Protein Mass Spectrometry
- Сортировать:
- Вид таблицей
-
AQUA™ Peptide YTGDASALFILPDQD[K] AQ0661-100PMOL
NACRES: NA.26 ApplicationProtein-AQUA™ is a powerful, enabling technology that facilitates focused, quantitative studies of not only specific protein expression, but specific amino acid modification as well, using stable-isotope–labeled peptides and mass spectrometry.Legal InformationThis method was developed by Dr. Steve Gygi and colleagues at Harvard Medical School. Limited use of this method is permitted under a licensing arrangement with Harvard Medical School.
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
AQUA is a trademark of Harvard Medical SchoolПараметрыmol wt monoisotopic mol wt 1760.87 Da shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
AQUA™ Peptide YVPIHTIDDGYSVI[K] AQ0223-100PMOL
Empirical Formula (Hill Notation): C7413C6H122N1615N2O24 Molecular Weight: 1727.87 NACRES: NA.26 ApplicationProtein-AQUA™ is a powerful, enabling technology that facilitates focused, quantitative studies of not only specific protein expression, but specific amino acid modification as well, using stable-isotope–labeled peptides and mass spectrometry.Legal InformationThis method was developed by Dr. Steve Gygi and colleagues at Harvard Medical School. Limited use of this method is permitted under a licensing arrangement with Harvard Medical School.
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
AQUA is a trademark of Harvard Medical School
Protein AQUA is a trademark of Harvard Medical SchoolПараметрыmol wt monoisotopic mol wt 1726.90 Da shipped in wet ice storage temp. 20°C Gene Information bakers yeast ... MRI1(856234)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, type N95 (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
AQUA™ Peptide YVQDGTYTV[K] AQ0608-100PMOL
ApplicationProtein-AQUA™ is a powerful, enabling technology that facilitates focused, quantitative studies of not only specific protein expression, but specific amino acid modification as well, using stable-isotope–labeled peptides and mass spectrometry.Legal InformationThis method was developed by Dr. Steve Gygi and colleagues at Harvard Medical School. Limited use of this method is permitted under a licensing arrangement with Harvard Medical School.
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
AQUA is a trademark of Harvard Medical SchoolПараметрыmol wt monoisotopic mol wt 1180.59 Da shipped in wet ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
AQUA™ Peptide YVQELQ[K] AQ0320-100PMOL
Empirical Formula (Hill Notation): C3513C6H66N815N2O13 Molecular Weight: 914.96 NACRES: NA.26 ApplicationProtein-AQUA™ is a powerful, enabling technology that facilitates focused, quantitative studies of not only specific protein expression, but specific amino acid modification as well, using stable-isotope–labeled peptides and mass spectrometry.Legal InformationThis method was developed by Dr. Steve Gygi and colleagues at Harvard Medical School. Limited use of this method is permitted under a licensing arrangement with Harvard Medical School.
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
AQUA is a trademark of Harvard Medical School
Protein AQUA is a trademark of Harvard Medical SchoolПараметрыmol wt monoisotopic mol wt 914.495 Da shipped in wet ice storage temp. 20°C Gene Information chicken ... FSTL1(395349)
cow ... FSTL1(534482)
dog ... FSTL1(608384)
human ... EEA1(8411), FSTL1(11167)
mouse ... Fstl1(14314)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, type N95 (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
AQUA™ Peptide YVYIAELLAH[K] AQ0547-100PMOL
NACRES: NA.26 ApplicationProtein-AQUA™ is a powerful, enabling technology that facilitates focused, quantitative studies of not only specific protein expression, but specific amino acid modification as well, using stable-isotope–labeled peptides and mass spectrometry.Legal InformationThis method was developed by Dr. Steve Gygi and colleagues at Harvard Medical School. Limited use of this method is permitted under a licensing arrangement with Harvard Medical School.
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
AQUA is a trademark of Harvard Medical SchoolПараметрыmol wt monoisotopic mol wt 1326.74 Da shipped in wet ice storage temp. 20°C Gene Information human ... PON1(5444)
mouse ... Pon1(18979)
rat ... Pon1(84024)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Biotin Polyethyleneoxide Iodoacetamide
Empirical Formula (Hill Notation): C18H31IN4O5S Molecular Weight: 542.43 MDL number: MFCD04974830 PubChem Substance ID: 24891627 NACRES: NA.32
Кат. номер B2059-50MG B2059-25MG General descriptionBiotin polyethyleneoxide (PEO) iodoacetamide is a sulfhydryl (thiol) specific biotinylation reagent.ApplicationBiotin Polyethyleneoxide Iodoacetamide has been used as a thiol reactive reagent to demonstrate the presence of free thiols in capsid protein L1 of human papillomavirus 16. It has been used for biotinylation of proteins for ELISA (enzyme-linked immunosorbent assay) competition and pull down experiments.- Incorporates a 12 atom hydrophilic spacer.
- Typically coupled to sulfhydryl groups at pH 7.5 - 8.5
- Especially useful for cysteine labeling in many proteomics type applications such as peptide mapping and mass spectrometry.
Biochem/physiol ActionsBiotin polyethyleneoxide (PEO) iodoacetamide group reacts specifically with reduced thiols at pH 7.5 - 8.5. Peptides and small molecules containing thiol groups may also be labeled using this reagent. The biotin PEO iodoacetamide enables tagging of cysteine residues and conjugation to sulfhydryls in proteins making it useful in proteomics, peptide mapping, phosphopeptide analysis, and mass spectrometry.Параметрыdescription Sulfhydryl specific, water soluble biotinylation reagent Quality Level 200 form powder solubility H2O: 10 mg/mL storage temp. 2-8°C SMILES string ICC(=O)NCCOCCOCCNC(=O)CCCCC1SCC2NC(=O)NC12 InChI 1S/C18H31IN4O5S/c19-11-16(25)21-6-8-28-10-9-27-7-5-20-15(24)4-2-1-3-14-17-13(12-29-14)22-18(26)23-17/h13-14,17H,1-12H2,(H,20,24)(H,21,25)(H2,22,23,26) InChI key LWGLKVINXNMNJX-UHFFFAOYSA-N
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 - H335 pcodes P302 + P352 - P305 + P351 + P338 Target Organs Respiratory system Personal Protective Equipment dust mask type N95 (US), Eyeshields, Gloves RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Endoproteinase Arg-C from mouse submaxillary gland
CAS Number: 82047-85-6 Enzyme Commission (EC) Number: 3.4.21.35 ( BRENDA | IUBMB ) EC Number: 279-893-6 MDL number: MFCD01324999 NACRES: NA.56
Кат. номер P6056-1VL P6056-PH P6056-1VL-KC ApplicationEndoproteinase Arg-C from mouse submaxillary gland has been used to study the syncytium formation in MERS-CoV (middle East respiratory syndrome coronavirus)-infected Vero cells in the presence of exogenous proteases. It has been used for the digestion of Rpl23ab (ribosomal protein L23ab)-containing fraction for LC-MS (liquid chromatography–mass spectrometry)/MS analysis.
Biochem/physiol Actions
Endoproteinase Arg-C is a serine endoprotease from mouse submaxillary gland which hydrolyzes peptide bonds at the carboxyl side of arginyl residues. The enzyme has been shown to cleave Lys-Lys and Lys-Arg bonds, and all Arg-X bonds may not be hydrolyzed.
Unit Definition
One unit will hydrolyze 1.0 µmole of N-p-tosyl-L-arginine methyl ester per min at pH 8.0 at 25 °C.Параметрыform lyophilized powder Quality Level 200, packaging vial of 5 μg suitability suitable for protein sequencing storage temp. −20°C
Safety Informationpictograms GHS07,GHS08 signalword Danger hcodes H315 - H319 - H334 - H335 pcodes P261 - P264 - P271 - P280 - P302 + P352 - P305 + P351 + P338 Target Organs Respiratory system RIDADR NONH for all modes of transport WGK Germany WGK 3 Узнать цену -
Endoproteinase Asp-N from Pseudomonas fragi mutant strain
CAS Number: 9001-92-7 Enzyme Commission (EC) Number: 3.4.24.33 ( BRENDA | IUBMB ) EC Number: 232-642-4 MDL number: MFCD02253021 NACRES: NA.56
Кат. номер P3303-1VL P3303-1VL-PW P3303-1VL-KC General descriptionEndoproteinase Asp-N is a metallo endoprotease. It is obtained from a mutant strain of Pseudomonas fragi, which hydrolyzes peptide bonds on the N-terminal side of aspartic and cysteic acid residues. Asp-N is used in proteomics for peptide mapping and protein sequence work due to its highly specific cleavage of peptides.ApplicationEndoproteinase Asp-N from Pseudomonas fragi mutant strain has been used for the digestion of specific proteins to prepare peptides and for the analysis of generated peptides by MS (mass spectrometry) method.Параметрыform lyophilized powder Quality Level 200 analyte chemical class(es) amino acids packaging vial of 2 µg suitability suitable for protein sequencing storage temp. 2-8°C
Safety Informationpictograms GHS07,GHS08 signalword Danger hcodes H315 - H319 - H334 - H335 pcodes P302 + P352 - P305 + P351 + P338 Target Organs Respiratory system Personal Protective Equipment dust mask type N95 (US), Eyeshields, Faceshields, Gloves RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Endoproteinase Glu-C from Staphylococcus aureus V8
CAS Number: 66676-43-5 Enzyme Commission (EC) Number: 3.4.21.19 ( BRENDA | IUBMB ) EC Number: 200-350-6 MDL number: MFCD01324998
Кат. номер P6181-1VL-KC P6181-50UG-KC P6181-PM P6181-1VL P6181-50UG-PW P6181-PH P6181-50UG ApplicationEndoproteinase Glu-C from Staphylococcus aureus V8 has been used for:- obtaining proteolytic cleavage fragments of the S-layer protein (from Bacillus stearothermophilus ATCC 12980) to perform affinity studies.
- the enzymatic cleavage of native VSTx-3 (voltage sensor toxin 3) peptide for its sequence determination.
- limited proteolysis of recombinant purified PimA (phosphatidylinositol mannosyltransferase).
- the digestion of glycosylated hemoglobin for isotope dilution liquid chromatography-tandem mass spectrometry analysis.
Biochem/physiol ActionsEndoproteinase Glu-C from Staphylococcus aureus strain V8 is a serine endoprotease, which hydrolyzes peptide bonds at the carboxyl side of glutamyl and aspartyl residues. The specificity of Glu-C is dependent upon the buffer and pH employed as well as the structure around the potential cleavage site. In ammonium acetate (pH 4.0) or ammonium bicarbonate (pH 7.8), the enzyme preferentially cleaves glutamyl bonds; whereas, in phosphate buffer (pH 7.8) Glu-C will cleave at either site. Glu-C is reported to be active in the presence of 0.2% SDS (sodium dodecyl sulfate) and in 4.0M urea.Параметрыform lyophilized powder Quality Level 200 analyte chemical class(es) amino acids suitability suitable for protein sequencing storage temp. 20°C
Safety InformationPersonal Protective Equipment dust mask type N95 (US), Eyeshields, Faceshields, Gloves RIDADR NONH for all modes of transport WGK Germany WGK 3 Узнать цену -
IA-MS Immunoaffinity Mass Spectrometry Kit - Protein A/G MSKT0004-1KT
General descriptionThe Protein A/G IA-MS Immunoaffinity Mass Spectrometry Kit is a 96-well platform enabling robust, high-throughput quantification of proteins in complex backgrounds by LC-MS/MS. Users provide their own capture antibody and internal standard (available separately, internal standards may be SIL peptides or preferably full length SIL protein) and the kit contains all other components needed for in-well enrichment and rapid trypsin digestion of samples. The plate format consists of 8-well strips allowing for partial runs, and avoids the high cost and potential LC column blockage associated with bead-based enrichment formats. The entire workflow can be performed in under 5 hours, resulting in digests ready for injection with no SPE or other cleanup required.ApplicationTarget protein enrichment and quantification from complex background by mass spectrometry.
Features and Benefits- Robust, high-throughput quantification of proteins in complex backgrounds by LC-MS/MS
- Entire workflow including digest completed in under 5 hours, such that samples are injection ready at the end of the work day
- 96-well plate format has potential for automation in a liquid-handling system
- Bead-free system circumvents messy clean-up and eliminates risk of column clogging
- Plate strips allow user to run as many or as few samples as desired
Packaging
Box with foam insert containing kit components.
Components
Protein A/G Coated Plates SAE0113-1EA
SOLu-Trypsin EMS0004-100UG
MS Denaturation Solution EMS00010-10ML
Rapid Trypsin Digestion Buffer EMS0009-30ML
Tris Buffered Saline with TWEEN® 20 (TBST)powder, pH 8.0 T9039
Tris Buffered Saline (TBS) powder, pH 8.0 T6664
EZ-Pierce™ plate seal Z721581-1EA
See datasheet, for more information.
Storage and Stability
2 years when stored at 2-8 °C.
Related Presentation- Development and Comparison of Two High Throughput LC-MS Methods for the Accurate Quantitation of IGF1 in Human Serum, (Poster, PDF)
Legal InformationEZ-Pierce is a trademark of Excel Scientific, Inc.
TWEEN is a registered trademark of Croda International PLCПараметрыform solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 2-8°C
Safety Informationpictograms GHS02,GHS06,GHS08 signalword Danger hcodes H226 - H301 + H311 + H331 - H370 pcodes P210 - P233 - P280 - P301 + P310 - P303 + P361 + P353 - P304 + P340 + P311 Flash Point F 75.2 °F Flash Point C 24 °C Узнать цену -
IA-MS Immunoaffinity Mass Spectrometry Kit - Streptavidin MSKT0003-1KT
General descriptionThe Streptavidin IA-MS Immunoaffinity Mass Spectrometry Kit is a 96-well platform enabling robust, high-throughput quantification of proteins in complex backgrounds by LC-MS/MS. Users provide their own biotinylated capture molecule and internal standard (available separately, internal standards may be SIL peptides or preferably full length SIL protein) and the kit contains all other components needed for in-well enrichment and rapid trypsin digestion of samples. The plate format consists of 8-well strips allowing for partial runs, and avoids the high cost and potential LC column blockage associated with bead-based enrichment formats. The entire workflow can be performed in under 5 hours, resulting in digests ready for injection with no SPE or other cleanup required.ApplicationTarget protein enrichment and quantification from complex background by mass spectrometry.
Features and Benefits- Entire workflow including digest completed in under 5 hours, such that samples are injection ready at the end of the work day
- 96-well plate format has potential for automation in a liquid-handling system
- Bead-free system circumvents messy clean-up and eliminates risk of column clogging
- Plate strips allow user to run as many or as few samples as desired
Packaging
Box with foam insert containing kit components.
Components
Streptavidin High Binding Capacity Coated Plate S2577-1EA
SOLu-Trypsin EMS0004-100UG
MS Denaturation Solution EMS00010-10ML
Rapid Trypsin Digestion Buffer EMS0009-30ML
Tris Buffered Saline with TWEEN® 20 (TBST)powder, pH 8.0 T9039
Tris Buffered Saline (TBS) powder, pH 8.0 T6664
EZ-Pierce™ plate seal Z721581-1EA
See datasheet, for more information.
Storage and Stability
2 years when stored at 2-8 °C.
Related Presentation- Development of a Plate-based Immunoaffinity LC-MS/MS Workflow for Sensitive Quantitation of Free Infliximab and Adalimumab in Human Serum, (Poster, PDF)
Legal InformationEZ-Pierce is a trademark of Excel Scientific, Inc.
TWEEN is a registered trademark of Croda International PLCПараметрыform solid suitability suitable for mass spectrometry shipped in wet ice storage temp. 2-8°C
Safety Informationpictograms GHS02,GHS06,GHS08 signalword Danger hcodes H226 - H301 + H311 + H331 - H370 pcodes P210 - P233 - P280 - P301 + P310 - P303 + P361 + P353 - P304 + P340 + P311 Flash Point F 75.2 °F Flash Point C 24 °C Узнать цену -
Low-Artifact Digestion Buffer
Кат. номер EMS0011-10ML EMS0011-PH General descriptionLow-Artifact Digestion Buffer (EMS0011) is optimized for digestion of therapeutic proteins and antibodies prior to peptide mapping by LC-UV-MS. The buffer has been designed to minimize artifactual methionine oxidation and asparagine deamidation during sample preparation while maintaining effective reduction, alkylation and proteolytic digestion.
Endogenous deamidation and oxidation of protein amino acids can be implicated in and be indicative of many diseases, protein turnover, development, and aging. The introduction of these modifications can often affect biological activity, half-life, and immunogenicity.
Current protein digestion workflows often introduce a significant amount of artifactual deamidation and oxidation which prohibits the measurement of the endogenous levels.
The Low Artifact Digestion Buffer allows protein digestion in less than 6 hours with minimized artifactual modifications such as deamidation and oxidation. The amount of oxidation and deamidation introduced during further downstream processing of biotherapeutic antibodies and proteins can be accurately determined. The most commonly deamidated amino acid is Asn especially when followed by small amino acids such as Gly. The most commonly oxidized amino acids are Met, Cys, and to some extent Trp and His.Параметрыform liquid suitability suitable for (peptide mapping) shipped in wet ice storage temp. 2-8°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
LysargiNase EMS0008
General descriptionLysargiNase is a metalloproteinase found in the thermophilic archaea Methanosarcina acetivorans. It specifically cleaves before lysine and arginine residues in proteins. This cleavage results in peptides with molecular weights similar to tryptic peptides, but with N-terminal lysine or arginine residues that can be fragmented with b ion-dominated spectra. This can improve protein C-terminal peptide identification and several arginine rich phosphosite assignments. Unlike with trypsin, LysargiNase cleavage also occurs at methylated lysine and arginine, allowing detection of these epigenetic modifications.
LysargiNase is suitable for peptide or protein digestion in solution or in gel.ApplicationLysargiNase is suitable for peptide or protein digestion in solution or in gel.
LysargiNase is suitable for peptide or protein digestion in solution or in gel. It is active under a variety of solvent conditions including 5 mM TCEP, 5% methanol, 5% acetonitrile, 0.8 M urea, 0.1% RapiGest, 1% deoxycholate, 0.2% SDS and 1% NP-40. It is active up to 55°C at pH 6 – 9. LysargiNase is reversibly inhibited by 1, 10-phenanthroline, EDTA and other calcium and zinc chelating agents. For peptide or protein digestion, a ratio of between 1:100 to 1:20 (w/w) enzyme:substrate is recommended.ComponentsEach vial contains 20 µg LysargiNase, prepared by recombinant expression in E. coli and lyophilized from buffer.Physical formEach vial contains 20 µg LysargiNase, prepared by recombinant expression in E. coli and lyophilized from buffer. Upon reconstitution in 20 µL water, the enzyme is in 50 mM HEPES, 5 mM CaCl2, pH 7.5.Storage and StabilityStore the lyophilized product at -20°C for up to 2 years. After reconstitution, the unused material can be stored in the freezer in aliquots. Avoid repeated freeze thaw cycles.Other NotesConcentration: Please refer to lot specific datasheet.DisclaimerUnless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 shipped in ambient
Safety Informationpictograms GHS07,GHS08 signalword Danger hcodes H315 - H319 - H334 - H335 pcodes P261 - P264 - P271 - P302 + P352 - P304 + P340 + P312 - P305 + P351 + P338 Target Organs Respiratory system WGK Germany WGK 1 Узнать цену -
MS PhosphoMix 1 Heavy
NACRES: NA.24
Кат. номер MSP1H-5X1VL MSP1H-1VL MSP1H-PH M9943-1.5ML-PW General descriptionThe MS PhosphoMix line of products allows for the testing of the strengths and weaknesses of phosphopeptide sample processing, mass spectrometry analysis and instrument configurations. The mixes are produced from synthetic phosphopeptides with sequences derived from naturally occurring peptides as identified by Mann et al. in HeLa cells.† Because the sequences are derived from mammalian cells, many natural phosphorylation motifs, such as those that present an abundance of proline, are represented.† Additionally, the phosphopeptide distribution in each mix has been chosen to present a broad range of characteristics, including ionizability, LC retention time, charge state, and isoelectric point. Finally, PhosphoMix-1, 2, and 3 were designed in a complementary fashion, as highlighted on the following page. For example, all three mixes contain peptides of the same sequence with different sites of phosphorylation.
Each of the three phosphopeptides mixes are available in their naturally occurring isotopic abundances (light) or as stable isotope enriched versions (heavy), making the set of products highly amenable to quantitative analyses, allowing users to compare recovery between workflows or techniques.- Naturally occurring peptide sequences
- Broad range of peptide characteristics
- Complementary product designs
- Available in light and heavy versions
More info and FASTA file,Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.ПараметрыQuality Level 200, quality Phosphopeptide Standard for MS analyte chemical class(es) amino acids, peptides, proteins packaging pkg of 200 pmol total phosphopeptides application(s) HPLC: suitable, LC/MS: suitable Featured Industry Food and Beverages format multi-component solution storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS PhosphoMix 1 Light
NACRES: NA.24
Кат. номер MSP1L-5X1VL MSP1L-PH MSP1H-1VL-PW MSP1L-1VL General descriptionThe MS PhosphoMix line of products allows for the testing of the strengths and weaknesses of phosphopeptide sample processing, mass spectrometry analysis and instrument configurations. The mixes are produced from synthetic phosphopeptides with sequences derived from naturally occurring peptides as identified by Mann et al. in HeLa cells. Because the sequences are derived from mammalian cells, many natural phosphorylation motifs, such as those that present an abundance of proline, are represented. Additionally, the phosphopeptide distribution in each mix has been chosen to present a broad range of characteristics, including ionizability, LC retention time, charge state, and isoelectric point. Finally, PhosphoMix-1, 2, and 3 were designed in a complementary fashion, as highlighted on the following page. For example, all three mixes contain peptides of the same sequence with different sites of phosphorylation.
Each of the three phosphopeptides mixes are available in their naturally occurring isotopic abundances (light) or as stable isotope enriched versions (heavy), making the set of products highly amenable to quantitative analyses, allowing users to compare recovery between workflows or techniques.- Naturally occurring peptide sequences
- Broad range of peptide characteristics
- Complementary product designs
- Available in light and heavy versions
More info and FASTA file,ПараметрыQuality Level 200, quality Phosphopeptide Standard for MS analyte chemical class(es) amino acids, peptides, proteins packaging pkg of 200 pmol total phosphopeptides application(s) HPLC: suitable, LC/MS: suitable Featured Industry Food and Beverages format multi-component solution storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS PhosphoMix 2 Heavy
NACRES: NA.24
Кат. номер MSP2H-5X1VL MSP2H-1VL MSP2H-PH MSP1L-1VL-PW General descriptionThe MS PhosphoMix line of products allows for the testing of the strengths and weaknesses of phosphopeptide sample processing, mass spectrometry analysis and instrument configurations. The mixes are produced from synthetic phosphopeptides with sequences derived from naturally occurring peptides as identified by Mann et al. in HeLa cells.† Because the sequences are derived from mammalian cells, many natural phosphorylation motifs, such as those that present an abundance of proline, are represented.† Additionally, the phosphopeptide distribution in each mix has been chosen to present a broad range of characteristics, including ionizability, LC retention time, charge state, and isoelectric point. Finally, PhosphoMix-1, 2, and 3 were designed in a complementary fashion, as highlighted on the following page. For example, all three mixes contain peptides of the same sequence with different sites of phosphorylation.
Each of the three phosphopeptides mixes are available in their naturally occurring isotopic abundances (light) or as stable isotope enriched versions (heavy), making the set of products highly amenable to quantitative analyses, allowing users to compare recovery between workflows or techniques.- Naturally occurring peptide sequences
- Broad range of peptide characteristics
- Complementary product designs
- Available in light and heavy versions
More info and FASTA file,Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.ПараметрыQuality Level 200, quality Phosphopeptide Standard for MS analyte chemical class(es) amino acids, peptides, proteins packaging pkg of 200 pmol total phosphopeptides application(s) HPLC: suitable, LC/MS: suitable Featured Industry Food and Beverages format multi-component solution storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS PhosphoMix 2 Light
NACRES: NA.24
Кат. номер MSP2L-5X1VL MSP2L-1VL MSP2L-PH MSP2H-1VL-PW General descriptionThe MS PhosphoMix line of products allows for the testing of the strengths and weaknesses of phosphopeptide sample processing, mass spectrometry analysis and instrument configurations. The mixes are produced from synthetic phosphopeptides with sequences derived from naturally occurring peptides as identified by Mann et al. in HeLa cells.† Because the sequences are derived from mammalian cells, many natural phosphorylation motifs, such as those that present an abundance of proline, are represented.† Additionally, the phosphopeptide distribution in each mix has been chosen to present a broad range of characteristics, including ionizability, LC retention time, charge state, and isoelectric point. Finally, PhosphoMix-1, 2, and 3 were designed in a complementary fashion, as highlighted on the following page. For example, all three mixes contain peptides of the same sequence with different sites of phosphorylation.
Each of the three phosphopeptides mixes are available in their naturally occurring isotopic abundances (light) or as stable isotope enriched versions (heavy), making the set of products highly amenable to quantitative analyses, allowing users to compare recovery between workflows or techniques.- Naturally occurring peptide sequences
- Broad range of peptide characteristics
- Complementary product designs
- Available in light and heavy versions
More info and FASTA file,ПараметрыQuality Level 200, quality Phosphopeptide Standard for MS analyte chemical class(es) amino acids, peptides, proteins packaging pkg of 200 pmol total phosphopeptides application(s) HPLC: suitable, LC/MS: suitable Featured Industry Food and Beverages format multi-component solution storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS PhosphoMix 3 Heavy
NACRES: NA.24
Кат. номер MSP3H-1VL MSP3H-PH MSP2L-1VL-PW MSP3H-5X1VL General descriptionThe MS PhosphoMix line of products allows for the testing of the strengths and weaknesses of phosphopeptide sample processing, mass spectrometry analysis and instrument configurations. The mixes are produced from synthetic phosphopeptides with sequences derived from naturally occurring peptides as identified by Mann et al. in HeLa cells.† Because the sequences are derived from mammalian cells, many natural phosphorylation motifs, such as those that present an abundance of proline, are represented.† Additionally, the phosphopeptide distribution in each mix has been chosen to present a broad range of characteristics, including ionizability, LC retention time, charge state, and isoelectric point. Finally, PhosphoMix-1, 2, and 3 were designed in a complementary fashion, as highlighted on the following page. For example, all three mixes contain peptides of the same sequence with different sites of phosphorylation.
Each of the three phosphopeptides mixes are available in their naturally occurring isotopic abundances (light) or as stable isotope enriched versions (heavy), making the set of products highly amenable to quantitative analyses, allowing users to compare recovery between workflows or techniques.- Naturally occurring peptide sequences
- Broad range of peptide characteristics
- Complementary product designs
- Available in light and heavy versions
More info and FASTA file,Legal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.ПараметрыQuality Level 200, quality Phosphopeptide Standard for MS analyte chemical class(es) amino acids, peptides, proteins packaging pkg of 200 pmol total phosphopeptides application(s) HPLC: suitable, LC/MS: suitable Featured Industry Food and Beverages format multi-component solution storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS PhosphoMix 3 Light
NACRES: NA.24
Кат. номер MSP3L-5X1VL MSP3L-PH MSP3H-1VL-PW MSP3L-1VL General descriptionThe MS PhosphoMix line of products allows for the testing of the strengths and weaknesses of phosphopeptide sample processing, mass spectrometry analysis and instrument configurations. The mixes are produced from synthetic phosphopeptides with sequences derived from naturally occurring peptides as identified by Mann et al. in HeLa cells. Because the sequences are derived from mammalian cells, many natural phosphorylation motifs, such as those that present an abundance of proline, are represented. Additionally, the phosphopeptide distribution in each mix has been chosen to present a broad range of characteristics, including ionizability, LC retention time, charge state, and isoelectric point. Finally, PhosphoMix-1, 2, and 3 were designed in a complementary fashion, as highlighted on the following page. For example, all three mixes contain peptides of the same sequence with different sites of phosphorylation.
Each of the three phosphopeptides mixes are available in their naturally occurring isotopic abundances (light) or as stable isotope enriched versions (heavy), making the set of products highly amenable to quantitative analyses, allowing users to compare recovery between workflows or techniques.- Naturally occurring peptide sequences
- Broad range of peptide characteristics
- Complementary product designs
- Available in light and heavy versions
More info and FASTA file,ПараметрыQuality Level 200, quality Phosphopeptide Standard for MS analyte chemical class(es) amino acids, peptides, proteins packaging pkg of 200 pmol total phosphopeptides application(s) HPLC: suitable, LC/MS: suitable Featured Industry Food and Beverages format multi-component solution storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS QCAL Peptide Mix
NACRES: NA.24
Кат. номер MSQC2-25UG MSQC2-2X25UG MSQC2-2X25UG-PW General descriptionQCAL was designed using the QconCAT technology and recombinantly expressed in E. coli. The parent protein sequence of QCAL is as follows:
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.ApplicationThis product is optimized to assess platform characteristics, including:- Repeatability/Reproducibility between runs
- System stability (drift, chromatography, signal intensity, sensitivity, etc.)
- Inter- and intra- platform and lab comparisons
MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.Features and BenefitsGeneral
Complexity- Defined mixture gives confidence in your instruments analysis
ComponentsEach vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.Параметрыform lyophilized powder analyte chemical class(es) amino acids, peptides, proteins application(s) HPLC: suitable Featured Industry Food and Beverages format multi-component solution shipped in ambient storage temp. 2-8°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS Qual/Quant QC Mix
NACRES: NA.24
Кат. номер MSQC1-1VL MSQC1-PH MSP3L-1VL-PW MSQC1-5X1VL ApplicationThis product is optimized to assess platform characteristics, including:- Repeatability/Reproducibility between runs
- System stability (drift, chromatography, signal intensity, sensitivity, etc.)
- Inter- and intra- platform and lab comparisons
Features and BenefitsGeneral
Complexity- Defined mixture gives confidence in your instruments analysis
Qualitative
Mixture of 6 tryptically digested human proteins (FASTA file)- Low complexity, defined mixture
- 25 fold concentration range
- C18 purified
14 SIL peptides- SIL peptides span a concentration range greater than three orders of magnitude (Table 1)
- 2 - 3 peptides per protein
Quantitative- MRM settings provided Skyline, xls, csv
- MRM transitions provided (files above)
- Light : Heavy ratios from 50:1 to 1:5
ComponentsEach vial contains 6 pre-digested (trypsin) human proteins plus 14 corresponding stable isotope labeled (SIL) peptides (7-8 μg total dried in a 0.5 mL vial).QualityUp to 100 uses based upon the recommended reconstitution methodLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.ПараметрыQuality Level 200 form solid quality Proteomics MRM LC-MS Calibration Standard storage temp. −20°C
Safety Informationpictograms GHS08 signalword Danger hcodes H334 pcodes P261 - P284 - P501 RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
MS RT Calibration Mix
NACRES: NA.24
Кат. номер MSRT1-1VL MSRT1-PH MSQC1-1VL-PW MSRT1-5X1VL General descriptionMSRT1 is an injection-ready standard, and can serve for quick tests of LC-MS platform performance, comparison of LC gradients and columns, monitoring column and system changes. MSRT1 can be used to predict retention times of peptides across LC-MS platforms. MSRT1 is also applicable to multiple reaction monitoring / selected reaction monitoring (MRM / SRM) analysis.
Components:
Each vial contains various amounts of 14 isotopically labeled synthetic peptides dried via vacuum centrifugation. Each peptide is labeled with either a [13C6,15N2] Lysine (+8 Da), a [13C6,15N4] Arginine (+10 Da), or a [13C6,15N] Leucine (+7 Da).ApplicationMS RT Calibration Mix has been used as a reference for iRT (relative retention times) calculations after LC-MS (liquid chromatography–mass spectrometry)/MS analysis. It has been used to check the reliability and specificity of ETD-HCD (electron transfer dissociation-high-energy collisional dissociation) MS3 (mass spectrometry) method for leucine/isoleucine discrimination.
The MS RT Calibration Mix is a LC-MS platform standard intended to test properties such as LC resolution, peptide elution profiles, and retention time prediction. The peptides in MSRT1 are designed to span the normal elution profile of complex proteomic samples. The peptides have been added in various amounts, based on electrospray response, to have relatively similar response and be readily observed.
MSRT1 is an injection-ready standard, and can serve for quick tests of LC-MS platform performance, comparison of LC gradients and columns, monitoring column and system changes. MSRT1 can be used to predict retention times of peptides across LC-MS platforms. MSRT1 is also applicable to multiple reaction monitoring / selected reaction monitoring (MRM / SRM) analysis.
Features and Benefits
General
Complexity- Defined mixture gives confidence in your instruments analysis
Easily visualized- Distinct LC-MS peak profile of peptides, readily separated with similar responses
- iRT Table (xls,)
Injection-ready- Decreases prep time
Qualitative:- Defined mixture of 14 stable isotope labeled (SIL) peptides
Quantitative:
MRM settings provided (Skyline,, xls,)
Recommended products
Discover LiChropur reagents ideal for HPLC, or LC-MS, analysisLegal InformationThis product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.Параметрыquality Proteomics Retention Time Standard for LC-MS Quality Level 200, analyte chemical class(es) amino acids, peptides, proteins application(s) HPLC: suitable, LC/MS: suitable Featured Industry Food and Beverages format multi-component solution storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Protease Profiler™ Kit PP0500-1KT
NACRES: NA.56 General descriptionFor detailed characterization of proteins of interest, increase your protease selection with the Protease Profiler. The Protease Profiler provides four proven alternative proteases in addition to Proteomics Grade Trypsin, an enzyme solublization reagent, and an enzyme reaction buffer. Each component has been stringently purified and qualified for MALDI-MS to ensure optimal performance. Characterize with greater flexibility, perform double enzymatic digestions, and explore alternative cleavage sites with the Protease Profiler.- Double Enzymatic Digestion - An initial digestion may result in peptide fragments greater than 5 kDa, often above the optimum detection range for most MS systems/instruments. A second digestion using a protease with different specificity results in cleavage of the large peptides, generating smaller peptides suitable for MS.
- Explore Alternative Proteases - Trypsin may be incompatible with some protein samples. Find the protease best suited to your protein of interest and improve the quality of your data.
- Perform Either Solution or Gel-based Digests - Optimized protocols and reagents for both digest conditions are provided, enabling flexibility in your analysis.
ApplicationThe Protease Profiler™ Kit can be used for different enzymatic digestions on the proteins of interest.
Storage and Stability
The entire Protease Profiler™ Kit retains activity for at least 1 year when stored at –20 °C. Alternatively, some of the components (Trypsin, Lys-C, Asp-N, Trypsin Solubilization Reagent, and Enzyme Reaction Buffer) may be stored at 2–8 °C. The storage temperature indicated on the labels of these products is 2–8 °C. Storage at –20 °C will not compromise the performance of these products.Legal InformationProtease Profiler is a trademark of Sigma-Aldrich Co. LLCПараметрыquality Proteases for Mass Spectrometry and Proteomics Quality Level 200, storage temp. 20°C
Safety Informationpictograms GHS07,GHS08 signalword Danger hcodes H302 - H315 - H317 - H319 - H334 - H335 pcodes P261 - P264 - P280 - P301 + P312 - P302 + P352 - P305 + P351 + P338 Target Organs Respiratory system RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Proteomics Dynamic Range Standard Set
EC Number: 232-650-8 NACRES: NA.24
Кат. номер UPS2-5X1SET UPS2-1SET General descriptionThe Proteomics Dynamic Range Standard Set is produced from a mixture of 48 individual human source or human sequence recombinant proteins, each of which has been selected to limit heterogeneous post-translational modifications (PTMs). The protein standard is formulated from 6 mixtures of 8 proteins to present a dynamic range of 5 orders of magnitude, ranging from 50 pmoles to 500 amoles. Each protein has been quantitated by amino acid analysis (AAA) prior to formulation.ApplicationThe Proteomics Dynamic Range Standard Set can be used to standardize and/or evaluate mass spectrometric (e.g., LC-MS/MS, MALDI-TOF-MS, etc.) and electrophoretic analysis conditions prior to the analysis of complex protein samples. UPS2 can be used to bracket precious experimental data sets between runs of a known complex standard sample. This allows confirmation of the robustness of the analysis method and stability of the instrument employed. Additionally, laboratories generating or comparing mass spectrometric data derived from poorly defined samples can use UPS2 as an external reference to assist with the evaluation of results and experimental methodology.
Proteomics Dynamic Range Standard Set has been used for the quantification of dynamic range universal protein standard on Orbitrap Analyzer using all ion fragmentation. It has been used as a standard for intensity-based absolute quantification of proteins (iBAQ) in LC-MS (liquid chromatography-mass spectrometry)/MS analysis.
Proteomics Dynamic Range Standard Set has been used in the intensity-based absolute quantification (iBAQ) of E .coli proteins, embryonic stem cells (ESCs) and neuronal precursor cells (NPCs) proteomes. It has also been used as a standard to spike HeLa cells for label-free quantification.ПараметрыQuality Level 200 quality Protein Mass Spectrometry Calibration Standard concentration 10.6 μg/ampule protein shipped in wet ice storage temp. −20°C
Safety Informationpictograms GHS07,GHS08 signalword Danger hcodes H315 - H319 - H334 - H335 pcodes P261 - P264 - P271 - P280 - P302 + P352 - P305 + P351 + P338 Target Organs Respiratory system RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Recombinant Trypsin
NACRES: NA.26
Кат. номер EMS0006-4X100UG EMS0006-PH EMS0006-100UG General descriptionTrypsin is a major proteolytic enzyme, synthesized as a preproenzyme by pancreas and is stored as proenzyme trypsinogen in secretory granules. Trypsin belongs to the family of serine proteases that are characterized by the catalytic triad His57, Asp102 and Ser195. Trypsin is routinely used in proteomics research for peptide mapping and protein sequence work due to its highly specific cleavage resulting in a limited number of tryptic peptides. Trypsin is a pancreatic serine endoprotease which hydrolyzes peptide bonds specifically at the carboxyl side of arginine and lysine residues. The rate of hydrolysis is slower if an acidic residue is on either side of the cleavage site and cleavage may not occur if a proline residue is on the carboxyl side. The enzyme also exhibits esterase and amidase activities. Trypsin has an average molecular mass of 23.29 kDa and a pH optimum near 8.0. This product is prepared from recombinant trypsin, porcine sequence. It is naturally devoid of chymotryptic activity. This high-quality trypsin is suitable for proteomics use.
Biochem/physiol Actions
Trypsin plays an important role in the digestion of consumed protein and contributes to the activation of other proteolytic enzymes like chemotrypsin and elastase.ПараметрыQuality Level 200 recombinant expressed in Pichia pastoris assay 10,000 unit/mg protein form lyophilized powder suitability suitable for ","suitable for mass spectrometry UniProt accession no. P00761, shipped in wet ice storage temp. 2-8°C
Safety Informationpictograms GHS05,GHS07,GHS08,GHS09 signalword Danger hcodes H290 - H314 - H317 - H332 - H334 - H335 - H411 pcodes P260 - P273 - P280 - P303 + P361 + P353 - P304 + P340 + P310 - P305 + P351 + P338 Target Organs Respiratory system Supp Hazards EUH071 RIDADR UN 1789 8 / PGIII WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Recombinant Trypsin Dimethlyated
NACRES: NA.26
Кат. номер EMS0007-4X100UG EMS0007-PH EMS0007-100UG General descriptionTrypsin is routinely used in proteomics research for peptide mapping and protein sequence work due to its highly specific cleavage resulting in a limited number of tryptic peptides. Trypsin is a pancreatic serine endoprotease which hydrolyzes peptide bonds specifically at the carboxyl side of arginine and lysine residues. The rate of hydrolysis is slower if an acidic residue is on either side of the cleavage site and cleavage may not occur if a proline residue is on the carboxyl side. The enzyme also exhibits esterase and amidase activities. Trypsin has an average molecular mass of 23.29 kDa and a pH optimum near 8.0.
This product is prepared from recombinant trypsin, porcine sequence and the lysine residues have been dimethylated to further restrict autolysis. It is naturally devoid of chymotryptic activity. This high quality trypsin is suitable for proteomics use.
Specific activity: >= 10,000 BAEE units per mg protein.ПараметрыQuality Level 200 recombinant expressed in Pichia pastoris assay 10,000 unit/mg form lyophilized powder suitability suitable for mass spectrometry UniProt accession no. P00761, shipped in wet ice storage temp. 2-8°C
Safety Informationpictograms GHS05,GHS07,GHS08,GHS09 signalword Danger hcodes H290 - H314 - H317 - H332 - H334 - H335 - H411 pcodes P260 - P273 - P280 - P303 + P361 + P353 - P304 + P340 + P310 - P305 + P351 + P338 Target Organs Respiratory system Supp Hazards EUH071 RIDADR UN 1789 8 / PGIII WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SigmaMAb Antibody Drug Conjugate (ADC) Mimic
Кат. номер MSQC8-PH MSQC8-0.5MG General descriptionSigmaMab Antibody Drug Conjugate (ADC) Mimic, is a non-toxic drug mimic that is utilized as a standard for mass spectrometry and high performance liquid chromatography. The ADC Mimic conjugates SigmaMab (MSQC4), an IgG1 monoclonal antibody, to dansyl fluorophores via an LC-SMCC crosslinker. This dansyl-LC-SMCC attachment serves as the substitution for the toxic payload of a real ADC.
The ADC Mimic allows for safer and more consistent testing, making it the optimal product over real ADCs. It is also a more affordable product compared to real ADCs. With the help of this non-toxic product, LC-MS processes can be developed in a safer environment.ApplicationPoster: Antibody Drug Conjugate Mimic Enables LC-MS Method Development Without Risk
Poster: LC-UV-MS Method Development for Antibody Drug Conjugates Using a Non-Toxic ADC-Mimic
Poster: LC-MS Method Development for Antibody Drug Conjugates Using a Non-Toxic ADC MimicПараметрыQuality Level 200 recombinant expressed in CHO cells antibody product type primary antibodies form lyophilized powder shipped in wet ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SigmaProt Intact Protein LC-MS Standard
EC Number: 220-163-3 NACRES: NA.24
Кат. номер MSRT2-PH MSRT2-1VL MSRT2-1VL-PW MSRT1-1VL-PW MSRT2-5X1VL ApplicationThe RP-LC-MS Protein Standard is a LC-MS platform standard that is intended to test LC-MS system suitability and intact protein mass measurement. The proteins in MSRT2 are chosen to represent an elution profile for complex proteomic samples. The proteins have been selected based on UV and electrospray response, and are readily observed by both modes of detection. After reconstitution, MSRT2 is an injection-ready standard. MSRT2 can be utilized in studies such as in top-down proteomics.
Components
MSRT2 contains these 9 proteins:- Ribonuclease B
- Insulin
- Lysozyme
- Transferrin
- Bovine serum albumin (BSA)
- Trypsin inhibitor
- -lactoglobulin A
- Carbonic anhydrase
- Lactate dehydrogenase
ПараметрыQuality Level 200, storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary A1(3) Sial(Alpha-2,3)
Empirical Formula (Hill Notation): C6513C8H121N5O54 Molecular Weight: 1940.68
Кат. номер ILGA13S23-600PMO ILGA13S23-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary A1(6)F Sial(Alpha-2,3)
Empirical Formula (Hill Notation): C6513C8H121N5O53 Molecular Weight: 1924.68
Кат. номер ILGA16FS23-600PMO ILGA16FS23-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary A2 2x(Sial(Alpha-2,3))
Кат. номер ILGA22S23-600PMO ILGA22S23-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary A2 2x(Sial(Alpha-2,6))
Кат. номер ILGA22S26-600PMO ILGA22S26-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary A2F 2x(Sial(Alpha-2,3))
Empirical Formula (Hill Notation): C8213C8H148N6O66 Molecular Weight: 2378.08
Кат. номер ILGA2F2S23-600PMO ILGA2F2S23-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary A2F 2xSial(Alpha-2,6)
Empirical Formula (Hill Notation): C8213C8H148N6O66 Molecular Weight: 2378.08
Кат. номер ILGA2F2S26-600PMO ILGA2F2S26-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary bA2F 2xSial(Alpha-2,6)
Empirical Formula (Hill Notation): C8213C8H148N6O66 Molecular Weight: 2378.08
Кат. номер ILBA2F2S26-600PMO ILBA2F2S26-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary bG0
Empirical Formula (Hill Notation): C4813C10H97N5O41 Molecular Weight: 1530.33
Кат. номер ILGBG0-600PMO ILGBG0-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G0
Empirical Formula (Hill Notation): C4213C8H84N4O36 Molecular Weight: 1325.15
Кат. номер ILGG0-600PMO ILGG0-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G0F
Empirical Formula (Hill Notation): C8213C8H148N6O66 Molecular Weight: 2378.08
Кат. номер ILGG0F-600PMO ILGG0F-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G1(3)
Empirical Formula (Hill Notation): C4813C8H94N4O41 Molecular Weight: 1487.29
Кат. номер ILGG13-600PMO ILGG13-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G1(6)
Empirical Formula (Hill Notation): C4813C8H94N4O41 Molecular Weight: 1487.29
Кат. номер ILGG16-2000PMO ILGG16-600PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G1(6)F
Empirical Formula (Hill Notation): C5413C8H104N4O45 Molecular Weight: 1633.43
Кат. номер ILGG16F-600PMO ILGG16F-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G2
Empirical Formula (Hill Notation): C5413C8H104N4O46 Molecular Weight: 1649.43
Кат. номер ILGG2-600PMO ILGG2-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G2A1(3) Sial(Alpha-2,3)
Empirical Formula (Hill Notation): C6513C8H121N5O54 Molecular Weight: 1940.68
Кат. номер ILG2A13S23-600PMO ILG2A13S23-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G2A1(3) Sial(Alpha-2,6)
Empirical Formula (Hill Notation): C6513C8H121N5O54 Molecular Weight: 1940.68
Кат. номер ILG2A13S26-600PMO ILG2A13S26-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G2A1(6) Sial(Alpha-2,3)
Empirical Formula (Hill Notation): C6513C8H121N5O54 Molecular Weight: 1940.68
Кат. номер ILG2A16S23-600PMO ILG2A16S23-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G2A1(6)F Sial(Alpha-2,3)
Empirical Formula (Hill Notation): C7113C8H131N5O58 Molecular Weight: 2086.83
Кат. номер IL2A16FS23-600PMO IL2A16FS23-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G2A1(6)F Sial(Alpha-2,6)
Empirical Formula (Hill Notation): C7113C8H131N5O58 Molecular Weight: 2086.83
Кат. номер IL2A16FS26-600PMO IL2A16FS26-2000PMO General descriptionSILu™Carb Glycan Standards are patented synthetic 13C-labeled N-glycans for use as internal standards in absolute glycan quantification by mass spectrometry.ApplicationFor use as a quantitative standard in applications such as Matrix-assisted Laser Desorption Ionization-time-of-flight (MALDI-TOF), Electrospray Ionization (ESI) and Liquid Chromatography Mass Spectrometry (LC-MS).
Physical form
13C labeled N-glycan refernce standard. 20 microM quantified solutionLegal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
SILu™Carb Glycan Standard 13C Biantennary G2F
Empirical Formula (Hill Notation): C6013C8H114N4O50 Molecular Weight: 1795.57
Кат. номер ILGG2F-600PMO ILGG2F-2000PMO Legal InformationSILu is a trademark of Sigma-Aldrich Co. LLCПараметрыshipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
