- Производитель:
- Sigma-Aldrich
NACRES: | NA.12 |
Кат. номер |
MSQC6-PH |
MSQC6-100UG |
MSQC6-100UG-KC |
MSQC6-5MG |
MSQC6-100UG-PW |
Features and Benefits
Universal Peptide Sequence Location
FNWYVDGVEVHNAK Heavy Chain (IgG1)
VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4)
SGTASVVCLLNNFYPR Light Chain (kappa)
VDNALQSGNSQESVTEQDSK Light Chain (kappa)
DSTYSLSSTLTLSK Light Chain (kappa)
SILu™Mab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.
- SILu™Mab yielded reproducible, linear curves from 0.1 µg/mL to 1000 µg/mL without enrichment or depletion.
- Good agreement was observed between multiple peptides derived from the same target.
- Label incorporation was determined to be >98% by mass spectrometry.
- Sequence coverage was confirmed by peptide mapping.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline
Preparation Note
SILu™Mab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILu™Mab provides universal utility, thus eliminating the need for production of candidate-specific internal standards.
Produced utilizing enriched media containing stable isotope labeled amino acids are 13C<SUB>6</SUB>, 15N<SUB>4</SUB>-labeled Arginine and 13C<SUB>6</SUB>, 15N<SUB>2</SUB>-labeled Lysine.
Reconstitution
SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure
- Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
- Add 500 µL of purified water containing 0.1% formic acid to the vial.
- Mix the contents by gently inverting the vial a minimum of 5 times.
- Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.
Analysis Note
SILuMAb K1 Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILuMAb K1 Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVLTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Target overlap areas are underlined
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
Quantitative
MRM settings provided (xls,)
SILu is a trademark of Sigma-Aldrich Co. LLC
Quality Level | 200, |
recombinant | expressed in CHO cells |
antibody product type | primary antibodies |
assay | 90% (SDS-PAGE) |
packaging | vial of 100 µg (± 10% Lot-specific vial content given on certificate of analysis) |
shipped in | wet ice |
storage temp. | 20°C |
RIDADR | NONH for all modes of transport |
WGK Germany | WGK 1 |
Flash Point F | Not applicable |
Flash Point C | Not applicable |
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа

С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии

Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.

У большинства компаний срок ожидания составляет 10-12 недель.

Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.

Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.

В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.

Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.