Protein Biology

His-tagged recombinant fragment corresponding to 77 amino acids from the N-terminal region of human CD133 (Prominin-1).

Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD133 (Prominin-1) in rat kidney tissue sections.
Immunofluorescence Analysis: A 1:100 dilution from a representative lot detected CD133 (Prominin-1) in rat kidney tissue sections.
Anti-CD133 (Prominin-1), clone 2F8 ZooMAb, Cat. No. ZRB1013, is a recombinant Rabbit Monoclonal Antibody that specifically targets Prominin (CD133) and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Prominin-1 (UniProt: O43490; also known as Antigen AC133, Prominin-like protein 1, CD133) is encoded by the PROM1 (also known as PROML1, MSTP061) gene (Gene ID: 8842) in human. CD133 (Prominin-1) is multi-pass cell-surface glycoprotein that plays a role in cell differentiation, proliferation and apoptosis. It binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development CD133 acts as a key regulator of disk morphogenesis. Defects in PROM1 gene are known to cause retinitis pigmentosa, cone-rod dystrophy, and retinal macular dystrophy 2. Higher levels of CD133 have been reported in several cancer cell types, including various leukemias, retinoblastomas, glioblastomas, and kidney carcinomas. Higher levels of CD133 are also observed in pancreatic, gastric, colorectal, and hepatocellular cancers. It is also considered as a marker of stem cells in the adult small intestine that are susceptible to transformation into tumors retaining a fraction of mutant Prom1+ tumor cells. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Zhu, L., et al. (2009). Nature 477 (7229); 603-607).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

ZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	2F8, monoclonal","recombinant monoclonal
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 97.11 kDa","observed mol wt ~100 kDa
species reactivity	rat, human
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency.
enhanced validation	recombinant expression
application(s)	immunofluorescence: suitable using 1:100","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using 1:100","western blot: suitable
isotype	IgG
conjugate	unconjugated
UniProt accession no.	O43490,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... PROM1;PROML1;MSTP061(8842)

Monocyte differentiation antigen CD14 is located at 5q31.1 on the human chromosome.
CD14 is a phospholipid anchored membrane protein with 55kDa molecular mass. It contains a bent solenoid, high leucine content (15.5%) region, and an extended amino-terminal pocket for binding acylated ligands. It is highly present in mature monocyte, macrophages and neutrophils and to lesser extent on granulocytes.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-CD14 antibody produced in rabbit

MDL number:	MFCD00164622
Human Protein Atlas Number:	HPA001887 Human Protein Atlas characterization data

Monocyte differentiation antigen CD14 precursor recombinant protein epitope signature tag (PrEST)

Anti-CD14 antibody produced in rabbit has been used in:

immunofluorescence
immunohistochemistry
western blotting

Anti-CD14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD14 is a pattern recognition receptor which helps to enhance the immune response during infection. During infection, CD14 first sensitize the cell to lipopolysaccharide and other lipoproteins followed by delivering these lipidated products to various Toll-like receptor signaling complexes. After delivery, it induces proinflammatory signaling cascades by ligand binding and causes cellular immune responses.
Monocyte differentiation antigen CD14 is weakly associated with Crohn′s disease (CD) and ulcerative colitis (UC).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84388,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent recombinant expression orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P08571,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD14(929)

ZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-CD14 Antibody, clone 1B4 ZooMAb® Rabbit Monoclonal

Specificity

Clone 1B4 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Monocyte differentiation antigen CD14. It targets an epitope within 16 amino acids from the C-terminal region.

KLH conjugated linear peptide corresponding to 16 amino acids from the C-terminal region of human Monocyte differentiation antigen CD14.

Quality Control Testing
Evaluated by Western Blotting in THP-1 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected CD14 in THP-1 cell lysate.
Tested applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD14 in human liver tissue lysate.
Flow Cytometry Analysis: 0.1 µg from a representative lot detected CD14 in one million THP-1 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD14 in human tonsil tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD14 in THP-1 cells.
Affinity Binding Assay: A representative lot of this antibody bound CD14 peptide with a KD of 1.0 x 10-12 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-CD14, clone 1B4 ZooMAb®, Cat. No. ZRB1294, is a recombinant Rabbit monoclonal antibody that specifically targets CD14 and is tested for use in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Target description
Monocyte differentiation antigen CD14 (UniProt: P08571; also known as Myeloid cell-specific leucine-rich glycoprotein, CD14) is encoded by the CD14 gene (Gene ID: 929) in human. CD14 is a GPI-anchor membrane glycoprotein that serves as a co-receptor for several Toll-like receptors. Together with TLR4 and MD-2, it forms the multi-receptor complex that recognizes Lipopolysaccharide (LPS) on the cell membrane. In the presence of LPS, CD14 and TLR4-MD2 are brought into close proximity inside lipid rafts and after translocation into the lipid rafts, TLR4 in the plasma membrane activates the TIRAP-MyD88-dependent pathway that leads to the first wave of NF-B activation. CD14 also acts as a co-receptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides. These clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. CD14 expression has been reported on cells of both hematopoietic and non-hematopoietic origin. A secreted form of CD14 has also reported that arises from the cleavage of the GPI anchor. CD14 is expressed on macrophages and a strong expression has been reported on the surface of monocytes. Its expression on monocytes is induced by 27-hydroxycholesterol that primes monocytes/macrophages to accelerate LPS-mediated inflammatory reaction. CD14-deficient macrophages display a significantly reduced sensitivity to low concentrations of LPS compared to wild-type cells and CD14 deficient mice do not develop septic shock after exposure to LPS or Gram-negative bacteria. CD14 is synthesized with a signal peptide (aa 1-19) and a propeptide (aa 346-375) that are cleaved off to generate the mature form. The mature form contains 11 leucine-rich repeats (LRR) that are required for responses to smooth LPS. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Zanoni, I., and Granucci, F. (2013). Front. Cell. Infect. Microbiol. 3; 32).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

expressed in HEK 293 cells

antibody form

purified antibody

antibody product type

primary antibodies

clone

1B4, recombinant monoclonal

description

recombinant, expressed in HEK 293 cells

calculated mol wt 40.08 kDa","observed mol wt ~49 kDa

species reactivity

human

species reactivity (predicted by homology)

monkey

packaging

antibody small pack of 25 µL

enhanced validation

recombinant expression
Learn more about

Anti-CD163 antibody produced in rabbit

HPA046404 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88534,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000
isotype	IgG
immunogen sequence	SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	Q86VB7,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD163(9332)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD163L1 antibody produced in rabbit

HPA015663 Human Protein Atlas characterization data

Scavenger receptor cysteine-rich type 1 protein M160 precursor recombinant protein epitope signature tag (PrEST)

Anti-CD163L1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Biochem/physiol Actions
Scavenger receptor CD163 (also known as M160) protein is encoded by M160 gene and is mapped to human chromosome 12p13.3. It belongs to scavenger receptor cysteine-rich superfamily and is found to be expressed by the monocyte or macrophage cell lineage. It acts as a key entry mediator for porcine reproductive and respiratory syndrome virus (PRRSV).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72966,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-1:500","western blot: 0.04-0.4 µg/mL
immunogen sequence	LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
conjugate	unconjugated
UniProt accession no.	Q9NR16,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD163L1(283316)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Putative mucin core protein 24 precursor recombinant protein epitope signature tag (PrEST)

Anti-CD164 antibody produced in rabbit

MDL number:	MFCD01633140
Human Protein Atlas Number:	HPA010636 Human Protein Atlas characterization data

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Sialomucin core protein 24 (also known as endolyn or CD164) is a protein encoded by the CD164 gene in humans. It is a sialomucin that plays roles in regulating proliferation, adhesion, and differentiation of hematopoietic stem cells. CD164 may act as a new target for diagnosis and treatment for colon cancer. It participates in regulating the proliferation, cell adhesion and differentiation of hematopoietic stem and progenitor cells. It is also involved in the development of cancer. The protein functions as a receptor that regulates stem cell localization to the bone marrow and may participate in the localization of prostate cancer cells to the marrow.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71974,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunohistochemistry: 1:20-1:50","western blot: 0.04-0.4 µg/mL
immunogen sequence	TQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTS
conjugate	unconjugated
UniProt accession no.	Q04900,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD164(8763)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD164L2 antibody produced in rabbit

HPA062915 Human Protein Atlas characterization data

CD164 sialomucin-like 2

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88004,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	VAFFVLHFLKAKDSTYQTLI
conjugate	unconjugated
UniProt accession no.	Q6UWJ8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD164L2(388611)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD177 antibody produced in rabbit

HPA041820 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST90945,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-- 1:500
immunogen sequence	DPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNL
conjugate	unconjugated
UniProt accession no.	Q8N6Q3,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD177(57126)

pictograms	GHS07
signalword	Warning
hcodes	H315 - H319
pcodes	P305 + P351 + P338
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD180 antibody produced in rabbit

HPA003740 Human Protein Atlas characterization data

CD180 antigen precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD180 antigen is a protein encoded by the CD180 gene in humans and is mapped to chromosome 5q12. It consists of tandem repeats of a leucine-rich motif in the extracellular domain that may be involved in protein-protein interactions. It acts as a novel human B-cell marker that is preferentially expressed on mature B cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86417,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:500- 1:1000
immunogen sequence	DFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKL
conjugate	unconjugated
UniProt accession no.	Q99467,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD180(4064)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 3E7 is a ZooMAb® Rabbit recombinant monoclonal antibody that specifically detects CD19. It targets an epitope within 23 amino acids from the N-terminal, extracellular domain.

Anti-CD19 Antibody, clone 3E7 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 23 amino acids from the N-terminal region of human CD19.

Anti-CD19, clone 3E7 ZooMAb®, Cat. No. ZRB1207,is a recombinant Rabbit monoclonal antibody that specifically targets CD19 and is tested for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in Daudi cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected CD19 in Daudi cell lysate.
Tested applications
Flow Cytometry Analysis: 1 µg from a representative lot detected CD19 in one million Human peripheral blood mononuclear cells (PBMC).
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD19 in Raji cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD19 in human tonsil and human appendix tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
B-lymphocyte antigen CD19 (UniProt: P15391; also known as B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12, CD19) is encoded by the CD19 gene (Gene ID: 930) in human. CD19 is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-19), which are subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 20-291), a transmembrane domain (aa 292-313), and a cytoplasmic domain (aa 314-556). It also contains two Ig-like C2-type domains (aa 20-113 and 176-277). CD19 is expression has been reported in B cells in blood and lymph nodes. It is part of a complex that is composed of CD19, CD21, CD81, and CD225 in the membrane of mature B-cells. It interacts directly with CD81 via its second extracellular domain early during biosynthesis in the ER/pre-Golgi compartments and is essential for trafficking and compartmentalization of CD19 receptor on the cell surface of activated B cells. It functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes and is reported to decrease the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Following B cell activation, CD19 is phosphorylated on tyrosine residues in a sequential order by Lyn. Phosphorylation of Tyr-531 is rapid, followed by phosphorylation at tyrosine 409. Phosphorylation of Tyr-500 appears to be slow and transient. CD19 is shown to be essential for normal B cell differentiation and proliferation in response to antigen challenges. It also activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca2+ stores. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Sato, A., et al. (1997). J. Immunol. 159(7); 3278-3287; Roifman, CM., and Ke, S. (1992). Biochem. Biophys. Res. Commun. 194(1); 222-225; Carter, RH., and Fearon, DT (1992). Science. 256(5053); 105-107).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

Quality Level	200
biological source	rabbit
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	3E7, recombinant monoclonal
description	recombinant, expressed in HEK 293 cells
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 61.13 kDa","observed mol wt ~80 kDa
purified by	using Protein A
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable
isotype	IgG
epitope sequence	N-terminus
conjugate	unconjugated
Protein ID accession no.	NP_001761.3,
UniProt accession no.	P15391,
shipped in	ambient
storage temp.	2-8°C

CD1A (cluster of differentiation 1A) belongs to a family of antigen-presenting proteins called CD1. These are evolutionary conserved proteins which present lipids instead of peptide. Humans contain five CD1 genes namely, CD1A, CD1B, CD1C, CD1D and CD1E. CD1A is a transmembrane glycoprotein which is expressed on dendritic cells. It is the only isoform, in this family, to be expressed by Langerhans cells.

Anti-CD1A antibody produced in rabbit

MDL number:	MFCD00211768
Human Protein Atlas Number:	HPA010734 Human Protein Atlas characterization data

T-cell surface glycoprotein CD1a precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD1 (cluster of differentiation 1) family of proteins is responsible for the capture and presentation of self and microbial glycolipids to the specific T cells. CD1A plays an important role in the host defense mechanism against microbial infection. It also facilitates early stages of immune response through CD1A-reactive T cells. This is achieved by inducing cytokine production and dendritic cell maturation, and activating cells such as NK (natural killer) cells and macrophages. The SNP rs411089, present in an intron in the CD1A gene is associated with increased susceptibility to tuberculosis, in Vietnamese population. Hence, it can be hypothesized that CD1A plays an important role in host defense against tuberculosis. The expression of this protein is also increased in monocyte culture derived from untreated multiple sclerosis (MS) patients, as opposed to expression in monocyte culture obtained from treated MS patients.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72090,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:50- 1:200
immunogen sequence	QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P06126,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD1A(909)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

CD1B (CD1b molecule) is a lipid antigen presenting glycoprotein belonging to the group of major histocompatibility complex class I-like glycoproteins. It consists of an antigen-binding groove connected with four interlinked hydrophobic channels.

Anti-CD1B antibody produced in rabbit HPA021824-100UL

MDL number:	MFCD00240910
Human Protein Atlas Number:	HPA021824 Human Protein Atlas characterization data

General description

T-cell surface glycoprotein CD1b Precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD1B (CD1b molecule) is majorly involved in the glycolipid antigen recognition and presentation on the CD1b-restricted T Cells during the T cell-mediated immune responses. The antigen-binding groove directly links to the acyl chains of lipid antigens, which allows the hydrophilic components to interact with T cell antigen receptors.CD1B (CD1b molecule) is majorly involved in the glycolipid antigen recognition and presentation on the CD1b-restricted T Cells during the T cell-mediated immune responses. The antigen-binding groove directly links to the acyl chains of lipid antigens, which allows the hydrophilic components to interact with T cell antigen receptors.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72091,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	IHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKAD
conjugate	unconjugated
UniProt accession no.	P29016,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD1B(910)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD2 antibody produced in rabbit HPA003883-100UL

MDL number:	MFCD00239657
Human Protein Atlas Number:	HPA003883 Human Protein Atlas characterization data

T-cell surface antigen CD2 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD2 (cluster of differentiation 2) is a cell adhesion molecule present on the surface of T cells and natural killer (NK) cells. It helps in promoting nanotube formation in ex vivo NK cells and plays a crucial role in the generation of nanotubes between an NK cell and its target. Its expression is significantly increased with the severity of chronic HBV infection, which may contribute to the hepatocyte damage in chronic HBV infection.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86361,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	recombinant expression orthogonal RNAseq
application(s)	immunohistochemistry: 1:500-1:1000","western blot: 0.04-0.4 µg/mL
immunogen sequence	DEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSP
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P06729,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD2(914)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD200 antibody produced in rabbit

HPA031149 Human Protein Atlas characterization data

CD200 (CD_antigen 200) gene is mapped to human chromosome 3q13.2. The gene encodes a transmembrane glycoprotein that belongs to the immunoglobulin superfamily. CD200 is widely expressed in different tissues and cell types such as lymphocytes, kidney glomeruli, neurons and endothelial cells. Its receptor is mainly expressed by myeloid cells (granulocytes, monocytes and macrophages).

CD200 molecule recombinant protein epitope signature tag (PrEST)

Anti-CD200 antibody produced in rabbit has been used in immunofluorescence.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper),
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD200 (CD_antigen 200) has an immunosuppressive effect on cells expressing its receptor, CD200R. CD200 is involved in maintaining immune homeostasis. CD200 reduces the immune system′s reaction to vaccines, while inhibition of CD200 expression can enhance the efficacy of cancer immunotherapy. The gene is known to be overexpressed in a number of human cancers. CD200 mostly supports tumor growth and invasion, by suppressing anti-tumor immune responses, while it is also known to inhibit melanoma cells from forming tumors or metastasizing into the lung. CD200 is considered as a biomarker in colon cancer and cutaneous squamous cell carcinoma. Deficiency of CD200 results in hyperactivation of macrophages and enhanced immune response to autoimmune disease.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86190,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq orthogonal RNAseq
application(s)	immunohistochemistry: 1:50- 1:200
immunogen sequence	EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS
conjugate	unconjugated
UniProt accession no.	P41217,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD200(4345)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD207 antibody produced in rabbit

HPA011216 Human Protein Atlas characterization data

Langerin (CD207) is a C-type lectin, which is expressed on Langerhans cells. It contains a C-type carbohydrate recognition domain (CRD) in its extracellular region. It also contains a Ca2+-dependent sugar binding region. It is a type II transmembrane protein, and its extracellular region also contains the neck region. This neck region forms coiled-coils of -helices which give rise to oligomers of CD207. It contains a proline-rich motif (WPREPPP) in its intracellular domain, which in turn is composed of 43 amino acids. This proline-rich motif might be involved in signal transduction. CD207 gene is localized to human chromosome 2p13.

C-type lectin domain family 4 member K recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Langerin (CD207) is an endocytic receptor which is involved in the formation of Birbeck granules, which are a part of the endosomal compartments exclusive to Langerhans cells. It recognizes the surface glucoconjugates present on pathogens such as, human immunodeficiency virus (HIV), and internalizes them into Birbeck granules. It therefore, prevents the transfer of HIV from Langerhans cells to T-cells, by degrading it. It forms the first step in antigen processing and presentation to immune cells. It recognizes a wide range of pathogens such as, Mycobacterium leprae, herpes simplex virus 2, and fungi such as, Malassezia furfur and Candida species. CD207 also binds to measles virus and presents it to CD4+ T cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71827,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
conjugate	unconjugated
UniProt accession no.	Q9UJ71,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD207(50489)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

CD22 molecule recombinant protein epitope signature tag (PrEST)

Anti-CD22 antibody produced in rabbit

MDL number:	MFCD00211772
Human Protein Atlas Number:	HPA024353 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70003,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:1000- 1:2500
immunogen sequence	DLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLL
conjugate	unconjugated
UniProt accession no.	P20273,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD22(933)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD226 antibody produced in rabbit

HPA015715 Human Protein Atlas characterization data

CD226 antigen precursor recombinant protein epitope signature tag (PrEST)

Anti-CD226 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD226 is an activating receptor consisting of two extracellular domains and mainly functions through its first extracellular domain. This molecule interacts with the ligands CD155 and CD112. With the help of immune-receptor tyrosine-based activatory motif (ITAM), it activates natural killer (NK) cells. Polymorphisms of this gene is associated with inflammatory demyelinating diseases and development of gastric cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72065,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:50- 1:200
immunogen sequence	DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTL
conjugate	unconjugated
UniProt accession no.	Q15762,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD226(10666)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 3N22 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects human Signal transducer 24 (CD24).

Anti-CD24 Antibody, clone 3N22 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 21 amino acids from the internal region of human Signal transducer 24 (CD24).

Anti-CD24, clone 3N22 ZooMAb, Cat. No. ZRB1564, is a recombinant Rabbit monoclonal antibody that specifically detects CD24 and is tested for use in Affinity Binding Assay, Flow Cytometry, and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD24 in lymphocytes, Jurkat, and Daudi cell lysates.
Flow Cytometry Analysis: 1 µg from a representative lot detected CD24 in one million Raji cells.
Affinity Binding Assay: A representative lot of this antibody bound CD24 peptide with a KD of 3.4 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Signal transducer CD24 (UniProt: P25063; also known as Small cell lung carcinoma cluster 4 antigen, CD24) is encoded by the CD24 (also known as CD24A) gene (Gene ID: 100133941) in human. CD24 is a GPI-anchor membrane glycoprotein protein that is expressed on hematopoietic cells including B cells, T cells, neutrophils, macrophages and in neuronal and ganglion cells. Its expression is also observed in many types of cancer cells. Its expression is reported to be higher levels in progenitor cells and metabolically active cells compared to terminally differentiated cells. In B cells its expression is lost when primary B-cells are induced to differentiate in antibody-forming cells. Deficiency of CD24 can result in a reduction in late pre-B and immature B-cell populations in the bone marrow. CD24 is extensively used as a marker for the differentiation of hematopoietic and neuronal cells. As a glycosyl phosphatidylinositol-anchor molecule, it mediates signal transduction by recruiting Src family protein tyrosine kinases via membrane rafts and also activates the mitogen-activated protein kinase pathway. CD24 is synthesized with a signal peptide (aa 1-26) and a propeptide (aa 60-80) that are cleaved off to produce the mature form (aa 27-59). Mutation is CD24 gene are linked to development of multiple sclerosis, a demyelinating disease of the central nervous system. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Fang, X., et al. (2010). Cell. Mol. Immunol. 7(2); 100-103).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit
Quality Level	200,
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	3N22, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 8.08 kDa, observed mol wt ~38 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, flow cytometry: suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
greener alternative category	Aligned,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

CD247 (cluster of differentiation 247), also known as T-cell receptor T3 zeta chain (CD3ξ), forms a part of the TCR (T-cell receptor)-CD3 complex. This gene is localized to human chromosome 1q22-q23 and is composed of eight exons. It is one of the four invariant subunits of TCR-CD3 complex.

Anti-CD247 antibody produced in rabbit

MDL number:	MFCD03454876
Human Protein Atlas Number:	HPA008750 Human Protein Atlas characterization data

T-cell surface glycoprotein CD3 zeta chain precursor recombinant protein epitope signature tag (PrEST)

Anti-CD247 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper),
Biochem/physiol Actions
CD247 (cluster of differentiation 247), also known as T-cell receptor T3 zeta chain (CD), plays an essential role in the organization, surface expression and signaling pathway of T-cell receptor (TCR)-CD3 complex. Any aberrations in these processes result in T-cell dysfunction and autoimmune disorder. Polymorphisms in this gene are linked to systemic lupus erythematosus. Variants in this gene are also linked to susceptibility to rheumatoid arthritis. In chronic hepatitis C patients, myeloid-derived suppressor cells (MDSCs) lead to persistence of viral infection and suppression of CD247 expression on CD8+ T-cells. Thus, MDSCs lead to dysfunction of T-cells mediated through CD247. Polymorphisms of this gene influence the response to hepatitis B vaccination, which in turn is determined by the BMI (body mass index).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70699,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP
conjugate	unconjugated
UniProt accession no.	P20963,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD247(919)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD248 antibody produced in rabbit

HPA051856 Human Protein Atlas characterization data

CD248 molecule, endosialin recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper),
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST85750,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH
conjugate	unconjugated
UniProt accession no.	Q9HCU0,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD248(57124)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 1K6 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects IL-2 receptor subunit alpha (CD25). It targets an epitope within 119 amino acids from the N-terminal region.

Anti-CD25 (IL2-RA) Antibody, clone 1K6 ZooMAb® Rabbit Monoclonal

GST/His-tagged recombinant fragment corresponding to 119 amino acids from the N-terminal, extracellular domain of human IL-2 receptor subunit alpha (CD25).

Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD25 (IL2-RA) in human lymph node tissue lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD25 (IL2-RA) in human tonsil tissue sections.
Flow Cytometry Analysis: 1µg from a representative lot detected CD25 (IL2-RA) in one million human peripheral blood mononuclear cells (PBMC).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user.
Anti-CD25 (IL2-RA), clone 1K6 ZooMAb, Cat. No. ZRB1412, is a recombinant Rabbit monoclonal antibody that targets CD25 (IL2-RA) and is tested for use in Flow Cytometry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Interleukin-2 receptor subunit alpha (UniProt: P01589; also known as IL-2 receptor subunit alpha, IL-2-RA, IL-2R subunit alpha, IL2-RA, TAC antigen, p55, CD25) is encoded by the IL2RA gene (Gene ID: 3559) in human. IL-2-RA is a non-covalent dimer of an alpha (CD25), beta unit (CD122). IL-2-RA is involved in the regulation of immune tolerance and controls the activity of T cells. IL-2RA can exist in three different forms; a high affinity dimer, an intermediate affinity monomer of beta subunit, and a low affinity monomer of alpha subunit. The high and intermediate affinity forms can also associate with a gamma subunit (CD132). CD25 is rapidly up-regulated upon activation of T cells. Activated T cells, regulatory T cells (Tregs) and NK cells express high levels of CD25, and high affinity expression of IL-2-RA is largely limited to these cells. CD25 is a single-pass type I membrane protein that is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off to produce the mature form that contains an extracellular domain (aa 22-240), a transmembrane domain (aa 241-250), and a short cytoplasmic tail (aa 260-272). It also contains two Sushi domains (aa 22-84 and 123-186). Mutations in IL2RA gene have been linked to insulin-dependent diabetes mellitus and immunodeficiency with lymphoproliferation that leads to recurrent viral, fungal, and bacterial infections. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. Ref.: (Driesen, J., et al. (2008). Immunobiology 213(9-10); 849-858).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
0.3 mg/mL after reconstitution at 25μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommended storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 30.82 kDa, observed mol wt ~35 kDa
species reactivity	mouse, human
packaging	pkg of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	flow cytometry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
greener alternative category	Aligned,
shipped in	ambient
storage temp.	2-8°C

Anti-CD27 antibody produced in rabbit

HPA038936 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87323,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:1000-1:2500
immunogen sequence	HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR
conjugate	unconjugated
UniProt accession no.	P26842,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD27(939)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD276 antibody produced in rabbit

HPA009285 Human Protein Atlas characterization data

CD276 (cluster of differentiation 276) is a member of the B7 family of T cell co-regulatory molecules, which functions as an immune-regulatory molecule. This protein is inducible by inflammatory cytokines on T-cells, B-cells and dendritic cells. Its ligand is yet unidentified.

CD276 antigen precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD276 (cluster of differentiation 276) functions as both T-cell stimulatory and inhibitory protein in tumor cells, and hence, its function in tumors is not very clear. In CRC (colorectal cancer), the expression of this protein has a strong and independent relation with poor prognosis. The expression of this protein is highly increased in endothelial cells (ECs) in cancer as opposed to that in normal tissue. Also, the number of circulating ECs is increased in tumor conditions as compared to normal conditions. CD276 is also up-regulated in glioblastomas, breast, lung, renal and colon carcinomas. It is a putative biomarker for rheumatoid arthritis (RA), and B7-H3-T-A-C-T polymorphism is linked to increased RA risk. This variant might also be linked to the secretion of soluble B7-H3. CD276 promotes tumorigenesis of mantle cell lymphoma, and its inactivation leads to increased sensitivity to chemotherapy.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71718,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
conjugate	unconjugated
UniProt accession no.	Q5ZPR3,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD276(80381)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD28 antibody produced in rabbit

HPA070003 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST92904,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:50- 1:200
immunogen sequence	RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
conjugate	unconjugated
UniProt accession no.	P10747,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD28(940)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 2N15 is a ZooMAb® Rabbit recombinant monoclonal antibody that specifically detects CD28. It targets an epitope within 15 amino acids from the extracellular domain.

Anti-CD28 Antibody, clone 2N15 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 15 amino acids from the extracellular domain of human CD28.

Anti-CD28, clone 2N15 ZooMAb®, Cat. No. ZRB1298, is a recombinant Rabbit monoclonal antibody that detects CD28 and is tested for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in Human tonsil tissue lsyate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected CD28 in Human tonsil tissue lysate.
Tested applications
Immunocytochemistry Analysis: A 1:40 dilution from a representative lot detected CD28 in Jurkat cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD28 in human tonsil tissue sections.
Flow Cytometry Analysis: 1 µg from a representative lot detected CD28 in one million human peripheral blood mononuclear cells (PBMC).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
T-cell-specific surface glycoprotein CD28 (UniProt: P10747; also known as TP44, CD28) is encoded by the CD28 gene (Gene ID: 940) in human. CD28 is a single-pass type I membrane glycoprotein that is synthesized with a signal peptide (aa 1-18), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 19-152), a transmembrane domain (aa 152-179), and a cytoplasmic domain (aa 180-220). It is mainly expressed on T lineage cells, including thymocytes, but may also be found on plasmablasts. It is reported to be constitutively expressed on both resting and activated T cells, on almost all CD4+ and on at least half of CD8+ T cells in humans. It is involved in T cell activation, proliferation, survival, and cytokine production. It reduces the threshold of TCR triggering required for T cell activation. CD28 signaling transduces a positive signal that promotes proliferation of TCR-stimulated T cells. It is shown to cause the initial activation of nave CD4 T cells by increasing the sensitivity of T cells to antigen receptor engagement. It also enhances the production of IL-4 and IL-10 in T-cells in conjunction with TCR/CD3 ligation and CD40L co-stimulation. Upon activation of mature T cells, either by mitogens or by cross-linking of the TCR, the expression of CD28 is shown to increase. Ligation of CD3 and CD28 (CD3/28 co-stimulation) is shown to promote increase in glucose metabolism, increased cytokine/chemokine expression, elevate IL-2 production, and induce resistance to apoptosis. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Riley, JL., and June, CH. (2005). Blood. 105(1); 13-21).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
1.2 mg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

expressed in HEK 293 cells

antibody form

purified antibody

antibody product type

primary antibodies

clone

2N15, recombinant monoclonal

description

recombinant, expressed in HEK 293 cells

calculated mol wt 25.07 kDa","observed mol wt ~40 kDa

species reactivity (predicted by homology)

bovine, monkey, rat

packaging

antibody small pack of 25 µL

enhanced validation

recombinant expression

application(s)

flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable

Anti-CD2AP antibody produced in rabbit

HPA003326 Human Protein Atlas characterization data

CD2-associated protein recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD2AP (CD2-associated protein) gene encodes a protein that forms a component of the filtration complex in the kidney and its haploinsufficiency serves as a determinant of human susceptibility to glomerular disease. The protein is an adaptor molecule that mediates T cell receptor signaling and podocyte homeostasis. It inhibits TGF-β-induced apoptosis in podocytes. It may function as a direct adaptor between the actin cytoskeleton and cell membrane proteins, such as ephrin and polycystin-2, and regulate the actin cytoskeleton.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST85224,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	rat, mouse, human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq independent
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	VDFDSLTVRTSKETDVVNFDDIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTCYSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDHGKEL
conjugate	unconjugated
UniProt accession no.	Q9Y5K6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD2AP(23607)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD2BP2 antibody produced in rabbit

HPA061309 Human Protein Atlas characterization data

CD2 (cytoplasmic tail) binding protein 2

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88443,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
isotype	IgG
immunogen sequence	MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEE
conjugate	unconjugated
UniProt accession no.	O95400,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD2BP2(10421)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD300C antibody produced in rabbit

HPA014523 Human Protein Atlas characterization data

CD300C (CD300c molecule) is a membrane receptor belonging to the IgV-like glycoprotein family called CD300. This family includes activating members namely, CD300b, CD300c, CD300d and CD300e, and inhibitory members namely, CD300a and CD300f. CD300C is exclusively expressed by monocytes and leukocytes, and was the first member of this family to be identified. Its transmembrane domain contains a negatively charged amino acid, and it has a short cytosolic region. This gene is localised to human chromosome 17, spans ~4.5kb, and has four exons. The signal peptide and the 5′-untranslated region is coded by exon1, the Ig (immunoglobulin)-like domain by exon2, exon 3 encodes for the region proximal to membrane and exon 4 codes for the transmembrane region.

CMRF35-like molecule 6 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD300C (CD300c molecule) plays an important role in inflammation, where it co-stimulates with LPS (lipopolysaccharide), the production of pro-inflammatory cytokines. It is also responsible for the mobilization of intracellular Ca2+ and activation of CD88 molecule. It is responsible for the activation of monocytes and mast cells, through Fc receptor-. It is involved in the regulation of TCR (T-cell receptor) mediated signaling, and is expressed differentially on TH (T-helper)-1 (IFN- producing) cells and TH17 (IL-17a producing) cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72959,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
conjugate	unconjugated
UniProt accession no.	Q08708,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD300C(10871)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD300E antibody produced in rabbit

HPA015570 Human Protein Atlas characterization data

CMRF35-like molecule 2 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD300e molecule (also known as IREM-2) is mapped to chromosome 17q25.1. It encodes for a 205 amino acid that contains an extracellular region comprising an Ig-like domain and a transmembrane region with a positively charged amino acid residue (lysine). It is a novel activating receptor of the Ig-superfamily in the monocytic lineage. This protein functions as an activating receptor capable of regulating the innate immune response in myeloid cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72373,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	TVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFR
conjugate	unconjugated
UniProt accession no.	Q496F6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD300E(342510)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 4E20 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects human Platelet endothelial cell adhesion molecule (PECAM-1). It targets an epitope within the cytoplasmic domain from the C-terminal region.

Anti-CD31 Antibody, clone 4E20 , ZooMAb® Rabbit Monoclonal

GST/His-tagged recombinant fragment corresponding to 85 amino acids from the C-terminal, cytoplasmic domain of human Platelet endothelial cell adhesion molecule (CD31; PECAM-1).

Anti-CD31, clone 4E20 ZooMAb, Cat. No. ZRB1216, is a highly specific rabbit recombinant monoclonal antibody that targets Platelet endothelial cell adhesion molecule (CD31 / PECAM-1) and has been tested for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD31 in THP1, HL60, and Jurkat cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:10,000 dilution from a representative lot detected CD31 in human tonsil tissue sections.
Flow Cytometry Analysis: 0.2 µg/mL from a representative lot detected CD31 in THP-1 cells.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD31 in THP-1 cell line.
Note: Actual optimal working dilutions must be determined by end user as specimens and experimental conditions may vary.
Target description
Platelet endothelial cell adhesion molecule (UniProt: P16284; also known as PECAM-1, EndoCAM. GPIIA′, PECA1, CD31) is encoded by the PECAM1 gene (Gene ID: 5175) in human. PECAM-1 is a single-pass type I membrane protein that is synthesized with a signal peptide (aa 1-27) that is subsequently cleaved to generate the mature protein with a large extracellular region (aa 28-601) that contains six Ig-like C2-type domains, followed by a transmembrane segment (aa 602-620) and a cytoplasmic tail (aa. 621-738 of isoform Long) that plays an essential role in PECAM-1-mediated cellular signaling. It contains six Ig-like C2-type domains and Ig-like C2-type domains 2 and 3 contribute to formation of the complex with BDKRB2 and in regulation of its activity. PECAM-1 is essential for leukocyte transendothelial migration (TEM) under most inflammatory conditions. It is expressed on platelets and leukocytes and is primarily concentrated at the borders between endothelial cells. Six isoforms of PECAM-1 have been described that are produced by alternative splicing. Isoform Long predominates in all tissues examined, whereas Delta 12 isoform is detected only in trachea and isoform Delta14-15 are only detected in lung tissue. Isoform Delta14 is detected in all tissues examined with the strongest expression in heart. Isoform Delta15 is expressed in brain, testis, ovary, cell surface of platelets, human umbilical vein endothelial cells (HUVECs), Jurkat T-cell leukemia, human erythroleukemia and U-937 histiocytic lymphoma cell lines. Tyrosine 690 residue plays a critical role in TEM and is required for efficient trafficking of PECAM-1 to and from the lateral border recycling compartment (LBRC) and is also required for the LBRC membrane to be targeted around migrating leukocytes. PECAM-1 also prevents phagocyte ingestion of closely apposed viable cells by transmitting ′detachment′ signals, and changes function on apoptosis, promoting tethering of dying cells to phagocytes. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	4E20, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 82.52 kDa, observed mol wt 130 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	flow cytometry: suitable, immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
greener alternative category	Aligned,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD33 antibody produced in rabbit

HPA035832 Human Protein Atlas characterization data

Myeloid cell surface antigen CD33 (cluster of differentiation 33), also known as SIGLEC3 (sialic acid binding Ig-like lectins) and GP67, belongs to the CD33-related SIGLEC gene family. It is a type 1 transmembrane protein and has two immunoglobulin-like extracellular domains, a single transmembrane area and two intracellular inhibitory motifs. The CD33 gene is located on human chromosome 19q13.

CD33 molecule

Anti-CD33 antibody has been used in immunohistochemical staining.
Biochem/physiol Actions
CD33 (cluster of differentiation 33) is mainly involved in anti-inflammatory signaling, cell adhesion and endocytosis functions. CD33 serves as a myeloid differentiation marker. Mutations in the CD33 gene are associated with Alzheimers disease susceptibility and acute myeloid leukemia treatment efficacy.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71736,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-1:500
immunogen sequence	KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P20138,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD33(945)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD34 antibody produced in rabbit

HPA036722 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87199,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-1:500
immunogen sequence	ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P28906,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD34(947)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 5C15 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Hematopoietic progenitor cell antigen CD34. It targets an epitope within 15 amino acids from the C-terminal region.

Anti-CD34 Antibody, clone 5C15 , ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal region of human Hematopoietic progenitor cell antigen CD34.

Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD34 in human kidney tissue lysaste.
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected CD34 in human kidney and rat kidney tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD34 in PC3 cell line.
Note: Actual optimal working dilutions must be determined by the end user as specimens and experimental conditions may vary.
Anti-CD34, clone 5C15 ZooMAb, Cat. No. ZRB1232, is a recombinant Rabbit monoclonal antibody that specifically targets CD34 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Hematopoietic progenitor cell antigen CD34 (UniProt: P28906; also known as CD34) is encoded by the CD34 gene (Gene ID: 947) in human. CD34 is a highly glycosylated single-pass type I membrane protein that is selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. It is predominantly regarded as a marker of hematopoietic stem cells and hematopoietic progenitor cells. L-Selectin (CD62L) is the most commonly described ligand for CD34. CD34 serves as an adhesion molecule that plays a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. It is also reported to act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Under normal conditions, CD34+ expressing cells account for about 1 to 2% of the total bone marrow cells. CD34 is synthesized with a signal peptide (aa 1-31), which is subsequently cleaved off to produce the mature form. The mature form contains an extracellular domain (aa 32-290), a transmembrane domain (aa 291-311), and cytoplasmic domain (312-385). The extracellular domain that is heavily sialylated and O-linked glycosylated and contains some N-linked glycosylation sites. Two isoforms of CD34 have been described that are produced by alternative splicing. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Sidney, LE et al. (2014). Stem Cells. 32(6); 1380-1389).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

CD36 is a major platelet membrane glycoprotein IV.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	5C15, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 40.72 kDa, observed mol wt ~110 kDa
species reactivity	rat, human
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
greener alternative category	Aligned,
shipped in	ambient
storage temp.	2-8°C

Anti-CD36 antibody produced in rabbit

MDL number:	MFCD00164626
Human Protein Atlas Number:	HPA002018 Human Protein Atlas characterization data

Platelet glycoprotein 4 recombinant protein epitope signature tag (PrEST)

Anti-CD36 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD36 is regulated by Csk homologous kinase (Chk), a tyrosine kinase, in thrombin stimulated platelets. CD36 interacts with fibrinogen-liganded integrin aIIbβ3 (GP IIb/IIIa) to stabilize aggregation and activation of platelet. During platelet activation, it identifies and binds to the quaternary (polymeric) structure of collagen.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77481,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:50-1:200
immunogen sequence	VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL
conjugate	unconjugated
UniProt accession no.	P16671,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD36(948)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD37 antibody produced in rabbit

HPA032120 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78600,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	PCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN
conjugate	unconjugated
UniProt accession no.	P11049,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD37(951)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD38 antibody produced in rabbit

HPA052381 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87611,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:1000-1:2500
immunogen sequence	GTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P28907,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD38(952)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Clone 1H2 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects human T-cell surface glycoprotein CD3 delta chain (CD3d). It targets an epitope within 15 amino acids from the extracellular domain.

Anti-CD3d Antibody, clone 1H2 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 15 amino acids from the extracellular domain of human T-cell surface glycoprotein CD3 delta chain (CD3d).

Anti-CD3d, clone 1H2 ZooMAb®, Cat. No. ZRB1295, is a recombinant Rabbit monoclonal antibody that specifically targets CD3d and is tested for use in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in Jurkat cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected CD3d in Jurkat cell lysate.
Tested applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD3d in Hut78 and MOLT-4 cell lysates.
Affinity Binding Assay: A representative lot of this antibody bound CD3d peptide with a KD of 1.0 x 10-12 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD3d in Jurkat cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD3d in human spleen and human tonsil tissue sections.
Flow Cytometry Analysis: 1 µg from a representative lot detected CD3d in one million Jurkat cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
T-cell surface glycoprotein CD3 delta chain (UniProt: P04234; also known as T-cell receptor T3 delta chain, CD3d) is encoded by the CD3D (also known as T3D) gene (Gene ID: 915) in human. CD3d is a single-pass type I membrane protein that is part of the TCR-CD3 complex present on T-lymphocyte cell surface. It plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. ITAM domain of CD3d is localized to amino acids 138-166. Upon TCR engagement, these motifs are phosphorylated by LCK and FYN resulting in the activation of downstream signaling pathways. CD3d is also reported to be involved in thymocyte differentiation and in the absence of a functional TCR-CD3 complex, thymocytes do not differentiate properly. CD3d also interacts with CD4 and CD8 to establish a functional link between the TCR and coreceptors CD4 and CD8, which is shown to be essential for activation and positive selection of CD4 or CD8 T-cells. CD3d is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 106-126), a transmembrane domain (aa 106-126), and a cytoplasmic domain (aa 127-171). Mutations in CD3D gene are known to cause Immunodeficiency 19 that is characterized by onset in early infancy of recurrent bacterial, viral, and fungal infections. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

Quality Level	200
biological source	rabbit
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	1H2, recombinant monoclonal
description	recombinant, expressed in HEK 293 cells
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 18.93 kDa","observed mol wt ~24 kDa
species reactivity	human
species reactivity (predicted by homology)	monkey
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	affinity binding assay: suitable","flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable
isotype	IgG
epitope sequence	Extracellular domain
conjugate	unconjugated
Protein ID accession no.	NP_000723,
UniProt accession no.	P04234,
shipped in	ambient
storage temp.	2-8°C

Anti-CD3E antibody produced in rabbit

HPA043955 Human Protein Atlas characterization data

CD3e molecule, epsilon (CD3-TCR complex)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87429,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
conjugate	unconjugated
UniProt accession no.	P07766,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD3E(916)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Clone 1H4 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects CD3e. It targets an epitope within 13 amino acids from the C-terminal, cytoplasmic domain.

Anti-CD3e Antibody, clone 1H4, ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 13 amino acids from the C-terminal region of human T-cell surface glycoprotein CD3 epsilon chain (CD3e).

Flow Cytometry Analysis: 0.01 µg from a representative lot detected CD3e in Jurkat cell line.
Immunohistochemistry (Paraffin) Analysis: A 1:40 dilution from a representative lot detected CD3e in human tonsil tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD3e in Jurkat cell line.
Immunofluorescence Analysis: A 1:40 dilution from a representative lot detected CD3e in human tonsil tissue sections.
Anti-CD3e, clone 1H4 ZooMAb, Cat. No. ZRB1011, is a recombinant Rabbit Monoclonal Antibody that specifically targets of CD3e T-cell surface glycoprotein and has been tested for use in Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
T-cell surface glycoprotein CD3 epsilon chain (UniProt P07766; also known as CD3-epsilon, CD3e, T-cell surface antigen T3/Leu-4 epsilon chain) is encoded by the CD3E (also known as T3E) gene (Gene ID 916) in human. The T cell receptor or TCR is a plasma membrane protein complex responsible for recognizing antigens bound to major histocompatibility complex (MHC) on antigen presenting cells. In 95% of T cells, the TCR is composed of a disulfide-linked alpha and beta dimer, while among 5% of T cells the TCR is composed of a gamma and a delta dimer. T cells are activated when their surface TCRs engage with antigen/MHC complex on antigen presenting cells. Each TCR alpha and beta chain contains a variable (V) and a constant (C) extracellular immunoglobulin-like domain, followed by a transmembrane region and a short cytoplasmic tail. The alpha and beta chains have very short cytoplasmic tail and rely on the CD3 (cluster of differentiation 3) co-receptor complex for transducing signaling further intracellularly. The CD3 co-receptor complex is composed of a CD3 chain, a CD3 chain, and two CD3 chains. The CD3 complex, TCR dimer, and a -chain together comprise the functional TCR complex. The CD3 epsilon chain is initially produced with a signal peptide (aa 1-22), the removal of which yields the mature chain (aa. 23-207) with an Ig-like (aa 32-112) domain-containing extracellular region (aa 23-126), a transmembrane segment (aa 127-152), and a cytoplasmic tail (aa 153-207), which contains the immunoreceptor tyrosine-based activation motif or ITAM (a.a. 178-205) that is essential for mediating ZAP-70 interaction and transducing TCR signaling. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
120 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	1H4, monoclonal","recombinant monoclonal
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 21.39 kDa","observed mol wt ~21 kDa
species reactivity	human
species reactivity (predicted by homology)	monkey
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency.
enhanced validation	recombinant expression
application(s)	flow cytometry: 1:40-1:100","immunocytochemistry: suitable using 1:100","immunofluorescence: 1:40-1:100","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable using 1:1,000
isotype	IgG
conjugate	unconjugated
UniProt accession no.	P07766,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... CD3E;T3E(916)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD3EAP antibody produced in rabbit

HPA041664 Human Protein Atlas characterization data

CD3e molecule, epsilon associated protein recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST82585,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000","western blot: 0.04-0.4 µg/mL
immunogen sequence	KRKRQKGTEGMEPEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMAMMEPGTEAMEPVEPEMKPLESPGGTMAPQQPEGA
conjugate	unconjugated
UniProt accession no.	O15446,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD3EAP(10849)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD3G antibody produced in rabbit

HPA038494 Human Protein Atlas characterization data

CD3g molecule, gamma (CD3-TCR complex)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST80656,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
conjugate	unconjugated
UniProt accession no.	P09693,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD3G(917)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

CD4, a glycoprotein, is predominantly expressed on the cell membrane of mature, thymus-derived (T) lymphocyte and also to some extent in the monocyte/macrophage lineage. It has a transmembrane domain, cytoplasmic region and an extracellular region of four tandem domain similar to members of Ig (immunoglobin) superfamily.

Anti-CD4 antibody produced in rabbit HPA004252-100UL

MDL number:	MFCD00211777
Human Protein Atlas Number:	HPA004252 Human Protein Atlas characterization data

General description

T-cell surface glycoprotein CD4 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD4 (cluster of differentiation 4) interacts with the CD4+ T cells with antigen-presenting cells or with target cells by binding to the major histocompatibility complex (MHC) class II molecules. Interaction with MHC-II molecules increases the cytokine expression and the differentiation of human monocytes into functional mature macrophages. Further, it effects human immunodeficiency virus (HIV) binding and subsequent infection. Thus, it proves an important role in HIV as the primary receptor.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86770,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	RASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWS
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P01730,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD4(920)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 2G19 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects CD4. It targets an epitope within 18 amino acids from the N-terminal, extracellular domain.

Anti-CD4 Antibody, clone 2G19 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 18 amino acids from the N-terminal, extracellular domain of human CD4.

Quality Control Testing
Evaluated by Western Blotting in HL-60 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected CD4 in HL-60 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD4 in THP-1 cell lysate.
Flow Cytometry Analysis: 0.1 µg from a representative lot detected CD4 in one million THP-1 cells.
Affinity Binding Assay: A representative lot of this antibody bound CD4 peptides with a KD of 4.5 x 10-8 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD4 in human spleen and human colon tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD4 in THP-1 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-CD4, clone 2G19 ZooMAb®, Cat. No. ZRB1759, is a recombinant Rabbit monoclonal antibody that targets CD4 and has been tested in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
T-cell surface glycoprotein CD4 (UniProt: P01730; also known as T-cell surface antigen T4/Leu-3, CD4) is encoded by the CD4 gene (Gene ID: 920) in human. CD4 is a single-pass type I membrane glycoprotein that is highly expressed in T-helper cells and is also found in macrophages, dendritic cells, and NK cells. CD4 is synthesized with a signal peptide (a 1-25), which is subsequently cleaved off to generate the mature form that has an extracellular domain (aa 26-396), a transmembrane domain (aa 397-418), and a cytoplasmic domain (aa 419-458). It has three Ig-like C2-type and one Ig-like V-type domain. CD4 plays an essential role in the immune response and serves multiple functions in response against both external and internal offenses. In T-cells, it functions primarily as a coreceptor for MHC class II molecule:peptide complex. It interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells and recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. The LCK can then initiate different intracellular signaling events by phosphorylating various substrates, which lead to lymphokine production, motility, adhesion and activation of T-helper cells. CD4 is also reported to participates in the development of T-helper cells in the thymus and trigger the differentiation of monocytes into functional mature macrophages. CD4 also serves a primary receptor for human immunodeficiency virus-1 (HIV-1). It is removed from plasma membrane by Nef protein of HIV-1, which increases clathrin-dependent endocytosis and lysosomal degradation of CD4. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit
Quality Level	200,
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	2G19, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt ~ 51.11 kDa, observed mol wt ~ 51 kDa
species reactivity	human
species reactivity (predicted by homology)	monkey
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, flow cytometry: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD40 antibody produced in rabbit

HPA031567 Human Protein Atlas characterization data

CD40 molecule, TNF receptor superfamily member 5

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78053,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-1:500
immunogen sequence	KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
conjugate	unconjugated
UniProt accession no.	P25942,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD40(958)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD40LG antibody produced in rabbit HPA045827-100UL

HPA045827 Human Protein Atlas characterization data

CD40 ligand recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78058,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	LTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVS
conjugate	unconjugated
UniProt accession no.	P29965,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD40LG(959)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

The CD44 (cell-surface glycoprotein) gene encodes a transmembrane glycoprotein and has 20 exons. It is mapped to human chromosome 11p13.

Anti-CD44 antibody produced in rabbit

MDL number:	MFCD00164629
Human Protein Atlas Number:	HPA005785 Human Protein Atlas characterization data

CD44 antigen precursor recombinant protein epitope signature tag (PrEST)

Anti-CD44 antibody produced in rabbit has been used:

in immunohistochemistry
in western blotting
in immunofluorescence staining to characterize the immunophenotype of the mammospheres

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Overexpression of CD44 (cell-surface glycoprotein) leads to esophageal squamous cell carcinoma (ESCC). It is involved in cell-cell and cell-extracellular matrix interactions. It plays an important role in lymphocyte homing and lymphocyte activation.
CD44 is a hyaluronic acid receptor that regulates cell repair, adhesion and inflammation. This protein has been implicated in cancer aggressiveness, metastasis and growth. Thus, CD44 is used as a cell-surface marker for several cancers . Anti-CD44 antibody is specific for CD44 in humans.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83079,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500
immunogen sequence	DDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPR
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P16070,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CD44(960)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-CD45 antibody produced in rabbit

HPA000440 Human Protein Atlas characterization data

protein tyrosine phosphatase, receptor type C recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79682,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:500-1:1000
immunogen sequence	KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	P08575,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... PTPRC(5788)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 5L3 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects CD45. It targets an epitope within 16 amino acids from the C-terminal half, cytoplasmic domain.

Anti-CD45 Antibody, clone 5L3, ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 16 amino acids from the C-terminal, cytoplasmic domain of human CD45.

Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD45 in rat spleen and human tonsil tissue lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD45 in human tonsil and mouse spleen tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD45 in Jurkat cells.
Note: Actual optimal working dilutions must be determined by the end user as specimens and experimental conditions may vary.
Anti-CD45, clone 5L3 ZooMAb , Cat. No. ZRB1180, is a highly specific recombinant rabbit monoclonal antibody that detects CD45 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Receptor-type tyrosine-protein phosphatase C (UniProt: P08575; also known as EC:3.1.3.48, Leukocyte common antigen, L-CA, T200, CD45) is encoded by the PTPRC (also known as CD45) gene (Gene ID: 5788) in human. CD45 is a single-pass type I membrane protein with tyrosine phosphatase activity. CD45 has been shown to be essential for antigen-induced signaling in T-cells and B-cells. It acts as a positive regulator of T-cell coactivation upon binding to DPP4. It is synthesized with a signal peptide (aa 1-25), which is subsequently cleaved off to generate the mature form that has a extracellular domain (aa 26-577), a short transmembrane domain (aa 578-598), and a cytoplasmic domain (aa 599-1306). CD45 contains two protein tyrosine phosphatase (PTPase) domains (aa 653-912 and 944-1228) and the first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. It also contains 2 fibronectin type-III domains (aa 391-483 and 484-576). Upon T-cell activation, it recruits and dephosphorylates SKAP1 and FYN. It also dephosphorylates LYN, and thereby modulates its activity. CD45 is expressed at high levels on all hematopoietic cells, however, higher density expression occurs on lymphocytes where about 10% of the surface area may be CD45. Eight isoforms of CD45 have been described that are produced by alternative splicing. However, only isoforms 1,2,3,5, and 7 are detected in thymocytes. Mutations in PTPRC gene have been associated with Multiple Sclerosis. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	5L3, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 61.01 kDa, observed mol wt ~200 kDa
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable (peptide)
isotype	IgG
conjugate	unconjugated
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable