Prestige Antibodies®
- Сортировать:
- Вид таблицей
-
Anti-AKT2 antibody produced in rabbit
Human Protein Atlas Number: HPA064521 Human Protein Atlas characterization data
Кат. номер HPA064521-100UL HPA064521-25UL Immunogenv-akt murine thymoma viral oncogene homolog 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST90086,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL immunogen sequence HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND conjugate unconjugated UniProt accession no. P31751, shipped in wet ice storage temp. 20°C Gene Information human ... AKT2(208)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-AKT3 antibody produced in rabbit
MDL number: MFCD01633021 Human Protein Atlas Number: HPA026441 Human Protein Atlas characterization data
Кат. номер HPA026441-100UL HPA026441-25UL General descriptionAKT serine/threonine kinase 3 (AKT3) is part of the protein kinase B family. It has a kinase domain, a pleckstrin homology domain and a regulatory domain. The protein consists of 479 amino acids and the gene encoding it is localized on human chromosome 1q44.ImmunogenRAC-gamma serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
AKT serine/threonine kinase 3 (AKT3) has a role in DNA repair and brain development. In mouse model, it modulates the expression of estrogen receptor α, Erb-B2 receptor tyrosine kinase 2 and Erb-B2 receptor tyrosine kinase 3 in breast cancer cells. AKT3 has been shown to stimulate the growth of triple-negative breast cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77824,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL conjugate unconjugated UniProt accession no. Q9Y243, shipped in wet ice storage temp. 20°C Gene Information human ... AKT3(10000)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-AKTIP antibody produced in rabbit
Human Protein Atlas Number: HPA046300 Human Protein Atlas characterization data
Кат. номер HPA046300-100UL HPA046300-25UL ImmunogenAKT interacting protein recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82287,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, rat, mouse packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK conjugate unconjugated UniProt accession no. Q9H8T0, shipped in wet ice storage temp. 20°C Gene Information human ... AKTIP(64400)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-AL592183.1 antibody produced in rabbit
Human Protein Atlas Number: HPA049380 Human Protein Atlas characterization data
Кат. номер HPA049380-100UL HPA049380-25UL ImmunogenNo description available in EnsemblApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84735,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence LQETLLDSLGYEHRWKRWLLYWIKDMSRD conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... AL592183.1(100134091)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALAS2 antibody produced in rabbit
Human Protein Atlas Number: HPA001638 Human Protein Atlas characterization data
Кат. номер HPA001638-100UL HPA001638-25UL Immunogen5-Aminolevulinate synthase, erythroid-specific, mitochondrial precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
δ-Aminolevulinate synthase 2 (also known as ALAS2) is a protein encoded by the ALAS2 gene in humans and is mapped to X chromosome between Xp21.1--q21. It is an aminolevulinic acid synthase and catalyzes the first committed step of heme biosynthesis. The gene is the rate-limiting enzyme for heme biosynthesis in erythroid cells and a missense mutation of this gene is associated with congenital sideroblastic anemia.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74295,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS conjugate unconjugated UniProt accession no. P22557, shipped in wet ice storage temp. 20°C Gene Information human ... ALAS2(212)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH16A1 antibody produced in rabbit
Human Protein Atlas Number: HPA059488 Human Protein Atlas characterization data
Кат. номер HPA059488-100UL HPA059488-25UL Immunogenaldehyde dehydrogenase 16 family, member A1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82750,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence ESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVE conjugate unconjugated UniProt accession no. Q8IZ83, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH16A1(126133)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH18A1 antibody produced in rabbit
Human Protein Atlas Number: HPA012604 Human Protein Atlas characterization data
Кат. номер HPA012604-100UL HPA012604-25UL General descriptionAldehyde dehydrogenase 18 family member A1 (ALDH18A1) is localized to the mitochondrial inner membrane. It is an ATP- and NADPH-dependent bifunctional enzyme. The gene encoding this protein is present on chromosome 10.ImmunogenDelta-1-pyrroline-5-carboxylate synthetase recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Aldehyde dehydrogenase 18 family member A1 (ALDH18A1) catalyzes the reduction of glutamate to 1-pyrroline-5-carboxylate which is a critical step in the de-novo biosynthesis of proline, arginine and ornithine. It is a bifunctional enzyme having both -glutamyl kinase (-GK) and -glutamyl phosphate reductase (-GPR) activities. The enzyme undergoes alternative splicing to give rise to two isoforms which differ by a two-amino acid insert at the N-terminus of the -glutamyl kinase active site. The short isoform is highly active in the gut and it takes part in arginine biosynthesis. The long isoform is involved in the synthesis of proline from glutamate and is expressed in many tissues.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71373,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, mouse, human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD conjugate unconjugated UniProt accession no. P54886, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH18A1(5832)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-ALDH1A3 antibody produced in rabbit
Human Protein Atlas Number: HPA064749 Human Protein Atlas characterization data
Кат. номер HPA064749-100UL HPA064749-25UL Immunogenaldehyde dehydrogenase 1 family, member A3ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST92494,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF conjugate unconjugated UniProt accession no. P47895, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH1A3(220)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH1B1 antibody produced in rabbit
Human Protein Atlas Number: HPA021037 Human Protein Atlas characterization data
Кат. номер HPA021037-100UL HPA021037-25UL General descriptionThe gene ALDH1B1 (aldehyde dehydrogenase family 1 member B1) is mapped to human chromosome 9p11.1. It belongs to ALDH superfamily of enzymes. The protein localizes in the mitochondria. ALDH1B1 is expressed in liver, stomach and small intestine. The protein exists as a homotetramer.ImmunogenAldehyde dehydrogenase X, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
ALDH1B1 (aldehyde dehydrogenase family 1 member B1) is mainly responsible for metabolism of acetaldehyde and lipid peroxidation products. It also takes part in ethanol detoxification pathway. ALDH1B1 is linked with development of coronary artery disease. Single nucleotide polymorphism in ALDH1B1 is associated with drinking patterns in humans. It is up-regulated in colonic adenocarcinoma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75290,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHV conjugate unconjugated UniProt accession no. P30837, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH1B1(219)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH1L2 antibody produced in rabbit
Human Protein Atlas Number: HPA059282 Human Protein Atlas characterization data
Кат. номер HPA059282-100UL HPA059282-25UL ImmunogenRecombinant protein corresponding to aldehyde dehydrogenase 1 family member L2
Sequence
KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL conjugate unconjugated UniProt accession no. Q3SY69, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH1L2(160428)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH2 antibody produced in rabbit HPA051065-100UL
Human Protein Atlas Number: HPA051065 Human Protein Atlas characterization data Immunogenaldehyde dehydrogenase 2 family (mitochondrial) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85385,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence LLSAAATQAVPAPNQQPEVFCNQI conjugate unconjugated UniProt accession no. P05091, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH2(217)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH3A2 antibody produced in rabbit
Human Protein Atlas Number: HPA014769 Human Protein Atlas characterization data
Кат. номер HPA014769-100UL HPA014769-25UL General descriptionALDH3A2 (aldehyde dehydrogenase 3 family, member A2) is a fatty aldehyde dehydrogenase, which has two alternatively spliced isoforms, differing at their C-termini. This gene is localized to human chromosome 17p11.2, spans 31kb, and contains 11 exons. The predominant isoform has 485 amino acids, and the other isoform has 508 amino acids. It also has three isoforms differing in their sizes, and the two longer transcripts are predominant in brain, heart, pancreas, and skeletal muscle. The shorter isoform is abundant in liver.ImmunogenFatty aldehyde dehydrogenase recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Anti-ALDH3A2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
ALDH3A2 (aldehyde dehydrogenase 3 family, member A2) is responsible for the oxidation of medium and long-chain fatty aldehydes, giving rise to carboxylic acids. It is a microsomal enzyme, and catalyzes the above reaction in an NAD (nicotinamide-adenine-dinucleotide)-dependent manner. It is also responsible for catalyzing the oxidation of fatty alcohols, and is a part of the fatty alcohol:NAD+ oxidoreductase (FAO) complex. Inactivation of this gene might lead to the accumulation of highly active lipids and fatty alcohols, eventually affecting the integrity of plasma membrane. Mutations in this gene lead to the autosomal recessive disorder called Sjogren-Larsson syndrome (SLS), which is characterized by mental retardation, ichthyosis, and spastic diplegia or tetraplegia.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71639,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE conjugate unconjugated UniProt accession no. P51648, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH3A2(224)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH3B1 antibody produced in rabbit
Human Protein Atlas Number: HPA038525 Human Protein Atlas characterization data
Кат. номер HPA038525-100UL HPA038525-25UL Immunogenaldehyde dehydrogenase 3 family, member B1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST80489,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence AAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPF conjugate unconjugated UniProt accession no. P43353, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH3B1(221)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDH9A1 antibody produced in rabbit
Human Protein Atlas Number: HPA010873 Human Protein Atlas characterization data
Кат. номер HPA010873-100UL HPA010873-25UL General descriptionALDH9A1 (aldehyde dehydrogenase 9 family, member A1) gene encodes an aldehyde dehydrogenase isozyme. This gene maps to human chromosome 1q22-q23, and spans 45kb consisting of 10 exons. It has an open reading frame of 1479bp. The encoded protein consists of 493 amino acids. This gene is highly expressed in skeletal muscle, kidney and adult liver, and has lower expression in lung, pancreas, heart and brain.Immunogen4-Trimethylaminobutyraldehyde dehydrogenase recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Anti-ALDH9A1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) is a cytoplasmic enzyme which is involved in the metabolism of aminoaldehydes. In liver, this enzyme catalyzes the synthesis of γ-Aminobutyric acid (GABA) from γ-aminobutyraldehyde. In brain, ALDH9A1 catalyzes dehydrogenation of aldehydes such as, betaine aldehyde, acetaldehyde, propionaldehyde along with that of γ-aminobutyraldehyde. This enzyme is also thought to be involved in the production of GABA from putrescine, either directly through diamine oxidase, or indirectly through acetylated putrescine via monoamine oxidase. Studies suggest that ALDH9A1 might be the predominant aldehyde dehydrogenase responsible for carnitine biosynthesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70697,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD conjugate unconjugated UniProt accession no. P49189, shipped in wet ice storage temp. 20°C Gene Information human ... ALDH9A1(223)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALDOA antibody produced in rabbit
Human Protein Atlas Number: HPA004177 Human Protein Atlas characterization data
Кат. номер HPA004177-100UL HPA004177-25UL General descriptionAldolase A, fructose-bisphosphate (ALDOA) is a ubiquitous glycolytic enzyme expressed in developing embryo and in adult muscle. It is involved in a wide range of cellular functions such as maintenance of striated muscle contraction, cell shape and mobility, actin filament organization and ATP biosynthetic process.ImmunogenFructose-bisphosphate aldolase A recombinant protein epitope signature tag (PrEST)ApplicationAnti-ALDOA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
In glycolysis, ALDOA catalyzes the reversible reaction of fructose-1,6-bisphosphate to glyceraldehydes-3-phosphate and dihydroxyacetone phosphate. High expression level of ALDOA is reported in various forms of malignant cancers, including human lung squamous, renal cell and hepatocellular carcinomas. ALDOA deficiency causes myopathy and hemolytic anemia.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85927,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence IVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL conjugate unconjugated UniProt accession no. P04075, shipped in wet ice storage temp. 20°C Gene Information human ... ALDOA(226)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG1 antibody produced in rabbit
Human Protein Atlas Number: HPA060392 Human Protein Atlas characterization data
Кат. номер HPA060392-100UL HPA060392-25UL ImmunogenALG1, chitobiosyldiphosphodolichol beta-mannosyltransferaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86256,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP conjugate unconjugated UniProt accession no. Q9BT22, shipped in wet ice storage temp. 20°C Gene Information human ... ALG1(56052)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG10 antibody produced in rabbit
Human Protein Atlas Number: HPA063387 Human Protein Atlas characterization data
Кат. номер HPA063387-100UL HPA063387-25UL ImmunogenALG10, alpha-1,2-glucosyltransferaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST90483,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence AHKYLLADNRHYTFYVWKRVFQRY conjugate unconjugated UniProt accession no. Q5BKT4, shipped in wet ice storage temp. 20°C Gene Information human ... ALG10(84920)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG10 antibody produced in rabbit HPA043329-100UL
Human Protein Atlas Number: HPA043329 Human Protein Atlas characterization data Immunogenasparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83237,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP conjugate unconjugated UniProt accession no. Q5BKT4, shipped in wet ice storage temp. 20°C Gene Information human ... ALG10(84920)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG11 antibody produced in rabbit
Human Protein Atlas Number: HPA047214 Human Protein Atlas characterization data
Кат. номер HPA047214-100UL HPA047214-25UL Immunogenasparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72881,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence DDELRVNQLRRLSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFEVTFLSSVEKLFK conjugate unconjugated UniProt accession no. Q2TAA5, shipped in wet ice storage temp. 20°C Gene Information human ... ALG11(440138)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG12 antibody produced in rabbit
Human Protein Atlas Number: HPA003076 Human Protein Atlas characterization data
Кат. номер HPA003076-100UL HPA003076-25UL ImmunogenALG12, alpha-1,6-mannosyltransferaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST90544,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence KVEESFNLQATHDLLYHWQDLEQYDHLEF conjugate unconjugated UniProt accession no. Q9BV10, shipped in wet ice storage temp. 20°C Gene Information human ... ALG12(79087)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG13 antibody produced in rabbit
Human Protein Atlas Number: HPA002853 Human Protein Atlas characterization data
Кат. номер HPA002853-100UL HPA002853-25UL General descriptionALG13 is an endoplasmic reticulum localized UDP-GlcNAc transferase. Structurally, it consists of a catalytic domain, but lacks any membrane-spanning domains.ImmunogenUncharacterized protein CXorf45ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
UDP-N-acetylglucosamine transferase subunit ALG13 homolog (also known as asparagine-linked glycosylation 13 homolog) is an enzyme encoded by the ALG13 gene in humans. Mutation in this gene (involved in protein N-glycosylation) causes non-syndromic forms X-linked intellectual disability (NSXLID). Overexpression of this gene leads to its cytosolic partitioning and reduction of Alg14 levels. Alg14 gene is essential and sufficient for the ER localization of Alg13.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74340,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence VGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPG conjugate unconjugated UniProt accession no. Q9NP73, shipped in wet ice storage temp. 20°C Gene Information human ... ALG13(55849)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG14 antibody produced in rabbit
Human Protein Atlas Number: HPA031829 Human Protein Atlas characterization data
Кат. номер HPA031829-100UL HPA031829-25UL Immunogenasparagine-linked glycosylation 14 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78605,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSR conjugate unconjugated UniProt accession no. Q96F25, shipped in wet ice storage temp. 20°C Gene Information human ... ALG14(199857)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG1L antibody produced in rabbit
Human Protein Atlas Number: HPA036108 Human Protein Atlas characterization data
Кат. номер HPA036108-100UL HPA036108-25UL Immunogenasparagine-linked glycosylation 1-like recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79530,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence VLPLVMDIQLLGQRLKPRDPCCPSRSFFSESQGKPF conjugate unconjugated UniProt accession no. Q6GMV1, shipped in wet ice storage temp. 20°C Gene Information human ... ALG1L(200810)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG2 antibody produced in rabbit HPA041601-100UL
MDL number: MFCD01633022 Human Protein Atlas Number: HPA041601 Human Protein Atlas characterization data Immunogenasparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81894,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence KFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLH conjugate unconjugated UniProt accession no. Q9H553, shipped in wet ice storage temp. 20°C Gene Information human ... ALG2(85365)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG3 antibody produced in rabbit
Human Protein Atlas Number: HPA045103 Human Protein Atlas characterization data
Кат. номер HPA045103-100UL HPA045103-25UL Immunogenasparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83858,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR conjugate unconjugated UniProt accession no. Q92685, shipped in wet ice storage temp. 20°C Gene Information human ... ALG3(10195)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-ALG5 antibody produced in rabbit HPA007989-100UL
Human Protein Atlas Number: HPA007989 Human Protein Atlas characterization data ImmunogenDolichyl-phosphate β-glucosyltransferase recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
ALG5 (Dolichyl-phosphate beta-glucosyltransferase) gene encodes a protein belonging to the glycosyltransferase 2 family and is localized on the membrane of rough endoplasmic reticulum. It catalyzes the transfer of glucose from UDP-glucose to dolichyl-phosphate (Dol-P) to produce dolichol-phosphate glucose (DPG). Other glycosyltransferases utilize this DGP for glycosylation of intermediate dolichol-linked oligosaccharide, N-glycan precursor. The encoded protein functions in the glycosylation of the oligomannose core in N-linked glycosylation of proteins, which is necessary for substrate recognition.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71858,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, mouse, rat application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence RHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDL conjugate unconjugated UniProt accession no. Q9Y673, shipped in wet ice storage temp. 20°C Gene Information human ... ALG5(29880)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG6 antibody produced in rabbit
Human Protein Atlas Number: HPA062536 Human Protein Atlas characterization data
Кат. номер HPA062536-100UL HPA062536-25UL ImmunogenALG6, alpha-1,3-glucosyltransferaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST92273,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI conjugate unconjugated UniProt accession no. Q9Y672, shipped in wet ice storage temp. 20°C Gene Information human ... ALG6(29929)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG8 antibody produced in rabbit HPA051898-100UL
Human Protein Atlas Number: HPA051898 Human Protein Atlas characterization data Immunogenasparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85631,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence AVRECCKCIDGKKVGKELTEKPKF conjugate unconjugated UniProt accession no. Q9BVK2, shipped in wet ice storage temp. 20°C Gene Information human ... ALG8(79053)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALG9 antibody produced in rabbit
Human Protein Atlas Number: HPA038575 Human Protein Atlas characterization data
Кат. номер HPA038575-100UL HPA038575-25UL Immunogenasparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST80511,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence ALFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNL conjugate unconjugated UniProt accession no. Q9BRP7, shipped in wet ice storage temp. 20°C Gene Information human ... FDXACB1(79796)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALK antibody produced in rabbit
MDL number: MFCD02095814 Human Protein Atlas Number: HPA010694 Human Protein Atlas characterization data
Кат. номер HPA010694-100UL HPA010694-25UL General descriptionThe anaplastic lymphoma kinase (ALK) gene codes for a transmembrane receptor tyrosine kinase (RTK) that has 1620 amino acids. It is a member of the insulin receptor superfamily and is usually expressed in nerve cells. ALK gene is mapped to human chromosome 2p23.2.ImmunogenALK tyrosine kinase receptor precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Anaplastic lymphoma kinase (ALK) has the ability to trigger Stat3 (signal transducer and activator of transcription 3) and rescue hematopoietic cells from cell death. Mutations in ALK-1 result in hereditary hemorrhagic telangiectasia (HHT), an autosomal dominant disorder of localized angiodysplasia.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71454,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS conjugate unconjugated UniProt accession no. Q9UM73, shipped in wet ice storage temp. 20°C Gene Information human ... ALK(238)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-ALKAL1 antibody produced in rabbit
Human Protein Atlas Number: HPA027368 Human Protein Atlas characterization data
Кат. номер HPA027368-100UL HPA027368-25UL ImmunogenALK and LTK ligand 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76439,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence ARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHF conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... FAM150A(389658)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALKBH1 antibody produced in rabbit
Human Protein Atlas Number: HPA044087 Human Protein Atlas characterization data
Кат. номер HPA044087-100UL HPA044087-25UL ImmunogenalkB, alkylation repair homolog 1 (E. coli) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81823,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN conjugate unconjugated UniProt accession no. Q13686, shipped in wet ice storage temp. 20°C Gene Information human ... ALKBH1(8846)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALKBH2 antibody produced in rabbit
Human Protein Atlas Number: HPA051976 Human Protein Atlas characterization data
Кат. номер HPA051976-100UL HPA051976-25UL ImmunogenalkB homolog 2, alpha-ketoglutarate-dependent dioxygenaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST91350,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence LVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYTVLFGKAE conjugate unconjugated UniProt accession no. Q6NS38, shipped in wet ice storage temp. 20°C Gene Information human ... ALKBH2(121642)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALKBH3 antibody produced in rabbit
Human Protein Atlas Number: HPA046489 Human Protein Atlas characterization data
Кат. номер HPA046489-100UL HPA046489-25UL ImmunogenalkB homolog 3, alpha-ketoglutarate-dependent dioxygenaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST91059,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEY conjugate unconjugated UniProt accession no. Q96Q83, shipped in wet ice storage temp. 20°C Gene Information human ... ALKBH3(221120)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALKBH4 antibody produced in rabbit
Human Protein Atlas Number: HPA051422 Human Protein Atlas characterization data
Кат. номер HPA051422-100UL HPA051422-25UL ImmunogenalkB, alkylation repair homolog 4 (E. coli) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82017,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN conjugate unconjugated UniProt accession no. Q9NXW9, shipped in wet ice storage temp. 20°C Gene Information human ... ALKBH4(54784)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALKBH6 antibody produced in rabbit
Human Protein Atlas Number: HPA073835 Human Protein Atlas characterization data
Кат. номер HPA073835-100UL HPA073835-25UL ImmunogenalkB homolog 6ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST93171,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS conjugate unconjugated UniProt accession no. Q3KRA9, shipped in wet ice storage temp. 20°C Gene Information human ... ALKBH6(84964)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALKBH7 antibody produced in rabbit
Human Protein Atlas Number: HPA039872 Human Protein Atlas characterization data
Кат. номер HPA039872-100UL HPA039872-25UL ImmunogenalkB, alkylation repair homolog 7 (E. coli) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79632,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG conjugate unconjugated UniProt accession no. Q9BT30, shipped in wet ice storage temp. 20°C Gene Information human ... ALKBH7(84266)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALKBH8 antibody produced in rabbit
Human Protein Atlas Number: HPA061514 Human Protein Atlas characterization data
Кат. номер HPA061514-100UL HPA061514-25UL ImmunogenalkB, alkylation repair homolog 8 (E. coli)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87926,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVV conjugate unconjugated UniProt accession no. Q96BT7, shipped in wet ice storage temp. 20°C Gene Information human ... ALKBH8(91801)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALOX12 antibody produced in rabbit
Human Protein Atlas Number: HPA010691 Human Protein Atlas characterization data
Кат. номер HPA010691-100UL HPA010691-25UL General descriptionALOX12 (arachidonate 12-lipoxygenase) gene is mapped to human chromosome 17p13.1. The gene is a member of the lipoxygenase family and is predominantly expressed in the brain.ImmunogenArachidonate 12-lipoxygenase, 12S-type recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Arachidonate 12-lipoxygenase is a non-heme iron-containing dioxygenase that functions in the leukotrienes pathway. It converts leukotriene A4/LTA4 into both the bioactive lipoxin A4/LXA4 and lipoxin B4/LXB4. It catalyzes both oxygenase and lipoxin synthase activity. It triggers angiogenesis and promotes tumor growth in human prostate carcinoma. It converts arachidonic acid to12(S)-hydroperoxyeicosatetraenoic acid, which is then converted to 12(S)-hydroxyeicosatetraenoic acid. The end product is an eicosanoid that promotes tumorigenesis and metastasis. It plays a crucial role in the survival of human vascular smooth muscle cells. It regulates epidermal barrier formation. Polymorphism in this gene has been associated with bipolar disorder.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72463,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEY conjugate unconjugated UniProt accession no. P18054, shipped in wet ice storage temp. 20°C Gene Information human ... ALOX12(239)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALPI antibody produced in rabbit
Human Protein Atlas Number: HPA051699 Human Protein Atlas characterization data
Кат. номер HPA051699-100UL HPA051699-25UL Immunogenalkaline phosphatase, intestinalApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82404,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence FQTIGLSAAARFNQCNTTRGNEVISVMNRAK conjugate unconjugated UniProt accession no. P09923, shipped in wet ice storage temp. 20°C Gene Information human ... ALPI(248)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALPK1 antibody produced in rabbit
Human Protein Atlas Number: HPA027443 Human Protein Atlas characterization data
Кат. номер HPA027443-100UL HPA027443-25UL Immunogenalpha-kinase 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77819,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence LWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKAT conjugate unconjugated UniProt accession no. Q96QP1, shipped in wet ice storage temp. 20°C Gene Information human ... ALPK1(80216)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALPK2 antibody produced in rabbit
Human Protein Atlas Number: HPA027976 Human Protein Atlas characterization data
Кат. номер HPA027976-100UL HPA027976-25UL Immunogenalpha-kinase 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77840,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence SSVDPVDEKELSVTDSLSAASETGGKENVNNVSQDQEEKQLKMDHTAFFKKFLTCPKILESSVDPIDEISVIEYTRAGKPEPSETTPQG conjugate unconjugated UniProt accession no. Q86TB3, shipped in wet ice storage temp. 20°C Gene Information human ... ALPK2(115701)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALPK3 antibody produced in rabbit
Human Protein Atlas Number: HPA026558 Human Protein Atlas characterization data
Кат. номер HPA026558-100UL HPA026558-25UL ImmunogenAlpha-protein kinase 3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77825,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence ISSLSQAPECGAQSLGKAPPQASVQVPTPPARRRHGTRDSTLQGQAGHRTPGEVLECQTTTAPTMSASSSSDVASIGVSTSGSQGIIEPMDMETQE conjugate unconjugated UniProt accession no. Q96L96, shipped in wet ice storage temp. 20°C Gene Information human ... ALPK3(57538)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALPP antibody produced in rabbit
Human Protein Atlas Number: HPA038764 Human Protein Atlas characterization data
Кат. номер HPA038764-100UL HPA038764-25UL Immunogenalkaline phosphatase, placentalApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82403,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence NWYSDADVPASARQEGCQDIATQLISNMDI conjugate unconjugated UniProt accession no. P05187, shipped in wet ice storage temp. 20°C Gene Information human ... ALPP(250)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALS2 antibody produced in rabbit
Human Protein Atlas Number: HPA046588 Human Protein Atlas characterization data
Кат. номер HPA046588-100UL HPA046588-25UL Immunogenamyotrophic lateral sclerosis 2 (juvenile) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78898,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD conjugate unconjugated UniProt accession no. Q96Q42, shipped in wet ice storage temp. 20°C Gene Information human ... ALS2(57679)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALS2CL antibody produced in rabbit
Human Protein Atlas Number: HPA048301 Human Protein Atlas characterization data
Кат. номер HPA048301-100UL HPA048301-25UL ImmunogenALS2 C-terminal like recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83762,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence VDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMMDPNHTGGLYDFLLTALES conjugate unconjugated UniProt accession no. Q60I27, shipped in wet ice storage temp. 20°C Gene Information human ... ALS2CL(259173)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALS2CR12 antibody produced in rabbit
Human Protein Atlas Number: HPA035793 Human Protein Atlas characterization data
Кат. номер HPA035793-100UL HPA035793-25UL Immunogenamyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79152,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR conjugate unconjugated UniProt accession no. Q96Q35, shipped in wet ice storage temp. 20°C Gene Information human ... ALS2CR12(130540)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ALX1 antibody produced in rabbit
Human Protein Atlas Number: HPA018905 Human Protein Atlas characterization data
Кат. номер HPA018905-100UL HPA018905-25UL General descriptionThe gene ALX1 (ALX homeobox protein 1) is mapped to human chromosome 12q21.3-q22. The rodent homolog of ALX1 is present in early chondrocytes and prechondrocytic mesenchymal cells. Human ALX1 is expressed in HeLa cervical carcinoma cells and cervical tissue. The protein localizes in the nucleus. ALX1 is also called as CART1 (cartilage homeoprotein 1).ImmunogenALX homeobox protein 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
ALX homeobox protein 1 (ALX1) is suggested to be a transcription modulator. Hypermethylation of ALX1 is associated with shorter relapse-free survival in stage I non-small-cell lung cancer. Loss of function of ALX1 is associated with severe facial clefting and microphthalmia.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84723,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence QIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVL conjugate unconjugated UniProt accession no. Q15699, shipped in wet ice storage temp. 20°C Gene Information human ... ALX1(8092)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
