Small Pack Antibodies
- Сортировать:
- Вид таблицей
-
Anti-RecQ1 Antibody, clone 5A12.1
eCl@ss: 32160702
Кат. номер MABE1055-25UL MABE1055-100UL General descriptionATP-dependent DNA helicase Q1 (UniProt: P46063; also known as EC:3.6.4.12, DNA helicase, RecQ-like type 1, RecQ1, DNA-dependent ATPase Q1, RecQ protein-like 1) is encoded by the RECQL (also known as RECQ1, RECQL1) gene (Gene ID: 5965) in human. RecQ helicases are a ubiquitous family of DNA unwinding enzymes involved in the maintenance of chromosome stability. They participate in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. Five members of the RecQ family have been reported in human cells: BLM, RECQ1, RECQ4, RECQ5, and WRN. RecQ1 displays high expression in heart, lung, skeletal muscle and kidney. It is also highly expressed in tumor cells and although brain exhibits low level of EecQ1, its expression is dramatically increased in human glioblastoma. Depletion of RecQ1 affects proliferation of glioblastoma cells and causes an increase in the level of DNA damage. RecQ1 depleted tumor cells are shown to be more sensitive to anti-tumor agents, such as hydroxyurea and temozolomide.
Specificity
Clone 5A12.1 specifically detects human ATP-dependent DNA helicase Q1 (RecQ1). It targets an epitope within 87 amino acids from the internal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 87 amino acids from the internal region of human ATP-dependent DNA helicase Q1.ApplicationAnti-RecQ1, clone 5A12.1, Cat. No. MABE1055, is a highly specific mouse monoclonal antibody that targets RecQ1 and has been tested for use in Western Blotting and Immunohistochemistry (Paraffin).
Immunohistochemistry (Paraffin) Analysis: A 1:50-250 dilution from a representative lot detected RecQ1 in human kidney and human tonsil tissue sections.
Quality
Evaluated by Western Blotting in Raji cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected RecQ1 in Raji cell lysate.
Target description
~73 kDa observed; 73.46 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5A12.1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_002898, UniProt accession no. P46063,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-REG3A Antibody, clone 8B11.1
eCl@ss: 32160702
Кат. номер MABF824-25UL MABF824-100UL General descriptionRegenerating islet-derived protein 3-alpha (UniProt: Q06141; also known as REG-3-alpha, Hepatointestinal pancreatic protein, HIP/PAP, Human proislet peptide, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-alpha, Reg III-alpha) is encoded by the REG3A (also known as PAP, PAP1) gene (Gene ID: 5068) in human. REG3-alpha is a member of the C-type lectin super family that exhibits bactericidal activity against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. It is a secretory protein that appears in pancreatic juice after induction of pancreatic inflammation and is shown to be highly induced during acute pancreatitis. In normal healthy pancreas, very low to undetectable expression is seen. It is also involved in hepatic and pancreatic regeneration. REG3-alpha is synthesized with a signal peptide (aa 1-26) and a propeptide (aa 27-37) that are cleaved off in the mature protein. Proteolytic processing by trypsin is shown to remove the inhibitory propeptide and this step is essential for peptidoglycan binding and antibacterial activity. REG3-alpha contain a C-type lectin domain (aa 47-172) and an EPN (Glu-Pro-Asn) motif (aa 114-116), The EPN motif is essential for recognition of the peptidoglycan carbohydrate backbone and for efficient bacterial killing with Glu114 playing a key role in peptidoglycan binding and bactericidal activity.
Specificity
Clone 8B11.1 is a mouse monoclonal antibody that detects human Regenerating islet-derived protein 3-alpha.ImmunogenGST/His-tagged recombinant fragment corresponding to 128 amino acids from the internal region of human Regenerating islet-derived protein 3-alpha.ApplicationAnti-REG3A, clone 8B11.1, Cat. No. MABF824, is a mouse monoclonal antibody that detects Regenerating islet-derived protein 3-alpha (REG3A) and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:50-250 dilution from a representative lot detected REG3A in human small intestine and human stomach tissue sections.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in human small intestine tissue lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected Regenerating islet-derived protein 3-alpha in Human small intestine tissue lysate.
Target description
~17 kDa observed; 19.40 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 8B11.1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_002571, UniProt accession no. Q06141,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Reptin antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200115-25UL SAB4200115-200UL General descriptionMonoclonal Anti-Reptin (mouse IgG1 isotype) is derived from the hybridoma 2E9-5 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a human Reptin fusion protein.
Reptin, also known as RuvB-like 2 RUVBL2, is encoded by the gene mapped to human chromosome 19q13.33. The encoded protein belongs to the AAA+ family of DNA helicases.Immunogena human Reptin fusion protein. The corresponding sequence differs by one amino acid in mouse.ApplicationMonoclonal Anti-Reptin antibody produced in mouse has been used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
- confocal microscopy
Biochem/physiol Actions
Reptin and pontin are associated with several chromatin-remodeling complexes and are involved in multiple biological processes including chromatin remodeling, DNA damage repair, telomerase activity, transcriptional regulation, apoptosis and cancer metastasis. Both proteins are also involved in cellular transformation by β-catenin and c-myc through their chromatin remodeling function.
Reptin has been involved in various cellular processes, including the response to DNA double-strand breaks and the control of gene expression. The encoded protein plays a vital role in repression of specific β-catenin and nuclear factor-κB targets. Elevated expression of the gene leads to the development of hepatocellular carcinomas (HCC) and renal cell carcinoma (RCC). Thus, reptin can be considered as a potential therapeutic target for HCC and RCC.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone 2E9-5, monoclonal form buffered aqueous solution mol wt antigen ~51 kDa species reactivity mouse, human, rat packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) western blot: 0.5-1.0 µg/mL using whole extract of human MCF-7 cells conjugate unconjugated UniProt accession no. Q9Y230, shipped in dry ice storage temp. 20°C Gene Information human ... RUVBL2(10856)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Resistin
eCl@ss: 32160702 NACRES: NA.41
Кат. номер AB3371-I AB3371-I-25UL General descriptionResistin (UniProt: Q9HD89; also known as Adipose tissue-specific secretory factor, ADSF,C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3) is encoded by the RETN (also known as FIZZ3, HXCP1, RSTN) gene (Gene ID: 56729) in rat. Resistin is a dilsulfide-linked homodimeric hormone secreted by the white adipose tissue. It is widely expressed, with strong expression in lung, bone marrow, and breast tissue. Resistin (resistance to insulin) was originally named for its ability to resist or interfere with the action of insulin. It has been linked to the development of atherosclerosis and cardiovascular diseases, non-alcoholic fatty liver disease, rheumatic disease, malignancy, asthma, inflammatory bowel disease and chronic kidney disease. It suppresses the ability of insulin to stimulate glucose uptake into adipose cells and is a key molecule linking obesity to diabetes. Circulating resistin levels are shown to be elevated in diet-induced and genetic forms of obesity and administration of anti-resistin antibody is shown to improve blood glucose levels and insulin action in mice with diet-induced obesity. Two isoforms of resistin have been described that are generated by alternative splicing. (Ref.: Jamaluddin MS et al (2012). Br J Pharmacol. 165(3); 622-632; Steppan, CM et al. (2001). Nature 409 (6818); 307-312).
Specificity
This rabbit polyclonal antibody detects Resistin in rat tissues. It targets an epitope within 17 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 17 amino acids from the N-terminal region of rat resistin.
Epitope: N-terminusApplicationAnti-Resistin Antibody, Cat. No. AB3371-I, is a rabbit polyclonal antibody that detects rat resistin and has been tested for use in Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in Resistin Recombinant Protein.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected recombinant rat resistin.
Target description
~12 kDa observed; 11.42 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat packaging antibody small pack of 25 µL application(s) western blot: suitable NCBI accession no. NP_001180303.1, UniProt accession no. Q9HD89, shipped in ambient Узнать цену -
Anti-REST Antibody, clone 12C11
Кат. номер MABE1982-25UG MABE1982-100UG General descriptionRE1-silencing transcription factor (also known as REST, Neural-restrictive silencer factor, X2 box repressor) is encoded by the REST (also known as NRSF, XBR) gene (Gene ID: 422623) in chicken. REST is a transcriptional repressor that acts by binding a DNA sequence element called the neuron-restrictive silencer element (NRSE). It is ubiquitously expressed, and higher expression is found in the tissues of the lymphocytic compartment, including spleen, thymus, peripheral blood lymphocytes, and ovary. It is also found in undifferentiated neuronal progenitor cells and it is believed that it acts as a master negative regular of neurogenesis. REST is also required to repress endogenous neuronal target genes in non-neuronal tissues, and also to repress these genes in neural precursors. Expression of REST is reported to be cell cycle-dependent with reduced levels in the G2 phase. REST restricts the expression of neuronal genes by associating with two distinct corepressors, SIN3A and RCOR1, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. REST also mediates repression by recruiting the BHC complex at RE1/NRSE sites, which acts by deacetylating and demethylating specific sites on histones and acting as a chromatin modifier. REST is shown to contain nine zinc finger domains, but a C-terminally truncated form is also produced by alternative splicing. Mutations in human REST gene can lead to Wilms tumors, a pediatric malignancy of the kidney that occurs due to uncontrolled multiplication of renal stem, stromal, and epithelial cells. ((Ref.: Chen, ZF., et al. (1998). Nat. Genet. 20(2); 136-142).
Specificity
Clone 12C11 is a mouse monoclonal antibody that detects RE1-silencing transcription factor (REST). It targets an epitope within the N-terminal region.ImmunogenGST-tagged recombinant fragment corresponding to the first 181 amino acids (without the initiator methionine) from Chicken RE1 silencing transcription factor (REST).ApplicationAnti-REST, clone 12C11, Cat. No. MABE1982, is a mouse monoclonal antibody that detects REST and is tested for use in Electrophoretic Mobility Shift Assay, Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in lysate from E14-Tg2a mouse embryonic stem cells.
Western Blotting Analysis (WB): A 1:1,000 dilution of this antibody detected REST in lysate from E14-Tg2a mouse embryonic stem cells.
Tested Applications
Electrophoretic Mobility Shift Assay: A representative lot detected REST in Electrophoretic Mobility Shift Assay. (Kim, S.M., et al. (2006). Biochem Biophys Res Commun. 346(2):426-35).
Immunocytochemistry Analysis: A representative lot detected REST in Immunocytochemistry applications (Shimojo, M. et al. (2008). J Biol Chem. 283(50):34880-6).
Western Blotting Analysis: A representative lot detected REST in Western Blotting applications (Chen, Z.F., et al. (1998). Nat Genet. 20(2):136-42).
Immunoprecipitation Analysis: A representative lot immunoprecipitated REST in Immunoprecipitation applications (Shimojo, M. et al. (2008). J Biol Chem. 283(50):34880-6).
Immunohistochemistry Applications: A representative lot detected REST in Immunohistochemistry applications (Paquette, A.J., et al. (2000). Proc. Natl. Acad. Sci. USA. 97(22):12318-23).
Immunocytochemistry Analysis: A 1:25 dilution from a representative lot detected REST in NTERA-2 cell line.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody clone 12C11, monoclonal mol wt calculated mol wt 170 kDa","observed mol wt ~170 kDa purified by using protein G species reactivity mouse, human, chicken packaging antibody small pack of 100 µg application(s) electrophoretic mobility shift assay: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 epitope sequence N-terminus UniProt accession no. N/A, shipped in 2-8°C Gene Information chicken ... REST(422623)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-REST Antibody, clone 2D9.1
eCl@ss: 32160702
Кат. номер MABC1560-25UG MABC1560 General descriptionRE1-silencing transcription factor (UniProt: Q13127; also known as REST, Neural-restrictive silencer factor, X2 box repressor) is encoded by the REST (also known as NRSF, XBR) gene (Gene ID: 5978) in human. REST is a transcriptional repressor that acts by binding a DNA sequence element called the neuron-restrictive silencer element (NRSE). It is ubiquitously expressed and higher expression is found in the tissues of the lymphocytic compartment, including spleen, thymus, peripheral blood lymphocytes and ovary. The protein is also found in undifferentiated neuronal progenitor cells and it is believed that it acts as a master negative regular of neurogenesis. REST restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. REST also mediates repression by recruiting the BHC complex at RE1/NRSE sites, which acts by deacetylating and demethylating specific sites on histones and acting as a chromatin modifier. REST is shown to contain nine zinc finger domains, but a C-terminally truncated form is also produced by alternative splicing. This variant, REST4, contains five of the zinc-finger domains and has weaker DNA binding capacity. Mutations in REST gene can lead to pediatric malignancy of the kidney which occurs due to uncontrolled multiplication of renal stem, stromal, and epithelial cells.
Specificity
Clone 2D9.1 detects RE1-silencing transcription factor in human cells. It targets an epitope within 297 amino acids from the C-terminal region.ImmunogenGST/His-Tagged recombinant fragment corresponding to 297 amino acids from the C-terminal region of human RE1-silencing transcription factor (REST).ApplicationAnti-REST, clone 2D9.1, Cat. No. MABC1560, s a mouse monoclonal antibody that detects REST and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:50-250 dilution from a representative lot detected REST in human tonsil and human small intestine tissues.
Quality
Evaluated by Western Blotting in HeLa cell nuclear extract.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected REST in 10 µg of HeLa cell nuclear extract.
Target description
~180 kda observed; 121.87 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 2D9.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_001180437, UniProt accession no. Q13127, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Retinal Dehydrogenase 1/ALDH1A1 Antibody, clone 16B4.2
eCl@ss: 32160702
Кат. номер MABD634-25UG MABD634-100UG General descriptionRetinal dehydrogenase 1 (UniProt: P00352; also known as EC: 1.2.1.36, RALDH 1, RalDH1, ALDH-E1, ALHDII, Aldehyde dehydrogenase family 1 member A1, Aldehyde dehydrogenase, cytosolic) is encoded by the ALDH1A (also known as ALDC, ALDH1, PUMB1) gene (Gene ID: 216) in human. Retinal dehydrogenase 1 is a ubiquitously distributed cytosolic enzyme that serves as a detoxification enzyme and also generates retinoic acid. It catalyzes the oxidation of retinal to retinoic acid that is essential for differentiation, development, and survival of dopaminergic neurons. It can also play a role in cellular defense against oxidative stress by oxidizing 4-hydroxynonenal (4-HNE) produced during lipid peroxidation. It is also involved in several other biological processes, such as stem cell maintenance, UV-radiation resistance, melanogenesis, and spermatogenesis, by catalyzing the conversion of specific aldehydes to their corresponding carboxylic acids. Retinal dehydrogenase 1 contains multiple NAD binding sites. (Ref.: Paval, D., et al. (2017). Clin. Psychopharmacol. Neurosci. 5(3); 229-236).
Specificity
Clone 16B4.2 detects Retinal dehydrogenase 1/ALDH1A1. it targets an epitope with in 18 ammo acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 18 amino acids from the C-terminal region of human retinal dehydrogenase 1.ApplicationImmunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected Retinal Dehydrogenase 1/ALDH1A1 in human liver and rat liver tissue sections.
Anti-Retinal Dehydrogenase 1/ALDH1A1, clone 16B4.2, Cat. No. MABD634, is a mouse monoclonal antibody that detects Retinal Dehydrogenase 1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in human liver tissue lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Retinal Dehydrogenase 1/ALDH1A1 in human liver tissue lysate.
Target description
~55 kDa observed; 54.86 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 16B4.2, monoclonal species reactivity human, rat packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2b NCBI accession no. NP_000680, UniProt accession no. P00352,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Retinal Pigment Epithelium 65 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MAB5428 MAB5428-25UG MAB5428-100UG
Specificity
Reacts with Retinal Pigment Epithelium 65 (RPE65). On bovine RPE membranes the antibody recognizes a protein with a molecular weight of ~65 kDa.ImmunogenBovine RPE microsomal membranes.ApplicationResearch Sub Category
Sensory & PNS
Anti-Retinal Pigment Epithelium 65 Antibody detects level of Retinal Pigment Epithelium 65 & has been published & validated for use in ELISA, IH, IP & WB.
Western blot: 1:5,000-1:20,000 on bovine RPE membranes using ECL. Suggested dilution buffer is TBS containing 10% calf serum, 0.25% T-20, 1M D-glucose with 10% glycerol. Suggested blocking buffer is TBS containing 2% BSA and 0.5% Tween 20. Preferred gel percentage is 10%.
Immunohistochemistry on frozen tissue sections: 1:250-1:500
Immunoprecipitation: 20 µg of antibody in a reaction volume of 500 µL.
Immunoaffinity purification
ELISA
Optimal working dilutions must be determined by end user.
Research Category
Neuroscience
Target description
~ 65 kDa
Physical form
Format: Purified
Purified immunoglobulin. Liquid in PBS. Contains no preservative.
Protein A purified
Storage and Stability
Maintain for 1 year at 2–8°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
EyeOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 401.8B11.3D9, monoclonal species reactivity mouse, bovine, human, Xenopus packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) ELISA: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NM_000329.2, UniProt accession no. Q16518, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Retinoschisin Antibody, clone 3R10
eCl@ss: 32160702
Кат. номер MABN2434 MABN2434-25UG General descriptionRetinoschisin (UniProt: O15537; also known as X-linked juvenile retinoschisis protein) is encoded by the RS1 (also known as XLRS1) gene (Gene ID: 6247) in human. Retinoschisin is discoidin domain-containing protein that is localized along the extracellular surfaces of rod and cone photoreceptors and bipolar cells including the synapses. It is undetectable in the inner plexiform layers and the inner nuclear layer. It is active in cell adhesion process during retinal development and maintains the cellular organization and synaptic structure of the retina. Retinoschisin is a homooctamer of 4 homodimers that are linked by disulfide bonds. It contains a single F5/8 type C domain. Deleterious mutations in RS1 encoding retinoschisin are associated with X-linked juvenile retinoschisis (RS), a common form of macular degeneration in males, which is characterized by a negative electroretinogram pattern and by a splitting of the inner retina. Approximately half of cases of X-linked retinoschisis have bilateral peripheral retinoschisis in the inferotemporal part of the retina. Retinoschisin levels are shown to be up-regulated during the differentiation of a retinoblastoma cell line.
Specificity
Clone 3R10 detects Retinoschisin in murine retinal cells. It targets an epitope within 18 amino acids from the N-terminal region.ImmunogenGST-tagged fusion protein containing a the LSSTEDEGEDPWYQKAC peptide fragment corresponding to amino acids 22-39 from the N-terminal region of human Retinoschisin precusor protein.ApplicationImmunofluorescence Analysis: A representative lot detected Retinoschisin in Immunofluorescence applications (Min, S.H., et. al. (2005). Mol Ther. 12(4):644-51; Weber, B.H., et. al. (2002). Proc Natl Acad Sci USA. 99(9):6222-7).
Western Blotting Analysis: A representative lot detected Retinoschisin in Western Blotting applications (Min, S.H., et. al. (2005). Mol Ther. 12(4):644-51; Wu, W.W., et. al. (2003). J Biol Chem. 278(30):28139-46).
Anti-Retinoschisin, clone 3R10, Cat. No. MABN2434, is a highly specific mouse monoclonal antibody that targets Retinoschisin and has been tested in Immunofluorescence and Western Blotting..
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in mouse retinal tissue lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Retinoschisin in 10 µg of mouse retinal tissue lysate.
Target description
~23 kDa observed; 25.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 3R10, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_000321, UniProt accession no. O15537, Узнать цену -
Anti-RGS2 Antibody, clone 9D9.1
eCl@ss: 32160702
Кат. номер MABC1220-25UG MABC1220 General descriptionRegulator of G-protein signaling 2 (UniProt: P41220; also known as RGS2, Cell growth-inhibiting gene 31 protein, G0/G1 switch regulatory protein 8) is encoded by the RGS2 (also known as G0S8, GIG31) gene (Gene ID: 5997) in human. RGS2 is shown to regulate G protein-coupled receptor signaling cascades. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. It also plays a role in the regulation of blood pressure in response to signaling via G protein-coupled receptors and GNAQ. RGS2 is reported to play a role in regulating the constriction and relaxation of vascular smooth muscle and also has a protective effect against myocardial hypertrophy and atrial arrhythmias. It inhibits beta-adrenergic receptor-induced cardiomyocyte hypertrophy. Overexpression of RGS2 reduces the activity of isoproterenol-induced ERK1/2 and prevents AKT activation. Four isoforms of RGS2 have been reported that are produced by alternative splicing. (Ref.: Nunn, C et al. (2010). Cell Signal 22(8); 1231-1239).
Specificity
Clone 9D9.1 specifically detects Regulator of G-protein signaling 2 (RGS2) in human and rat cells. It targets an epitope within 82 amino acids from the N-terminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 82 amino acids from the N-terminal region of human Regulator of G-protein signaling 2 (RGS2).ApplicationAnti-RGS2, clone 9D9.1, Cat. No. MABC1220, is a mosue monoclonal antibody that detects RGS2 in human and rat cells and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Western Blotting Analysis: 1 µg/mL from a representative lot detected RGS2 in 10 µg of HL-60 cell lysate.
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected RGS2 in human cerebral cortex, human pancreas, human lymphoma, and rat testis tissues.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in Raji cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected RGS2 in 10 µg of Raji cell lysate.
Target description
~25 kDa observed; 24.38 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 9D9.1, monoclonal species reactivity rat, human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_002914, UniProt accession no. P41220, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-RhoB Antibody, clone 7F7
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS1990 MABS1990-25UL General descriptionRho-related GTP-binding protein RhoB (UniProt: P62745; also known as Rho cDNA clone 6, h6) is encoded by the RHOB (also known as ARH6, ARHB) gene (Gene ID: 388) in human. RhoB is a member of the Ras super-family of small GTP-binding proteins, which is involved in hydrolysis of GTP and is active in GTP-bound form. RhoB is a short-lived Rho GTPase whose expression is inducible by a variety of stimuli including growth factors and stress stimuli. Its levels are up-regulated by DNA damaging agents, such as hydrogen peroxide or ionizing radiation. RhoB plays a negative role in tumorigenesis as its deletion is known to cause tumor formation. It is reported to mediate apoptosis in neoplastically transformed cells following DNA damage. It is not considered to be essential for development, but affects cell adhesion and growth factor signaling in transformed cells. RhoB displays 83% homology with RhoA. However, unlike RhoA, which is cytosolic and translocates to plasma membrane upon activation, RhoB localizes to endosomes/multivesicular bodies. RhoB participates in sorting and degradation of growth factors and cytokine receptors. RhoB has three nucleotide-binding regions (aa 12-19; 59-63; and 117-120). RhoB is shown to be critically required for the inflammatory response of endothelial cells to TNF alpha, possibly through MAP kinase activation downstream of the TNFR.
Specificity
Clone 7F7 detects RhoB in multiple species. It targets an epitope within 19 amino acids from the C-terminal half. This clone specifically detects RhoB, but not RhoA, Rac1, or cdc42.ImmunogenKLH-conjugated linear peptide corresponding to 19 amino acids from the C-terminal half of human RhoB.ApplicationAnti-RhoB, clone 7F7, Cat. No. MABS1990, is a mouse monoclonal antibody that detects Rho-related GTP-binding protein RhoB in human and has been tested for use in ELISA and Western Blotting.
Western Blotting Analysis: A 1:2,000 dilution from a representative lotdetected RhoB in 10 µg of MCF7 cell lysate.
Western Blotting Analysis: A representative lot detected RhoB in mouse and rabbit spleen, mouse kidney, recombinant RhoB, 293 cells expressing RhoB, CHO, H9C2, PK1P.185, COS, MDA MB-231, MCF7 and chicken fibroblasts (Courtesy of Lisa Laury-Kleintop, Ph.D., Lankenau Institute for Medical Research, Philadelphia PA, USA).
ELISA Analysis: A representative lot detected RhoB in Plate bound recombinant RhoB (Courtesy of Lisa Laury-Kleintop, Ph.D., Lankenau Institute for Medical Research, Philadelphia PA, USA).
Research Category
Signaling
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected RhoB in 10 µg of HEK293 cell lysate.
Target description
~20 kDa observed; 22.12 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 7F7, monoclonal species reactivity monkey, human, rabbit, porcine, mouse, hamster, chicken, rat packaging antibody small pack of 25 µL application(s) ELISA: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_004031.1, UniProt accession no. P62745, Gene Information human ... RHOB(388)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Ricin A Chain Antibody, clone RAC18
eCl@ss: 32160702
Кат. номер MABF2155-25UG MABF2155-100UG General descriptionRicin is a dimeric toxin derived from Ricinus communis (Caster bean). It is composed of a sugar-binding subunit (B chain) that attached to cell surface receptors and facilitate the entry of toxin into the target cell and a second subunit (A chain), whcih has glycosidase activity that inactivates ribosomes by depurinating a single adenosine residue from an exposed loop of the 28S ribosomal RNA. This leads to inhibition of protein synthesis in cells. The toxic effects of Ricin are attributed to the A chain. Clone RAC18 displays high avidity for intact ricin and inhibits its activity without affecting binding of ricin to cells. Immunization with RAC18 is shown to offer significant protection against ricin toxicity. (Ref.: Maddaloni, M., et al. (2004). J. Immunol. 172; 6221-6228).
Specificity
Clone RAC18 bind to Ricin A chainImmunogenPurified Ricin A chain.ApplicationAnti-Ricin A Chain, clone RAC18, Cat. No. MABF2155, is a mouse monoclonal antibody that detects Ricin A chain and has been tested for use in ELISA, Inhibition Assay, and Neutralizing.
Neutralizing Analysis: A representative lot neutralized the activity of Ricin A chain. (Maddaloni, M., et. al. (2004). J Immunol. 172(10):6221-8).
ELISA Analysis: A representative lot detected Ricin A chain in ELISA applications (Maddaloni, M., et. al. (2004). J Immunol. 172(10):6221-8; Simon, S., et. al. (2015). Toxins (Basel) 7(12):4967-86).
Inhibition Analysis: A representative lot inhibited the enzymatic activity of Ricin. (Maddaloni, M., et. al. (2004). J Immunol. 172(10):6221-8).
Research Category
Inflammation & Immunology
Quality
Evaluated by ELISA with Ricin A chain.
ELISA Analysis: Various dilutions of this antibody detected Ricin A chain in an indirect ELISA.
Target description
29.89 kDa calculated.
Physical form
Format: Purified
Protein G purified
Purified mouse monoclonal antibody IgG2a in PBS without preservatives.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone RAC18, monoclonal species reactivity Ricinus communis packaging antibody small pack of 25 µg application(s) ELISA: suitable","inhibition assay: suitable","neutralization: suitable isotype IgG2a UniProt accession no. Q0Q2G6, Узнать цену -
Anti-Ricin B Chain Antibody, clone RBC11
eCl@ss: 32160702
Кат. номер MABF2154-25UG MABF2154-100UG General descriptionRicin is a dimeric toxin derived from Ricinus communis (Caster bean). It is composed of a sugar-binding subunit (B chain) that attached to cell surface receptors and facilitate the entry of toxin into the target cell and a second subunit (A chain), which has glycosidase activity that inactivates ribosomes by depurinating a single adenosine residue from an exposed loop of the 28S ribosomal RNA. The toxic effects of Ricin are attributed to the A chain. Ricin B chain is shown to be a lectin that binds to galactosides found at the cell surface in a non-cooperative manner. It has two Ricin-B type lectin domains (aa 7-134 and 137-261). The mode of galactose binding is reported to be nearly identical at the two sites. Clone RBC11 is shown to block binding of Ricin to the cell. (Ref.: Maddaloni, M., et al. (2004). J. Immunol. 172; 6221-6228; Rutenber, E., et al. (1987). Nature. 326(6113):624-626).
Specificity
Clone RBC 11 binds to Ricin B chain.ImmunogenPurified Ricin B chain.ApplicationFlow Cytometry Analysis: A representative lot detected Ricin B chain in Flow Cytometry applications (Maddaloni, M., et. al. (2004). J Immunol. 172(10):6221-8).
ELISA Analysis: A representative lot detected Ricin B chain in ELISA applications (Maddaloni, M., et. al. (2004). J Immunol. 172(10):6221-8; Simon, S., et. al. (2015). Toxins (Basel) 7(12):4967-86).
Anti-Ricin B Chain, clone RBC11, Cat. No. MABF2154, is a mouse monoclonal antibody that detects Ricin B chain and has been tested for use in ELISA and Flow Cytometry.
Research Category
Inflammation & Immunology
Quality
Evaluated by ELISA with Ricin B chain.
ELISA Analysis: Various dilutions of this antibody detected Ricin B chain in an indirect ELISA.
Target description
28.90 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone RBC11, monoclonal species reactivity Ricinus communis packaging antibody small pack of 25 µg application(s) ELISA: suitable","flow cytometry: suitable isotype IgG2b UniProt accession no. D0VFC4,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Rictor antibody produced in rabbit
NACRES: NA.44
Кат. номер SAB4200141-25UL SAB4200141-200UL General descriptionm-TOR is a conserved kinase that primarily regulates cell growth. Rictor is a rapamycin-insensitive companion of m-TOR and regulates the phosphorylation of Akt/PKB. Rictor also phosphorylates PKCα and actin cytoskeleton .
Rictor (rapamycin-insensitive companion of mTOR) is a subunit of the mammalian target of rapamycin complex 2 (mTORC2). The mTORC2 complex contains mTOR, mLST8, mSIN1, deptor, protor-1 and rictor. mTOR substrate that regulates cell size.
Specificity
Anti-Rictor antibody is specific for human, mouse and rat rictor. In immunoblotting, detection of the rictor band (approx. 190 kDa) is specifically inhibited by the immunizing peptide.ImmunogenThe corresponding sequence is identical in mouse and rat rictor.ApplicationAnti-Rictor antibody is suitable for use in immunohistochemistry (5-10 μg/mL using heat-retrieved formalin-fixed, paraffin-embedded rat testis sections and biotin/ExtrAvidin Peroxidase staining system). The product may also be used for immunoprecipitation (5-10 μg using lysates of human HeLa cells), and immunoblot (1-2 μg/mL is using whole extracts of mouse C2C12 cells).
Biochem/physiol Actions
Rictor (rapamycin-insensitive companion of mTOR) regulates cell survival and cytoskeletal organization through the regulation of Akt/ protein kinase B (PKB) and protein kinase C alpha (PKCα).
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt ~190 kDa species reactivity mouse, rat, human packaging antibody small pack of 25 µL concentration ~1-2 µg/mL application(s) immunohistochemistry: 5-10 µg/mL using a working concentration of 5-10 ug/mL is recommended using heat-retrieved formalin-fixed, paraffin-embedded rat testis sections and biotin / ExtrAvidin Peroxidase staining system.","immunoprecipitation (IP): 5-10 µg using a working amount of 5-10 µg is recommended using lysates of human HeLa cells.","western blot: 1-2 µg/mL using a working concentration of 1-2 µg/mL is recommended using whole extracts of mouse C2C12 cells. conjugate unconjugated UniProt accession no. Q6R327, shipped in dry ice storage temp. 20°C Gene Information human ... RICTOR(253260)
mouse ... rictor(78757)
rat ... rictor(310131)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-RINF (CXXC5)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE570 ABE570-25UG General descriptionCXXC-type zinc finger protein 5 (UniProt: Q7LFL8; also known as CF5, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, Retinoid-inducible nuclear factor, RINF) is encoded by the CXXCS (also known as HSPC195, TCCCIA00297) gene (Gene ID: 51523) in human. In human cells, two isoforms of RINF have been reported that are produced by alternative splicing. The isoform two lacks the first 95 amino acids. RINF serves as a transcription factor that binds to the oxygen responsive element of COX4I2 and represses its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen). Its nuclear localization sequence is localized in amino acids 257-262. It is shown to co-localize with DVL1 in large bodies localized outside the nuclear membrane. RINF is shown to be important in normal myelopoiesis. RINF acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. It is also shown to be essential for DNA damage-induced ATM phosphorylation, p53 activation, and cell cycle arrest. RINF silencing is reported to increase sensitivity of K562 cells to daunorubicin- and lenalidomide. (Ref.: Aston A et al. (2013). Oncotarget. 4(9); 1438-1448).
Specificity
This rabbit polyclonal antibody detects CXXC-type zinc finger protein 5 (RINF) in human cells. It targets an epitope within 17 amino acids from the N-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 17 amino acids from the N-terminal half of human CXXC-type zinc finger protein 5. Immunogen is conserved between two isoforms.ApplicationAnti-RINF (CXXC5) Antibody, Cat. No. ABE570, is a highly specific rabbit polyclonal antibody that targets RINF (CXXC5) and has been tested in Western Blotting.
Quality
Evaluated by Western Blotting in MCF-7 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected RINF (CXXC5) in 10 µg of MCF-7 cell lysate.
Target description
~35 kDa observed; 32.98 kDa calculated. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) rat (based on 100% sequence homology), mouse (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable NCBI accession no. NP_057547.5, UniProt accession no. Q7LFL8, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Ring Finger Protein 213 (RNF213)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABC1391 ABC1391-25UG General descriptionE3 ubiquitin-protein ligase RNF213 (UniProt: Q63HN8; also known as ALK lymphoma oligomerization partner on chromosome 17, Mysterin, RING finger protein 213, RING-type E3 ubiquitin transferase RNF21) is encoded by the RNF213 (also known as ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR) gene (Gene ID: 57674) in human. RNF213 is a widely expressed, homooligomeric, cytoplasmic protein that has E3 ubiquitin-protein ligase and AAA+ ATPase activity. It contains a zinc-finger domain (aa 3997-4036) that is required for its ubiquitin-protein ligase activity. RNF213 is shown to be involved in angiogenesis and in non-canonical Wnt signaling pathway in vascular development. Four isoforms of RNF213 have been described that are produced by alternative splicing. RNF213 ligase activity is negatively regulated by PTP1B in HER2+ breast cancer cells and RNF213 knockdown is shown to reverse the effects of PTP1B deficiency on alpha-keto-dependent dehydrogenases, non-mitochondrial oxygen consumption, and hypoxia-induced death of HER2+ BC cells. RNF213 activity is down-regulated by let-7c miRNA, which binds to the 3-UTR transcript of RNF213. Microbial infection leading to induction of pro-inflammatory cytokines are shown to up-regulate its activity. Defects in RNF213 gene are known to cause Moyamoya disease 2, a progressive cerebral angiopathy characterized by bilateral intracranial carotid artery stenosis and telangiectatic vessels in the region of the basal ganglia, which can lead to transient ischemia and/or rupture of the collateral vessel. (Ref.: Banh, RS et al (2016). Nat. Cell Biol. 18(7); 803-813).
Specificity
This rabbit polyclonal antibody detects human and mouse Ring Finger Protein 213.Immunogen11 GST-tagged recombinant fragments from human Ring Finger Protein 213.ApplicationAnti-Ring Finger Protein 213 (RNF213), Cat. No. ABC1391, is a rabbit polyclonal antibody that detects E3 ubiquitin-protein ligase RNF213 and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Immunoprecipitation Analysis: A representative lot detected Ring Finger Protein 213 (RNF213) in BT474, MDA-MB-361, and HCC1954 cells (Banh, R.S., et. al. (2016). Nat Cell Biol. 18(7):803-13).
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected Ring Finger Protein 213 (RNF213) in HUVEC transfected with siRNA213 (Courtesy of Dr Akio Koizumi at Kyoto University).
Immunocytochemistry Analysis: A representative lot detected Ring Finger Protein 213 (RNF213) in HeLa cells treated with RNF213 siRNA (Hitomi, T., et. al. (2013). Biochem Biophys Res Commun. 438(1):13-9).
Western Blotting Analysis: A representative lot detected Ring Finger Protein 213 (RNF213) in Western Blotting applications (Hitomi, T., et. al. (2013). Biochem Biophys Res Commun. 438(1):13-9; Banh, R.S., et. al. (2016). Nat Cell Biol. 18(7):803-13; Kobayashi, H., et. al. (2015). J Am Heart Assoc. 4(7)).
Quality
Evaluated by Western Blotting in HEK293T cells transfected with 3XFlag RNF213 wild-type.
Western Blotting Analysis: 1 µg/mL of this antibody detected Ring Finger Protein 213 (RNF213) in HEK293T cells transfected with 3XFlag RNF213 wild-type.
Target description
~596 kDa observed; 591.41 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_001243000, UniProt accession no. Q63HN8, shipped in ambient Gene Information human ... RNF213(57674)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-RIP140 Antibody, clone 6D7
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS1917 MABS1917-25UG General descriptionNuclear receptor-interacting protein 1 (UniProt: P48552; also known as Nuclear factor RIP140, Receptor-interacting protein 140) is encoded by the NRIP1 gene (Gene ID: 8204) in human. RIP140 is a nuclear protein that is localized to discrete foci and redistributes to larger nuclear domains upon binding to ligand-bound NR3C1. It is expressed in liver in a circadian manner. RIP140 contains 9 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs, which have different affinities for nuclear receptors. The C-terminal LTKTNPILYYMLQK motif is required for ligand-dependent interaction with retinoic acid (RA) receptor-alpha (RARA) and retinoid X receptor beta (RXRB) homodimers and heterodimers, for the corepressor activity, and for the formation of an HDAC3 complex with RARA/RXRB. It also contains at least four autonomous repression domains (RD1-4). RD1 functions via a histone deacetylase (HDAC)-independent mechanism, whereas RD2, RD3 and RD4 can function by HDAC-dependent or independent mechanisms, depending on cell type. RIP140 Acetylation regulates its nuclear translocation and co-repressive activity of RIP140 is regulated by its acetylation, which is shown to abolish its interaction with C-terminal-binding protein 1 (CTBP1). Several glucocorticoid responses are shown to be deregulated by RIP140 possibly via an interaction between the glucocorticoid receptor (GR), which prevents binding of true co-activator with GR. (Ref.: Subramaniam N, et al. (1999). J. Biol. Chem. 274(25):18121-7).
Specificity
Clone 6D7 detects Nuclear receptor-interacting protein 1 (RIP140) in human, mouse, and rat cells. It targets an epitope with in 178 amino acids from the N-terminal half.ImmunogenGST-tagged recombinant fragment corresponding to 178 amino acids from the N-terminal half of human Nuclear receptor-interacting protein 1 (RIP140).ApplicationWestern Blotting Analysis: A representative lot detected RIP140 in Western Blotting applications (Kiskinis, E., et. al. (2007). EMBO J. 26(23):4831-40; Hallberg, M., et. al. (2008). Mol Cell Biol. 28(22):6785-95).
Chromatin Immunoprecipitation Analysis: A representative lot detected RIP140 in Chromatin Immunoprecitpiation applications (Hallberg, M., et. al. (2008). Mol Cell Biol. 28(22):6785-95).
Anti-RIP140, clone 6D7, Cat. No. MABS1917, is a mouse monocloanl antibody that detects RIP140 and has been tested for use in Chromatin Immunoprecipitation (ChIP) and Western Blotting.
Research Category
Signaling
Quality
Evaluated by Western Blotting in MCF7 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected RIP140 in 10 µg of MCF7 cell lysate.
Target description
~160 kDa observed; 126.94 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 6D7, monoclonal species reactivity mouse, rat, human packaging antibody small pack of 25 µg application(s) ChIP: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_003480.2, UniProt accession no. P48552, shipped in ambient Gene Information human ... NRIP1(8204)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-RKIP Antibody, clone 4A11
eCl@ss: 32160702
Кат. номер MABC1137-100UG MABC1137-25UG General descriptionPhosphatidylethanolamine-binding protein 1 (UniProt: P30086; also known as PEBP-1, HCNPpp, Neuropolypeptide h3, Prostatic-binding protein, Raf kinase inhibitor protein, RKIP) is encoded by the PEBP1 (also known as PBP, PEBP) gene (Gene ID: 5037) in human. RKIP is as member of the phosphatidylethanolamine-binding-protein (PEBP) family that antagonizes multiple cell-survival pathways, such as the Ras-Raf-1, MEK/ERK, NF- B, and G-protein-coupled receptor Kinase 2 and thereby modulates cell growth, apoptosis, motility, invasion and metastasis. Over-expression of RKIP is shown to inhibit c-Src auto-phosphorylation and activation and IL-6-, JAK1 and 2-, and Raf-mediated STAT3 phosphorylation and activation. RKIP overexpression is shown to sensitize tumor cells to chemotherapeutic drug-induced apoptosis. Hence, it is considered as a suppressor of metastasis and a prognostic marker in several cancers. Clone 4A11 exhibits specific staining in formalin-fixed NIH3T3 cells transfected with GFP-PEBP1 and in some pancreatic cancer cells. (Ref.: Odabaei, G., et al. (2004). Adv. Cancer Res. 91; 169-200; Yousuf, S., et al. (2014). PLoS One 9(3); e92478).
Specificity
Clone 4A11 specifically detects human Raf kinase inhibitor protein, (RKIP).ImmunogenPurified native and denatured Raf kinase inhibitor protein (RKIP).ApplicationDetects Raf kinase inhibitor protein (Phosphatidylethanolamine-binding protein 1) using this mouse monoclonal Anti-RKIP, clone 4A11, Cat. No. MABC1137, tested for use in Western Blotting, Immunocytochemistry, and Immunohistochemistry (Paraffin).
Research Category
Apoptosis & Cancer
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected RKIP in human pancreas and human thyroid tissue sections.
Immunohistochemistry Analysis: A representative lot of this antibody detected RKIP in Immunohistochemistry applications (Wang, X., et. al. (2010). J Immunol Methods. 362(1-2):151-60).
Immunocytochemistry Analysis: A representative lot of this antibody detected RKIP in Immunocytochemistry applications (Wang, X., et. al. (2010). J Immunol Methods. 362(1-2):151-60).
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected RKIP in HEK293 cell lysate.
Target description
~23 kDa; 21.06 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibodyIgG1κ in buffer containing PBS without azide
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 4A11, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_002558.1, UniProt accession no. P30086, Gene Information human ... PEBP1(5037) Узнать цену -
Anti-RKIP Antibody, clone 7F12
eCl@ss: 32160702
Кат. номер MABC1136-25UG MABC1136-100UG General descriptionPhosphatidylethanolamine-binding protein 1 (UniProt: P30086; also known as PEBP-1, HCNPpp, Neuropolypeptide h3, Prostatic-binding protein, Raf kinase inhibitor protein, RKIP) is encoded by the PEBP1 (also known as PBP, PEBP) gene (Gene ID: 5037) in human. RKIP is as member of the phosphatidylethanolamine-binding-protein (PEBP) family that antagonizes multiple cell-survival pathways, such as the Ras-Raf-1, MEK/ERK, NF- B, and G-protein-coupled receptor Kinase 2 and thereby modulates cell growth, apoptosis, motility, invasion and metastasis. Over-expression of RKIP is shown to inhibit c-Src auto-phosphorylation and activation and IL-6-, JAK1 and 2-, and Raf-mediated STAT3 phosphorylation and activation. RKIP overexpression is shown to sensitize tumor cells to chemotherapeutic drug-induced apoptosis. Hence, it is considered as a suppressor of metastasis and a prognostic marker in several cancers. Clone 7F12 specifically detects denatured RKIP endogenously expressed in 293 cells and several pancreatic cell lines. (Ref.: Odabaei, G., et al. (2004). Adv. Cancer Res. 91; 169-200; Yousuf, S., et al. (2014). PLoS One 9(3); e92478).
Specificity
Clone 7F12 specifically detects human Raf kinase inhibitor protein, (RKIP).ApplicationDetects Raf kinase inhibitor protein using this mouse monoclonal Anti-RKIP, clone 7F12, Cat. No. MABC1136, tested for use in Western Blotting.
Western Blotting Analysis: A representative lot detected RKIP in Western Blotting applications (Wang, X., et. al. (2010). J Immunol Methods. 362(1-2):151-60).
Quality
Evaluated by Western Blotting in HEK293 cell lysates.
Western Blotting Analysis: 1 µg/mL of this antibody detected RKIP in HEK293 cell lysates.
Target description
~23 kDa; 21.06 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 7F12, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_002558.1, UniProt accession no. P30086, Gene Information human ... PEBP1(5037) Узнать цену -
Anti-RNA polymerase II Antibody, clone CTD4H8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-623 5-623-25UG 5-623-100UG General descriptionRNA polymerase II (Pol II) is a multi-subunit enzyme responsible for the transcription of protein-coding genes. Transcription initiation requires recruitment of the complete transcription machinery to a promoter via solicitation by activators and chromatin remodeling factors. Pol II can coordinate 10 to 14 subunits. This complex interacts with the promoter regions of genes and a variety of elements and transcription factors. The DNA binding domain of the polymerase is a groove where TFIIB orients the DNA for unwinding and transcription.
Specificity
This antibody recognizes Phospho- and non-phospho-RNA polymerase II.ImmunogenPeptide containing 10 repeats of YSPT[pS]PS corresponding to the carboxyl-terminal domain of RNA polymerase II.ApplicationResearch Sub Category
Transcription Factors
Anti-RNA polymerase II Antibody, clone CTD4H8 is a high quality Mouse Monoclonal Antibody for the detection of RNA polymerase II and has been published in more than 40 citations and validated for use in ChIP & WB.
Research Category
Epigenetics & Nuclear Function
Quality
Routinely evaluated by western blot on HeLa nuclear extracts.
Western Blot Analysis:
0.05-1 µg/mL of this lot detected RNA polymerase II in HeLa nuclear extracts. 0.1-2 µg/mL of a previous lot detected RNA polymerase II in 3T3 nuclear extracts
Target description
210-220 kDa
Physical form
Format: Purified
Protein G Chromatography
Purified mouse IgG1 in buffer containing 0.1M Tris-glycine, pH 7.4, 0.15M NaCl, 0.05% sodium azide before the addition of glycerol to 30%.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations:
Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.
Analysis Note
Control
A431 nuclear extract.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CTD4H8, monoclonal species reactivity mouse, Saccharomyces cerevisiae, rat, human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) ChIP: suitable (ChIP-seq)","western blot: suitable isotype IgG1 NCBI accession no. NP_000928, UniProt accession no. P24928, shipped in dry ice Узнать цену -
Anti-RNA Polymerase II Antibody, CTD Antibody, clone 8WG16
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-952-I-25UG 5-952-I-100UG General descriptionDNA-directed RNA polymerase II subunit RPB1 (UniProt: P24928; also known as EC: 2.7.7.6, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, is encoded by the POLR2A (also known as POLR2) gene (Gene ID: 5430) in human. DNA-dependent RNA polymerase II catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. RPB1 subunit is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that suggested to grab the incoming DNA template. It has multiple zinc and magnesium ion binding sites and contains a repetitive C-terminal domain (CTD; aa 1593-1960) that consists of tandem repeats of the consensus sequence YSPTSPS and serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing. It can exist in both hypophosphorylated form, which is mainly cytosolic, and in hyperphosphorylated form. The phosphorylation of Serine 2 and 5 in the hepatapeptide repeat is achieved by Cdk7 and Cdk9. Cdk7 phosphorylation promotes transcription initiation by triggering promoter release and elongation.
Specificity
almost all eukaryotic species, which has a concensus hepatapeptide repeat
Clone 8WG16 specifically detects DNA-directed RNA polymerase II subunit RPB1.ImmunogenRNA Polymerase II from wheat germ extractApplicationWestern Blotting Analysis: A representative lot detected RNA Polymerase II, CTD in Western Blotting applications (Patturajan, M., et. al. (1998). J Biol Chem. 273(8):4689-94; Zhang, J., et. al. (1991). J Biol Chem. 266(4):2290-6).
Dot Blot Analysis: A representative lot detected RNA Polymerase II, CTD in Dot Blot applications (Thompson, N.E., et. al. (1989). J Biol Chem. 264(19):11511-20).
Immunoprecipitation Analysis: A representative immunoprecipitated RNA Polymerase II, CTD in Immunoprecipitation applications (Bhaumik, S.R., et. al. (2001). Genes Dev. 15(15):1935-45).
Inhibition Analysis: A representative lot inhibited the interaction of RNA Polymerase II, CTD with the transcription complex. (Thompson, N.E., et. al. (1989). J Biol Chem. 264(19):11511-20).
Anti-RNA Polymerase II, CTD, clone 8WG16, Cat. No. 05-952-I, is a mouse monoclonal antibody that detects DNA-directed RNA polymerase II subunit RPB1 and has been tested for use in Dot Blot, Chromatin Immunoprecipitation, Immunoprecipitation, Inhibition assay, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HeLa nuclear extract cell lysates.
Western Blotting Analysis: 1 µg/mL of this antibody detected RNA Polymerase II, CTD in HeLa cell nuclear extract.
Target description
~220 kDa observed; 217.18 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2a in PBS without preservatives.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 8WG16, monoclonal species reactivity yeast, human packaging antibody small pack of 25 µg application(s) dot blot: suitable","immunoprecipitation (IP): suitable","inhibition assay: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_000928, UniProt accession no. P24928, Узнать цену -
Anti-RNA polymerase II subunit B1 Antibody, clone 4F8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE30-25UG ABE30 General descriptionRNA polymerase II subunit B1 (RPB1) is the largest subunit of the RNA polymerase II complex. As a holoenzyme RNA polymerase II catalyzes transcription of eukaryotic DNA into RNA using the four ribonucleoside triphosphates as substrates. The RPB1 subunit, in combination with other polymerase subunits, forms a large central cleft that maintains contact between the active site of the enzyme, the DNA template, and the nascent RNA transcript. This subunit also contains a carboxy terminal domain (CTD) consisting of tandem heptapeptide repeats. In actively transcribing RNA polymerase ‘Ser-2’ and ‘Ser-5’ of the heptapeptide repeat are phosphorylated. Phosphorylation activates the RNA polymerase II beta subunit, allowing it to serve as an assembly platform for additional subunits that modulate initiation, elongation, termination and mRNA processing.ImmunogenKLH-conjugated linear peptide corresponding to human RNA polymerase II subunit B1.ApplicationUse Anti-RNA polymerase II subunit B1 Antibody, clone 4F8 (rabbit polyclonal antibody) validated in WB, ICC to detect RNA polymerase II subunit B1 also known as DNA-directed RNA polymerase II subunit RPB1.
Research Category
Epigenetics & Nuclear Function
Research Sub Category
RNA Metabolism & Binding Proteins
Immunocytochemistry Analysis: 1:500 dilution from a representative lot detected RNA polymerase II subunit B1 in HeLa cells.
Quality
Evaluated by Western Blot in HeLa nuclear extract.
Western Blot Analysis: 1 µg/mL of this antibody detected RNA polymerase II subunit B1 on 10 µg of HeLa nuclear extract.
Target description
~217 kDa observed
Physical form
Purified rabbit polyclonal in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Affinity purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
HeLa nuclear extractOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), horse (based on 100% sequence homology), bovine (based on 100% sequence homology), canine (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable NCBI accession no. NP_000928, UniProt accession no. P24928, shipped in wet ice
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-RNF123 Antibody, clone 2C10.1
eCl@ss: 32160702
Кат. номер MABS1896-100UL MABS1896-25UL General descriptionE3 ubiquitin-protein ligase RNF123 (UniProt: Q5XPI4; also known as EC 2.3.2.27, Kip1 ubiquitination-promoting complex protein 1, RING finger protein 123, RING-type E3 ubiquitin transferase RNF123) is encoded by the RNF123 (also known as KPC1, PF1477) gene (Gene ID: 63891) in human.RNF123 serves as a catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. It is required for poly-ubiquitination and proteasome-mediated degradation of CDKN1B/p27 during the cell cycle G1 phase of the cell cycle. It contains a ring-type zinc finger domain (aa 1254-1292). Two isoforms of RNF123 have been reported that are produced by alternative splicing. RNF123 is also reported to serve as a negative regulator of RIG-I and MDA5. Overexpression of RNF123 is shown to inhibit IFN-beta production triggered by Sendai virus (SeV) and encephalomyocarditis picornavirus (EMCV) and knockdown of endogenous RNF123 can potentiate IFN-beta production triggered by SeV and EMCV. RNF123 is shown to interact with the N-terminal CARD domains of RIG-I/MDA5 and compete with the downstream adaptor VISA/MAVS/IPS-1/Cardif for RIG-I/MDA5 CARD binding. (Ref.: Wang, S., et al. (2016). EMBO Rep. 17(8):1155-68).
Specificity
Clone 2C10.1 specifically detects RING-type E3 ubiquitin transferase RNF123 in human cells. It targets an epitope within 92 amino acids from the N-terminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 92 amino acids from the N-terminal region of human RING-type E3 ubiquitin transferase RNF123.ApplicationAnti-RNF123, clone 2C10.1, Cat. No. MABS1896, is a mouse monoclonal antibody that detects RING-type E3 ubiquitin transferase RNF123 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected RING-type E3 ubiquitin transferase RNF123 in HeLa cell lysate.
Target description
~150 kDa observed; 148.52 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 2C10.1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_071347, UniProt accession no. Q5XPI4,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-RNF213
eCl@ss: 32160702
Кат. номер ABN1474-25UG ABN1474-100UG General descriptionE3 ubiquitin-protein ligase RNF213 (UniProt: Q63HN8; also known as EC:2.3.2.27, ALK lymphoma oligomerization partner on chromosome 17, Mysterin, RING finger protein 213, RING-type E3 ubiquitin transferase RNF213) is encoded by the RNF213 (also known as ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR) gene (Gene ID: 57674) in human. RNF213 is a widely expressed, homooligomeric cytosolic protein that is involved in the non-canonical Wnt signaling pathway in vascular development. It acts by mediating ubiquitination and degradation of FLNA and NFATC2 downstream of RSPO3, which leads to the inhibition of the non-canonical Wnt signaling pathway and promotes vessel regression. Its activity is induced by pro-inflammatory cytokines. RNF213 contains a Zinc finger domain (aa 3997-4036), which is required for its ubiquitin-protein ligase activity. It also contains an AAA domain, which is associated with ATPase activity. Four isoforms of RNF213 have been described that are produced by alternative splicing. Mutations in RNF213 gene have been linked to Moyamoya disease 2 (MYMY2) disease, a progressive cerebral angiopathy that can lead to transient ischemic attacks and/or cerebral infarction, and rupture of the collateral vessels can cause intracranial hemorrhage.
Specificity
This rabbit polyclonal antibody detects E3 ubiquitin-protein ligase RNF213 in human cells. It targets an epitope within 15 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal half of human E3 ubiquitin-protein ligase RNF213. Immunogen sequence is conserved in isoforms 1, 2, and 4.
Epitope: unknownApplicationAnti-RNF213, Cat. No. ABN1474, is a highly specific rabbit polyclonal antibody that targets E3 ubiquitin-protein ligase RNF213 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected RNF213 in human cerebral cortex and human kidney tissue sections.
Western Blotting Analysis: 2 µg/mL from a representative lot detected RNF213 in 10 µg of HEK293 cells transfected with 3XFLAG RNF213 WT.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in HUVEC lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected RNF213 in 10 µg of HUVEC lysate.
Target description
~590 kDa observed; 591.41 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_001243000, UniProt accession no. Q63HN8, Gene Information human ... RNF213(57674) Узнать цену -
Anti-RPA2 p34 Antibody, clone RPA20 1-46
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 4-1481-25UG 4-1481 4-1481-100UG General descriptionRPA is a heterotrimeric protein complex that binds specifically to single-stranded DNA (ssDNA). It is composed of three subunits, RPA1 (70 kDa), RPA2 (32 kDa), and RPA3 (14 kDa), and plays multiple roles in DNA metabolism. RPA is required for DNA replication initiation, as well as replication elongation. At the onset of DNA replication, RPA is loaded onto chromatin after the binding of Cdc45 to origins. RPA is needed for subsequent loading of DNA polymerase and other replication proteins to initiate DNA replication. After DNA replication begins, RPA moves with replication forks, stabilizing ssDNA and assisting in DNA synthesis. In addition to its replication function, RPA is also known to play essential roles in damage repair and recombination.The 32 kDa subunit, is phosphorylated by the cdc2 family of kinases when cells enter S-phase and in response to DNA damage by ATM, ATR, and DNA-PK. Alternate names for RPA32 include replication protein A 32 kDa subunit, RP-A, RF-A, replication factor-A protein 2, p32, p34, RPA2, REPA2, and RPA32.
Specificity
This antibody recognizes RPA2.ImmunogenHis-tagged recombinant protein corresponding to human RPA2.
Epitope: UnknownApplicationResearch Sub Category
Cell Cycle, DNA Replication & Repair
Chromatin Biology
Anti-RPA2 p34 Antibody, clone RPA20 1-46 is a Mouse Monoclonal Antibody for detection of RPA2 p34 also known as Replication factor A protein 2 & has been validated in WB.
Western Blot (SNAP ID) Analysis: 0.5 µg/mL from a previous lot detected RPA2 on 10 µg of NIH/3T3 cell lysate.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blot in HeLa cell lysate.
Western Blot Analysis: 0.5 µg/mL of this antibody detected RPA2 on 10 µg of HeLa cell lysate.
Target description
~32 kDa
Physical form
Protein G Purified
Purified mouse monoclonal IgG1κ in buffer containing 0.1 M Tris-Glycine (pH 7.4, 150 mM NaCl) with 0.05% sodium azide.
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
HeLa cell lysateOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form affinity isolated antibody antibody product type primary antibodies clone 1-46, monoclonal","RPA20, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG1 NCBI accession no. NM_002946, UniProt accession no. P15927, shipped in ambient 108,00 € / 10 243 ₽Получить предложение -
Anti-RPL23 antibody produced in rabbit
Human Protein Atlas Number: HPA003373 Human Protein Atlas characterization data
Кат. номер HPA003373-100UL HPA003373-25UL Immunogen60S ribosomal protein L23 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
RPL23 (ribosomal protein L23) gene encodes a component of the ribosomal 60s subunit and is a member of the L14P family of ribosomal proteins. It is localized to the cytoplasm. Its amino acid sequence is homologous to the yeast large subunit ribosomal protein L17 and is also called rpL17. It contains 140 residues and has a molar mass of 15kDa. It inhibits vascular smooth muscle growth and serves as a potential therapeutic target to limit carotid intima-media thickening.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86613,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV conjugate unconjugated UniProt accession no. P62829, shipped in wet ice storage temp. 20°C Gene Information human ... RPL23(9349)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-RRP8 Antibody, clone 5C7.1
eCl@ss: 32160702
Кат. номер MABE1013-100UG MABE1013-25UG General descriptionRibosomal RNA-processing protein 8 (UniProt: O43159; also known as Cerebral protein 1, Nucleomethylin) is encoded by the RRP8 (also known as KIAA0409, NML, hucep-1) gene (Gene ID: 23378) in human. Ribosome biosynthesis is one of the most energy-consuming cellular process, which adapts to changes in intracellular energy status. Ribosomal RNA-processing protein 8 is a novel nuclear protein that serves as an essential component of the energy-dependent nucleolar silencing) complex (eNoSC) that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation or upon elevation of NAD+/NADP+ ratio and activates SIRT1 that leads to deacetylation of histone H3 followed by dimethylation of H3 at Lysine 9 (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase.
Specificity
Clone 5C7.1 specifically detects Ribosomal RNA-processing protein 8. It targets an epitope with in the C-terminal half.ImmunogenGST-tagged recombinant fragment corresponding to 98 amino acids from the C-terminal half of human Ribosomal RNA-processing protein 8.ApplicationAnti-RRP8, clone 5C7.1, Cat. No. MABE1013, is a highly specific mouse monoclonal antibody, that targets Ribosomal RNA-processing protein 8 and has been tested for use in Immunocytochemistry and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected RRP8 in HeLa, A431, HUVEC, and NIH/3T3 cells.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected RRP8 in HeLa cell lysate.
Target description
~53 kDa observed; 50.72 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5C7.1, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_056139, UniProt accession no. O43159, Узнать цену -
Anti-RTN4IP1 Antibody, clone NIMPR14 MABC961-25UL
eCl@ss: 32160702 General descriptionReticulon-4-interacting protein 1, mitochondrial (UniProt: Q924D0; also known as NOGO-interacting mitochondrial protein, RTN4IP1) is encoded by the Rtn4ip1 (also known as Nimp) gene in murine species. RTN4IP1 is an outer mitochondrial membrane protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. This interaction may be important for reticulon-induced inhibition of neurite growth. RNT4IP1 plays a role in the regulation of retinal ganglion cell (RGC) neurite outgrowth, and hence in the development of the inner retina and optic nerve. It is widely expressed in mitochondria-enriched tissues and co-localizes with the endoplasmic reticulum HSPA5 at spots corresponding to contacts with mitochondria. Mutations in Rtn4ip1 gene can cause optic atrophy 10 that leads to vision loss sometime in early childhood.
Specificity
Clone NIMPR14 is a rat monoclonal antibody that detects Reticulon-4-interacting protein 1 in murine species.ImmunogenPurified BALB/c mouse neutrophils.ApplicationFlow Cytometry Analysis: A representative lot detected RTN4IP1 in Flow Cytometry applications (Lopez, A.F., et. al. (1984). Br J Haematol. 57(3):489-94; Taylor, P.R., et. al. (2014). Nat Immunol. 15(2):143-51).
Inhibition Analysis: A representative lot detected RTN4IP1 in Inhibition applications (Tacchini-Cottier, F., et. al. (2000). J Immunol. 165(5):2628-36; de Vries, B., et. al. (2003). J Immunol. 170(7):3883-9; Chang, H.R., et. al. (1993). J Leukoc Biol. 53(6):636-9; Mentzel, S., et. al. (1999). Kidney Int. 55(4):1335-47).
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected RTN4IP1 in mouse lung tissue.
Immunohistochemistry Analysis: A representative lot detected RTN4IP1 in Immunohistochemistry applications (Lopez, A.F., et. al. (1984). Br J Haematol. 57(3):489-94).
Immunohistochemistry Analysis: A representative lot detected RTN4IP1 in Immunohistochemistry applications (Lopez, A.F., et. al. (1984). Br J Haematol. 57(3):489-94.; de Vries, B., et. al. (2003). J Immunol. 170(7):3883-9; Chang, H.R., et. al. (1993). J Leukoc Biol. 53(6):636-9).
Immunocytochemistry Analysis: A representative lot detected RTN4IP1 in Immunocytochemistry applications (Lopez, A.F., et. al. (1984). Br J Haematol. 57(3):489-94.; Taylor, P.R., et. al. (2014). Nat Immunol. 15(2):143-51).
Detect Reticulon-4-interacting protein 1, mitochondrial using this rat monoclonal Anti-RTN4IP1, clone NIMP‐R14 , Cat. No. MABC961-25UL, validated for use in Immunohistochemistry, Inhibition and Immunohistochemistry (Paraffin).
Research Category
Apoptosis & Cancer
Quality
Evaluated by Immunohistochemistry in mouse spleen tissue.
Immunohistochemistry Analysis: A 1:1,000 dilution of this antibody detected RTN4IP1 in mouse spleen tissue.
Physical form
Format: Purified
Purified rat monoclonal antibody IgG2b in PBS without preservatives.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone monoclonal species reactivity mouse packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","inhibition assay: suitable isotype IgG2b UniProt accession no. Q924D0,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Rubicon antibody, Mouse monoclonal
Кат. номер SAB4200838-25UL SAB4200838-100UL General descriptionRun domain Beclin-1-interacting and cysteine-rich domain-containing protein (Rubicon) also known as Beclin-1 associated RUN domain containing protein (Baron) or KIAA0226, is a negative regulator of endosomes maturation and endocytic trafficking.1-2 Rubicon knockdown studies showed enhanced autophagosome maturation and endocytosis.1 It also have a critical role in the LC3-associated phagocytosis (LAP) a noncanonical autophagy process which can be induced through the activation of extracellular receptor by different stimulators including pathogens, immune complexes and dying cells.4-5
Specificity
Monoclonal Anti-Rubicon antibody specifically recognizes Rubicon from human origin.Immunogensynthetic peptide corresponding to the N-terminal region of human Rubicon, conjugated to KLHApplicationThe antibody may be used in various immunochemical techniques including Immunoblotting and Immunofluorescence. Detection of the Rubicon band by Immunoblotting is specifically inhibited by the immunogen.
Biochem/physiol Actions
The mammalian class III phosphatidylinositol 3-kinase (PtdIns3K) complex consists of three core proteins, catalytic VPS34, the adaptor VPS15 (p150) and the recruiter Beclin-1 (ATG6); these endocytosis regulators were reported to stably bind Beclin-1 ATG14, UVRAG and Rubicon.1-3 The complex Rubicon-UVRAG–Beclin-1/PtdIns3K can be found both in early and in late endosomes or lysosomes. Rubicon was described as the mediator for the recruitment of the UVRAG-Beclin-1-VPS34 complex and of ATG7 and LC3-II LAPosome.4-5 Furthermore, Rubicon has been identified as a key modulator of the inflammatory response and viral replication, during several viral infections such as hepatitis B virus (HBV). Rubicon expression is induced in negative regulation of the innate immune response resulting in enhances viral replication and possibly supporting viral immune evasion mechanism.4
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone RB-145, monoclonal form liquid species reactivity human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 2-4 µg/mL using human A431 whole cell extract.","immunofluorescence: 2-4 µg/mL using human HeLa cells. isotype IgG1 UniProt accession no. Q92622, shipped in dry ice storage temp. 20°C Gene Information human ... RUBCN(9711)
Safety InformationFlash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-sACDY10 Antibody, clone R21
Кат. номер MABS2257-25UG MABS2257-100UG General descriptionAdenylate cyclase type 10 (UniProt: Q96PN6; also known as EC:4.6.1.1, AH-related protein, Adenylate cyclase homolog, Germ cell soluble adenylyl cyclase, hsAC, sAC, Testicular soluble adenylyl cyclase) is encoded by the ADCY10 (also known as SAC) gene (Gene ID: 55811) in human. sAC catalyzes the formation of the signaling molecule cAMP. It is present in cytoplasm, nucleus, and mitochondria and is mainly detected in airway epithelial cells and testis. It is also expressed in several other tissues, but at much lower levels. It serves as a sensor to mediate responses to changes in cellular pH and bicarbonate levels and regulates pH-dependent V-ATPase recycling. sAC is shown to be activated by manganese or magnesium ions. In the presence of magnesium ions, it is activated by bicarbonate, however, in the presence of manganese ions its activity is inhibited by bicarbonate. In the absence of magnesium and bicarbonate, its activity is shown to be weakly activated by calcium ions. sAC plays a critical role in mammalian spermatogenesis by producing the cAMP, which regulates cAMP-responsive nuclear factors indispensable for sperm maturation in the epididymis. It induces capacitation, the maturational process that sperm undergo prior to fertilization and is also involved in ciliary beat regulation. sAC is shown to play a role in the pathogenesis of certain hyperproliferative skin disorders via modulation of gene expression. Its levels are shown to be upregulated in the nuclei of keratinocytes in certain hyperproliferative skin diseases, such as psoriasis and squamous cell carcinoma. However, it is shown that sAC is lost from the nucleus when a malignant epithelial tumor acquires invasive properties in the dermis. (Ref.: Zippin, JH., et al. (2010). J. Invest. Dermatol. 130(5); 1279-1287; Hess, KC., et al. (2005). Dev Cell. 9(2); 249-259; Pastor-Soler, N., et al. (2003). J. Biol. Chem. 278(49); 49523-49529).
Specificity
Clone R21 is a mouse monoclonal antibody that detects soluble adenylyl cyclase in multiple mammalian species.ImmunogenGST-tagged fusion protein corresponding to the 50 kDa splice variant of human soluble Adenylyl cyclase (sAC).ApplicationQuality Control Testing
Evaluated by Western Blotting with GST-soluble adenylate cyclase fusion protein.
Western Blotting Analysis (WB): A 1:1,000 dilution of this antibody detected GST-soluble Adenylate cyclase type 10 fusion protein.
Tested Applicaitons
Immunohistochemistry Applications: A representative lot detected sACDY10 in Immunohistochemistry applications (Pastor-Soler, N., et al. (2003). J Biol Chem.;278(49):49523-9).
Western Blotting Analysis: A representative lot detected sACDY10 in Western Blotting applications (Zippin, J.H., et al. (2003). FASEB J.;17(1):82-4; Pastor-Soler, N., et al. (2003). J Biol Chem.;278(49):49523-9; Hess, K.C., et al. (2005). Dev Cell.;9(2):249-59; Zippin, J.H., et al. (2010). J Invest Dermatol.;130(5):1279-87).
Immunocytochemistry Analysis: A representative lot detected sACDY10 in Immunocytochemistry applications (Zippin, J.H., et al. (2003). FASEB J.;17(1):82-4; Pastor-Soler, N., et al. (2003). J Biol Chem.;278(49):49523-9; Hess, K.C., et al. (2005). Dev Cell.;9(2):249-59; Zippin, J.H., et al. (2010). J Invest Dermatol.;130(5):1279-87).
Immunocytochemistry Analysis: A 1:50 dilution from a representative lot detected sACDY10 in COS-7 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected sACDY10 in human melanoma tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-sACDY10, clone R21, Cat. No. MABS2257, is a mouse monoclonal antibody that detects Adenylate cyclase type 10 (sAC) and is tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone R21, monoclonal mol wt calculated mol wt 187.15 kDa","observed mol wt ~75 kDa purified by using protein G species reactivity canine, mouse, human, rat, monkey packaging antibody small pack of 100 µg application(s) immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG1 epitope sequence N-terminal conjugate unconjugated Protein ID accession no. NP_060887, UniProt accession no. Q96PN6, shipped in 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SALL2 Antibody, clone 2B9.1
eCl@ss: 32160702
Кат. номер MABD633-25UG MABD633-100UG General descriptionSal-like protein 2 (UniProt: Q9Y467; also known as Zinc finger protein 795, Zinc finger protein SALL2, Zinc finger protein Spalt-2, Sal-2, hSal2) is encoded by the SALL2 (also known as KIAA0360, SAL2, ZNF795) gene (Gene ID: 6297) in human. SALL2 is a member of the Sal C2H2-type zinc-finger protein family that serves as a transcription factor and plays a role in eye development before, during, and after optic fissure closure. Two isoforms of SALL2 have been described (105 kDa and 21 kDa) that are produced by alternative splicing. SALL2 contains seven C2H2-type zinc-finger regions. Its highest expression is observed in different areas of adult brain and lower levels are detected in heart muscle. It is expressed throughout the retina and lens vesicle as well as the periocular mesenchyme. In fetal brain it is exclusively found in pontine nuclei and is expressed at five weeks of development, the stage at which optic fissure closure begins. Mutations in SALL2 gene are known to cause Coloboma, ocular, autosomal recessive syndrome that results in abnormal morphogenesis of the optic cup and stalk, and incomplete fusion of the fetal intra-ocular fissure during gestation.
Specificity
Clone 2B9.1 detects Sal-like protein 2 in human cells. It targets an epitope within 90 amino acids from the C-terminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 90 amino acids from the C-terminal region of human Sal-Like protein 2.ApplicationImmunohistochemistry Analysis: A 1:50 dilution from a representative lot detected SALL2 in human cerebellum tissues.
Anti-SALL2, clone 2B9.1, Cat. No. MABD633, is a highly specific mouse monoclonal antibody that targets Sal-like protein 2 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in H9 human embryonic stem cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected SALL2 in H9 human embryonic stem cell lysate.
Target description
~130 kDa observed; 105.31 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 2B9.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_001278375, UniProt accession no. Q9Y467, Gene Information human ... SALL2(6297)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SARS-CoV RBD Antibody, clone m396
Кат. номер MABF3072-25UG MABF3072-100UG General descriptionSpike glycoprotein (UniProt: P59594; also known as S glycoprotein, E2, Peplomer protein) is encoded by the S (also known as 2) gene (Gene ID: 1489668) in SARS-CoV-2 virus. The SARS-CoV-2 is a positive-strand RNA virus that causes severe respiratory syndrome in human. The mature SARS-CoV-2 contains 4 structural proteins: Envelope (E), Membrane (M), Nucleocapsid (N), and the Spike protein (S). E and M proteins help in viral assembly and N protein is needed for RNA synthesis. The S protein is a single-pass type I, homotrimeric, membrane glycoprotein that is responsible for virus binding and entry into host cell. It is synthesized with a signal peptide (aa 1-12), which is subsequently cleaved off to generate the mature protein that contains an extracellular domain (aa 13-1213), a transmembrane domain (aa 1214-1234), and a cytoplasmic domain 1235-1273). The S protein is further processed into S1 (aa 13-685) and S2 (aa 686-1273) subunits by host cell furin. The presence of a furin polybasic cleavage site in S protein from SARS-CoV-2 sets it apart from S protein in SARS-CoV that possesses a monobasic S1/S2 cleavage site. The S1 subunit has the receptor binding domain (RBD; aa 319-541) that mediates entry of SARS-CoV-2 into sensitive cells through the peptidase domain of host Angiotensin-converting enzyme 2 (ACE2) with high affinity (KD = 15 nM). The S2 protein, which is reported to be well conserved, is responsible for membrane fusion. Clone m396 is shown to neutralize SARS-CoV-2 virus by disrupting ACE2/RBD binding. It is also effective in neutralizing both SARS-CoV-1 and SARS-CoV-2 pseudoparticles. (Ref.: Ju, B., et al. (2020). Nature. 584(7819); 115-119; Cao, Y., et al. (2020). Cell. 182(1); 73-84).
Specificity
Clone m396 is a human recombinant monoclonal antibody that detects SARS-CoV spike protein. It targets an epitope within the receptor binding domain.ImmunogenFrom human IgG phage library panned against the receptor-binding domain (RBD) of the SARS-CoV spike protein.ApplicationAnti-SARS-CoV RBD, clone m396, Cat. No. MABF3072, is a human recombinant monoclonal antibody that detects Spike protein of SARS-CoV and is tested for use in ELISA, Neutralizing, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting with His-tagged recombinant receptor binding domain of SARS-CoV spike protein.
Western Blotting Analysis (WB): A 1:1,000 dilution of this antibody detected recombinant receptor binding domain of SARS-CoV spike protein.
Tested Applications
Neutralizing: A representative lot neutralized SARS-CoV in Neutralizing applications (Zhu, Z., et al. (2007). Proc Natl Acad Sci USA.;104(29):12123-8).
ELISA Analysis: Various dilutions of this antibody detected His-tagged SARS-CoV Receptor Binding Domain (RBD) of SARS-CoV Spike protein.
ELISA Analysis: A representative lot detected SARS-CoV RBD in ELISA applications (Ju, B., et al. (2020). Nature.;584(7819):115-119).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified human recombinant monoclonal antibody IgG1 in PBS without azide.
Storage and Stability
Store at -10°C to -25°C. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone m396, monoclonal mol wt calculated mol wt 139.13 kDa","observed mol wt ~34 kDa purified by using Protein A species reactivity SARS coronavirus packaging antibody small pack of 100 µg application(s) ELISA: suitable","neutralization: suitable","western blot: suitable isotype IgG1 epitope sequence Extracellular domain conjugate unconjugated Protein ID accession no. NP_828851, UniProt accession no. P59594, shipped in dry ice Gene Information vaccinia virus ... S(1489668)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SARS-CoV-1/2 S Protein Antibody, clone 2B3E5 ZooMAb® Mouse Monoclonal
Кат. номер ZMS1076-25UL ZMS1076-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.SpecificityClone 2B3E5 is a ZooMAb mouse recombinant antibody that specifically detects SARS-CoV-1/2 Spike protein. It targets an epitope within the extracellular domain.ImmunogenRecombinant fragment corresponding to full-length extracellular domain from SARS-CoV virus spike protein.ApplicationAnti-SARS-CoV-1/2 S Protein, clone 2B3E5 ZooMAb, Cat. No. ZMS1076, is a recombinant Mouse monoclonal antibody that detects SARS-CoV-1/2 Spike (S) protein and is tested for use in Affinity Binding Assay, ELISA, Flow Cytometry, and Western Blotting.
Affinity Binding Assay: This antibody bound recombinant extracellular domain of Spike protein with a KD of 3.8 x 10-7 and with the recombinant receptor binding domain with a KD of 4.4 x 10-7.
Flow Cytometry Analysis: 1 µg/mL from a representative lot detected SARS-CoV-1/2 S protein in Transfected 293 cells (Courtesy of Dr Thomas Moran, Center for Therapeutic Antibody Development).
Western Blotting Analysis: 1 µg/mL from a representative lot detected SARS-CoV-1/2 S Protein in Vero E6 cells +/- SARS-Cov-2 infection (Courtesy of Jeff Johnson Laboratory, Icahn School of Medicine at Mount Sinai (ISMMS).
ELISA Analysis: A multiple Dilution from a representative lot detected SARS-CoV-1/2 S Protein in S1 fusion protein (Courtesy of Dr Thomas Moran, Center for Therapeutic Antibody Development).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
SARS-CoV-1/2 Spike glycoprotein (UniProt: P59594/P0DTC2; also known as S glycoprotein, E2, Peplomer protein) is encoded by the S gene (Gene ID: 1489668/43740568) in SARS-CoV-1/2 virus. The SARS-CoV-2 is a positive-strand RNA virus that causes severe respiratory syndrome in human. The mature SARS-CoV-2 contains 4 structural proteins: Envelope (E), Membrane (M), Nucleocapsid (N), and the Spike protein (S). E and M proteins help in viral assembly and N protein is needed for RNA synthesis. The S protein is a single-pass type I, homotrimeric, membrane glycoprotein that is responsible for virus binding and entry into host cell. It is synthesized with a signal peptide (aa 1-12), which is subsequently cleaved off to generate the mature protein that contains an extracellular domain (aa 13-1213), a transmembrane domain (aa 1214-1234), and a cytoplasmic domain 1235-1273). The S protein is further processed into S1 (aa 13-685) and S2 (aa 686-1273) subunits by host cell furin. The presence of a furin polybasic cleavage site in S protein from SARS-CoV-2 sets it apart from S protein in SARS-CoV that possesses a monobasic S1/S2 cleavage site. The S1 subunit has the receptor binding domain (RBD; aa 319-541) that mediates entry of SARS-CoV-2 into sensitive cells through the peptidase domain of host Angiotensin-converting enzyme 2 (ACE2) with high affinity (KD = 15 nM). The S2 protein, which is reported to be well conserved, is responsible for membrane fusion. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified mouse monoclonal antibody IgG2a in buffer containing PBS with 5% Trehalose without preservatives
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Data presented is the available current product information and provided as-is. These products have not been tested or verified in any additional applications, sample types, including any clinical use. Experimental conditions must be empirically derived by the user. Our Antibody Guarantee only covers tested applications stated herein and conditions presented in our product information and is not extended to publications.
Параметры
