The SP1 transcription factor contains a zinc finger protein motif, by which it binds directly to DNA and enhances gene transcription. Sp1 has always been described as a ubiquitous transcription factor that is required for the constitutive and inducible expression of a variety of genes, such as in cell cycle or mammalian development.
Specificity
Recognizes Sp1, Mr 105 kDa and 95 kDa.
Expected to cross-react with rat.

Full length human Sp1 protein.

Use Anti-Sp1 Antibody (Rabbit Polyclonal Antibody) validated in ChIP, EMSA, IF, IP, WB to detect Sp1 also known as Sp1 transcription factor, specificity protein 1.
Research Sub Category
Transcription Factors
Research Category
Epigenetics & Nuclear Function
Immunoprecipitation:
4 µg of this lot immunoprecipitated Sp1 from 500 µg of HeLa nuclear extract.
NOTE: A previous lot successfully immunoprecipitated the -1 subunit using the Catch and Release v2.0 Reversible Immunoprecipitation System (Catalog # 17-500). See manual for more information and protocol: www.millipore.com
Chromatin Immunoprecipitation:
Reported by an independent laboratory.
Immunofluorescence:
Reported by an independent laboratory.
Electrophoretic Mobility Shift Assay (EMSA):
1 µL of a previous lot of this antibody has been reported by an independent laboratory to supershift DNA complexes containing recombinant Sp1 and endogenous Sp1 from HeLa cells in EMSA.
Quality
Routinely evaluated by Western Blot on HeLa lysates.
Western Blot Analysis:
1:500 dilution of this lot detected SP1 on 10 µg of HeLa lysates.
Target description
Varies

Replaces: MABE550
Physical form
Format: Purified
Protein A purified
Purified rabbit polyclonal IgG in buffer containing 0.014 M phosphate buffer, pH 7.6, 0.175 M NaCl, 0.07% sodium azide and 30% glycerol.
Storage and Stability
Stable for 1 year at 2-8ºC from date of receipt.
Analysis Note
Control
HeLa nuclear extract.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

biological source	rabbit
Quality Level	100
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	polyclonal
species reactivity	human, rat, mouse
packaging	antibody small pack of 25 µg
Торговая марка	Upstate^®
application(s)	ChIP: suitable","electrophoretic mobility shift assay: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG
NCBI accession no.	NP_003100.1,
UniProt accession no.	P08047,
shipped in	ambient

Узнать цену

Подробнее

Anti-SPATA13 antibody produced in rabbit

HPA041208 Human Protein Atlas characterization data

spermatogenesis associated 13 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST81387,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL
immunogen sequence	NQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLT
conjugate	unconjugated
UniProt accession no.	Q96N96,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... SPATA13(221178)

Spectrin beta (UniProt: G1SN11) is encoded by the SPTBN1 gene in rabbit. Spectrins belong to the superfamily of proteins called F-actin cross linking proteins that function as scaffolding proteins for protein sorting, cell adhesion, and migration. They are principle components of a cell membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. They are actin binding proteins that serves as a membrane organizer and stabilizer. Spectrin beta II is a multifunctional protein that contains lipid-binding sites within its two calponin-homology domains (aa 82-186 and 201-306) and a pleckstrin homology domain (aa 2224-2334) and triple helical segments. Spectrin beta II is generally associated with the cytoplasmic surface of the membrane by attachment to ankyrin.
Specificity
Clone 2A7 is a mouse monoclonal antibody that detects beta-II spectrin.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-Spectrin beta-II Antibody, clone 2A7

Purified spectrin from frozen rabbit lens membranes.

Research Category
Cell Structure
Anti-Spectrin beta-II , clone 2A7, Cat. No. MABT1364, is a mouse monoclonal antibody that detects Spectrin beta chain and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Immunoprecipitation Analysis: A representative lot immunoprecipitated Spectrin beta-II in Immunoprecipitation applications (Bazellieres, E., et. al. (2012). J Cell Sci. 125(Pt 4):919-31).
Immunocytochemistry Analysis: A representative lot detected Spectrin beta-II in Immunocytochemistry applications (Bazellieres, E., et. al. (2012). J Cell Sci. 125(Pt 4):919-31).
Western Blotting Analysis: A representative lot detected Spectrin beta-II in Western Blotting applications (Bazellieres, E., et. al. (2012). J Cell Sci. 125(Pt 4):919-31).
Quality
Evaluated by Western Blotting in differentiated Caco2 cell lysates.
Western Blotting Analysis: 2 µg/mL of this antibody detected Spectrin beta-II in differentiated Caco2 cell lysates.
Target description
~275 kDa observed; 271.27 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	mouse
antibody form	purified immunoglobulin
antibody product type	primary antibodies
clone	2A7, monoclonal
species reactivity	human, rabbit
packaging	antibody small pack of 25 µg
application(s)	immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable
isotype	IgG1
UniProt accession no.	G1SN11,
Gene Information	human ... SPTBN1(6711)

Sphingomyelin phosphodiesterase 3 (UniProt: Q9NY59; also known as EC: 3.1.4.12, Neutral sphingomyelinase 2, nSMase-2, nSMase2, Neutral sphingomyelinase II) is encoded by the SMPD3 gene (Gene ID: 55512) in human. SMases are classified based on their pH optimum into acid, neutral, and alkaline subtypes. Four different neutral SMases have been described in mammals and nSMase-2 is shown to be the most predominant in cellular systems. nSMase-2 is a phosphoprotein whose activity is regulated by calcineurin (PP2B) and it is shown to be exclusively phosphorylated on serine residues. It is predominantly expressed in the brain and its levels are shown to be up-regulated during G0/G1 phases. Two isoforms of nSMase-2 are reported that are produced by alternative splicing. nSMase-2 catalyzes the generation of bioactive lipid ceramide through the hydrolysis of the membrane lipid sphingomyelin and specifically hydrolyzes the phosphocholine-headgroup from sphingomyelin. It does not exhibit phospholipase C-type activity against phosphatidylcholine, lysophosphatidylcholine, platelet activating factor or lyso-platelet activating factor. For its activity a neutral pH and divalent cations (Mg2+ or Mn2+) are required and its activity is stimulated by the presence of phosphatidylserine (PS) and unsaturated fatty acids. NSMase-2 undergoes palmitoylation and palmitoylation-deficient protein is target for lysosomal degradation. (Ref.: Filosto, S., et al (2010). J. Biol. Chem. 285 (14); 10213-10222; Shamseddine, A.A., et al (2013). Adv. Enz. Regul. 57: 24-41).
Specificity
Clone 14G5.1 detects neutral sphingomyelinase 2 in human and murine brain tissue. It targets an epitope within 101 amino acids from the C-terminal region.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-SPMD3 (nSMase2) Antibody, clone 14G5.1

GST/His-tagged recombinant fragment corresponding to 101 amino acids from the C-terminal region of human Neutral sphingomyelinase 2.

Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected SPMD3 (nSMase2) in human brain tissue lysate.
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected SPMD3 (nSMase2) in human stomach and human fallopian tube tissue sections.
Anti-SPMD3 (nSMase2), clone 14G5.1, Cat. No. MABC1558, is a mouse monoclonal antibody that detects Sphingomyelin phosphodiesterase 3 (sSMase) and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in mouse cerebellum tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected SPMD3 (nSMase2) in mouse cerebellum tissue lysate.
Target description
~70 kDa observed; 71.08 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Mouse monoclonal antibody in tissue culture supernatant without azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

Sterol regulatory element-binding protein 1 (UniProt: P36956; also known as SREBP-1, Class D basic helix-loop-helix protein 1, bHLHd1, Sterol regulatory element-binding transcription factor 1) is encoded by the SREBF1 (also known as BHLHD1, SREBP1) gene (Gene ID: 6720) in human. SREBP-1 is a multi-pass membrane protein that acts as at transcriptional activator required for lipid homeostasis. Six isoforms of SREBP-1 have been described that are produced by alternative splicing. SREBP-1 is expressed in a wide variety of tissues and is most abundant in liver and adrenal gland. In fetal lung and liver it is expressed in high levels. SREBP-1A predominates in hepatoma cell lines while isoform SREBP-1C is predominantly found in liver, adrenal gland, and ovary. Both isoforms IA and IC is found in kidney, brain, white fat, and muscle. SREBP-1 regulates transcription of the LDL receptor gene as well as the fatty acid and to a lesser degree the cholesterol synthesis pathway. It binds to the sterol regulatory element 1 (SRE-1) (5-ATCACCCCAC-3) and has dual sequence specificity binding to both an E-box motif (5-ATCACGTGA-3) and to SRE-1 (5-ATCACCCCAC-3). SREBP-1 has two cytoplasmic domains (aa 1-487 and 567-1147; two helical domains (aa 488-508 and 548-568), and a luminal domain (aa 509-547). In the absence of sterols, it moves from the endoplasmic reticulum to the Golgi. At low cholesterol the SCAP/SREBP complex is recruited into COPII vesicles for export from the ER. In the Golgi complex SREBPs are cleaved sequentially by site-1 and site-2 protease. The first cleavage by site-1 protease occurs within the luminal loop, the second cleavage by site-2 protease occurs within the first transmembrane domain and releases the transcription factor from the Golgi membrane.
Specificity
This rabbit polyclonal antibody detects Sterol regulatory element-binding protein 1 in human.

Quality Level	100
biological source	mouse
antibody form	unpurified
antibody product type	primary antibodies
clone	14G5.1, monoclonal
species reactivity	human, rat, mouse
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG2a
NCBI accession no.	NP_061137,
UniProt accession no.	Q9NY59,
Gene Information	human ... SMPD3(55512)

Узнать цену

Подробнее

Anti-SREBP-1

eCl@ss:	32160702
NACRES:	NA.41

KLH-conjugated linenar peptide corresponding to 14 amino acids from the N-terminal half of human Sterol regulatory element-binding protein 1. The Immunogen sequence is conserved in SREBP-1A, B, and C and in isoform 4.

Immunohistochemistry Analysis: A 1:250-1,000 dilution from a representative lot detected SREBP-1 in human adrenal gland and human kidney tissues.
Research Category
Signaling
Anti-SREBP-1, Cat. No. ABS1508, is a rabbit polyclonal antibdody that detects Sterol regulatory element-binding protein 1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in DU145 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected SREBP-1 in 10 µg of DU145 cell lysate.
Target description
~120 kDa observed; 121.67 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
purified by	affinity chromatography
species reactivity	human
packaging	antibody small pack of 25 µg
application(s)	immunohistochemistry: suitable (paraffin)","western blot: suitable
isotype	IgG
UniProt accession no.	P36956,
shipped in	ambient

Sterol regulatory element-binding protein 1 (UniProt: P36956; also known as SREBP-1, Class D basic helix-loop-helix protein 1, bHLHd1, Sterol regulatory element-binding transcription factor 1) is encoded by the SREBF1 (also known as BHLHD1, SREBP1) gene (Gene ID: 6720) in human. SREBP-1 is a multi-pass membrane protein found on nuclear, endoplasmic reticulum, and Golgi membranes. It attaches to membranes via two hydrophobic sequences (aa 477-497 and 536-556). It is expressed in a wide variety of tissues, but is most abundant in liver and adrenal gland. Six isoforms of SREBP-1 have been described that are produced by alternative splicing. Isoform SREBP-1C predominates in liver, adrenal gland, and ovary, whereas isoform SREBP-1A predominates in hepatoma cell lines. Both isoforms are found in kidney, brain, white fat, and muscle. It serves as a transcriptional activator that is essential for lipid homeostasis and regulates transcription of the LDL receptor gene. It is also involved in fatty acid and cholesterol synthesis. It acts by binds to the sterol regulatory element 1 (SRE-1) (5-ATCACCCCAC-3) and displays dual sequence specificity binding to both an E-box motif (5-ATCACGTGA-3) and to SRE-1 (5-ATCACCCCAC-3). SREBP-1 has two cytoplasmic domains (aa 1-487 and 569-1147), two transmembrane domains (aa 88-508 and 548-568), and one lumenal domain (aa 509-547). In the precursor form, which has a hairpin orientation in the membrane both the N-terminal transcription factor domain and the C-terminal regulatory domain face the cytoplasm. Two separate site-specific proteolytic cleavages are required for release of the transcriptionally active N-terminal domain. These cleavages are carried out by two distinct proteases, called site-1 protease (S1P; aa 490-491) and site-2 protease (S2P; aa 530-531). SREBP-1 can be phosphorylated by AMPK at Ser402, which suppress its processing and nuclear translocation, and thereby repress target gene expression.
Specificity
Clone 2A4 is a mouse monoclonal antibody that detects Sterol regulatory element-binding protein 1. It targets an epitope within 107 amino acids from the N-terminal half.

Flash Point F	does not flash
Flash Point C	does not flash

Узнать цену

Подробнее

Anti-SREBP-1 Antibody, clone 2A4

eCl@ss:	32160702
NACRES:	NA.41

His-tagged recombinant fragment corresponding to 107 amino acids from the N-terminal half of human Sterol regulatory element-binding protein 1 (SREBP-1).

Research Category
Signaling
Western Blotting Analysis: A representative lot detected SREBP-1 in Western Blotting applications (Toth, J.I., et. al. (2004). Mol Cell Biol. 24(18):8288-300; Key, C.C., et. al. (2017). Cell Rep. 19(10):2116-2129; Rosenfeld, J.M., et. al. (1998). J Biol Chem. 273(26):16112-21; Sato, R., et. al. (1994). J Biol Chem. 269(25):17267-73).
Anti-SREBP-1, clone 2A4, Cat. No. MABS2034, is a mouse monoclonal antibody that detects Sterol regulatory element-binding protein 1 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected SREBP-1 in HeLa cell lysate.
Target description
~135 kDa observed; 121.68 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.