Prestige Antibodies®
- Сортировать:
- Вид таблицей
-
Monoclonal Anti-MCL1 antibody produced in mouse
Кат. номер AMAB90859-100UL AMAB90859-25UL General descriptionInduced myeloid leukemia cell differentiation protein (Mcl-1) belongs to B-cell lymphoma 2 (Bcl-2) apoptotic protein family. The Mcl-1 gene is mapped to human chromosome 1q21. It encodes a protein of 42 kDa. The alternate spliced variant is a small protein of 30 kDa. It contains three Bcl-2 homology (BH) domains whereas the alternate spliced has only one BH domain.Immunogenmyeloid cell leukemia sequence 1 (BCL2-related), recombinant protein epitope signature tag (PrEST)
Sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
Epitope
Binds to an epitope located within the peptide sequence PEEELDGYEP as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Induced myeloid leukemia cell differentiation protein (Mcl-1) functions as anti-apoptotic protein. Mcl-1 is upregulated in several carcinomas and is a key factor contributing to drug resistance in chemotherapies. It favors tumorigenesis in multiple myeloma and plays a crucial role in tumor progression. Spliceosome based inhibitors for Mcl-1 are suggested for prevent cancer metastasis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70113,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL1128, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:500- 1:1000 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000143384, UniProt accession no. Q07820, shipped in wet ice storage temp. 20°C Gene Information human ... MCL1(4170)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MEF2C antibody produced in mouse
Кат. номер AMAB90728-100UL AMAB90728-25UL Immunogenmyocyte enhancer factor 2CApplicationAll Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0369, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:500- 1:1000 isotype IgG1 immunogen sequence PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN conjugate unconjugated UniProt accession no. Q06413, shipped in wet ice storage temp. 20°C Gene Information human ... MEF2C(4208)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-METTL14 antibody produced in mouse
Human Protein Atlas Number: AMAB91276 Human Protein Atlas characterization data
Кат. номер AMAB91276-100UL AMAB91276-25UL Immunogenmethyltransferase like 14ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL4254, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:500-1:1000 isotype IgG1 immunogen sequence RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE conjugate unconjugated UniProt accession no. Q9HCE5, shipped in wet ice storage temp. 20°C Gene Information human ... METTL14(57721)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MKI67 antibody produced in mouse
Кат. номер AMAB90870-100UL AMAB90870-25UL Immunogenantigen identified by monoclonal antibody Ki-67, recombinant protein epitope signature tag (PrEST)
Sequence
DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI
Epitope
Binds to an epitope located within the peptide sequence PLSLSTCLFGRGIEC as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79721,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL1234, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:200- 1:500 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000148773, UniProt accession no. P46013, shipped in wet ice storage temp. 20°C Gene Information human ... MKI67(4288)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MKI67IP antibody produced in mouse
Кат. номер AMAB90961-100UL AMAB90961-25UL General descriptionMonoclonal Anti-MKI67IP Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal andImmunogennucleolar protein interacting with the FHA domain of MKI67
Nucleolar protein interacting with the FHA domain of MKI67ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.,
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88687,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL2240, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 2-10 µg/mL","immunohistochemistry: 1:200- 1:500 isotype IgG2a immunogen sequence IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI conjugate unconjugated UniProt accession no. Q9BYG3, shipped in wet ice storage temp. 20°C Gene Information human ... MKI67IP(84365)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MKI67IP from mouse
Кат. номер AMAB90962-100UL AMAB90962-25UL General descriptionMonoclonal Anti-MKI67IP Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal andImmunogennucleolar protein interacting with the FHA domain of MKI67
Nucleolar protein interacting with the FHA domain of MKI67ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.,
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88687,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL2237, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:2500- 1:5000 isotype IgG1 immunogen sequence IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI conjugate unconjugated UniProt accession no. Q9BYG3, shipped in wet ice storage temp. 20°C Gene Information human ... MKI67IP(84365)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MKL1 antibody produced in mouse
Human Protein Atlas Number: AMAB91285 Human Protein Atlas characterization data
Кат. номер AMAB91285-100UL AMAB91285-25UL Immunogenmegakaryoblastic leukemia (translocation) 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL4281, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:50-1:200 isotype IgG1 immunogen sequence EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG conjugate unconjugated UniProt accession no. Q969V6, shipped in wet ice storage temp. 20°C Gene Information human ... MKL1(57591)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MKL2 antibody produced in mouse
Кат. номер AMAB90887-100UL AMAB90887-25UL ImmunogenMKL/myocardin-like 2ApplicationAll Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL1546, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL isotype IgG1 immunogen sequence QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP conjugate unconjugated UniProt accession no. Q9ULH7, shipped in wet ice storage temp. 20°C Gene Information human ... MKL2(57496)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MMP9 antibody produced in mouse
Кат. номер AMAB90805-100UL AMAB90805-25UL Immunogenmatrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase), recombinant protein epitope signature tag (PrEST)
Sequence
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI
Epitope
Binds to an epitope located within the peptide sequence RGESKSLGPALLLLQ as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83039,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0539, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:500- 1:1000 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000100985, Featured Industry Research Pathology UniProt accession no. P14780, shipped in wet ice storage temp. 20°C Gene Information human ... MMP9(4318)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MOG antibody produced in mouse
Human Protein Atlas Number: AMAB91066 Human Protein Atlas characterization data
Кат. номер AMAB91066-100UL AMAB91066-25UL Immunogenmyelin oligodendrocyte glycoproteinApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL2852, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, mouse, rat packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:1000- 1:2500 isotype IgG1 immunogen sequence ALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG conjugate unconjugated UniProt accession no. Q16653, shipped in wet ice storage temp. 20°C Gene Information human ... MOG(4340)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MRC1 antibody produced in mouse
Кат. номер AMAB90746-100UL AMAB90746-25UL ImmunogenRecombinant protein corresponding to mannose receptor, C type 1.
Sequence
NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Epitope
Binds to an epitope located within the peptide sequence VSPSAVQTAACNQDA as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86249,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0387, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:2500- 1:5000 isotype IgG2a conjugate unconjugated Ensembl | human accession no. ENSG00000260314, shipped in wet ice storage temp. 20°C Gene Information human ... MRC1L1(414308)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MST1R antibody produced in mouse
Кат. номер AMAB90766-100UL AMAB90766-25UL Immunogenmacrophage stimulating 1 receptor (c-met-related tyrosine kinase)ApplicationAll Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0463, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL isotype IgG1 immunogen sequence EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP conjugate unconjugated UniProt accession no. Q04912, shipped in wet ice storage temp. 20°C Gene Information human ... MST1R(4486)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MTDH antibody produced in mouse
Кат. номер AMAB90763-100UL AMAB90763-25UL ImmunogenmetadherinApplicationAll Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0401, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:500- 1:1000 isotype IgG1 immunogen sequence RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD conjugate unconjugated UniProt accession no. Q86UE4, shipped in wet ice storage temp. 20°C Gene Information human ... MTDH(92140)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MTOR antibody produced in mouse AMAB91508-100UL
ImmunogenRecombinant protein corresponding to mechanistic target of rapamycin
Sequence
DTNTKGNKRSRTRTDSYSAGQSVEApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL8228, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000198793, shipped in wet ice storage temp. 20°C Gene Information human ... MTOR(2475)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MUC16 antibody produced in mouse
Human Protein Atlas Number: AMAB91056 Human Protein Atlas characterization data
Кат. номер AMAB91056-100UL AMAB91056-25UL Immunogenmucin 16, cell surface associatedApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL2782, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:500-1:1000 isotype IgG1 immunogen sequence GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ conjugate unconjugated UniProt accession no. Q8WXI7, shipped in wet ice storage temp. 20°C Gene Information human ... MUC16(94025)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MUC2 antibody produced in mouse AMAB91542-100UL
ImmunogenRecombinant protein corresponding to Mucin 2, oligomeric mucus/gel-forming
Sequence
IKRPDNQHVILKPGDFKSDPKNNApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL9148, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunohistochemistry: 1:20000-1:50000 isotype IgG2a conjugate unconjugated Ensembl | human accession no. ENSG00000198788, shipped in wet ice storage temp. 20°C Gene Information human ... MUC2(4583)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-MYO10 antibody produced in mouse AMAB91554-100UL
ImmunogenRecombinant protein corresponding to myosin X
Sequence
DDAFKDSPNPSEHGHSDQRApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL8994, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunofluorescence: 2-10 µg/mL","western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000145555, shipped in wet ice storage temp. 20°C Gene Information human ... MYO10(4651)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NANOG antibody produced in mouse
Кат. номер AMAB91391-100UL AMAB91391-25UL ImmunogenRecombinant protein corresponding to Nanog homeobox
Sequence
DSPDSSTSPKGKQPTSAEKApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone CL5803, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 2-10 µg/mL","immunohistochemistry: 1:1000-1:2500 isotype IgG2a conjugate unconjugated Ensembl | human accession no. ENSG00000111704, UniProt accession no. Q9H9S0, shipped in wet ice storage temp. 20°C Gene Information human ... NANOG(79923)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NAPRT antibody produced in mouse
Кат. номер AMAB90823-100UL AMAB90823-25UL ImmunogenRecombinant protein corresponding to nicotinate phosphoribosyltransferase.
Sequence
PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP
Epitope
Binds to an epitope located within the peptide sequence PAFFEHLRALDCSEV as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76285,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0665, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:200- 1:500 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000147813, shipped in wet ice storage temp. 20°C Gene Information human ... NAPRT1(93100)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NECAB1 antibody produced in mouse
Кат. номер AMAB90801-100UL AMAB90801-25UL ImmunogenRecombinant protein corresponding to N-terminal EF-hand calcium binding protein 1.
Sequence
LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
Epitope
Binds to an epitope located within the peptide sequence SIQWPGKRSS as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76228,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0576, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:500- 1:1000 isotype IgG2b conjugate unconjugated Ensembl | human accession no. ENSG00000123119, UniProt accession no. Q8N987, shipped in wet ice storage temp. 20°C Gene Information human ... NECAB1(64168)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NECAB2 antibody produced in mouse
Кат. номер AMAB90808-100UL AMAB90808-25UL ImmunogenN-terminal EF-hand calcium binding protein 2, recombinant protein epitope signature tag (PrEST)
Sequence
ATEDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLSEFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHVKVDTLSQPEALSRILVPA
Epitope
Binds to an epitope located within the peptide sequence IGRLESKALWFDLQQ as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72714,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0524, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:500- 1:1000 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000103154, UniProt accession no. Q7Z6G3, shipped in wet ice storage temp. 20°C Gene Information human ... NECAB2(54550)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NEFH antibody produced in mouse
Human Protein Atlas Number: AMAB91025 Human Protein Atlas characterization data
Кат. номер AMAB91025-100UL AMAB91025-25UL Immunogenneurofilament, heavy polypeptideApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL2671, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:500- 1:1000 isotype IgG1 immunogen sequence ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE conjugate unconjugated UniProt accession no. P12036, shipped in wet ice storage temp. 20°C Gene Information human ... NEFH(4744)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NEFL antibody produced in mouse
Human Protein Atlas Number: AMAB91314 Human Protein Atlas characterization data
Кат. номер AMAB91314-100UL AMAB91314-25UL Immunogenneurofilament, light polypeptideApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL4729, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity mouse, rat, human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:10000-1:20000 isotype IgG1 immunogen sequence SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF conjugate unconjugated UniProt accession no. P07196, shipped in wet ice storage temp. 20°C Gene Information human ... NEFL(4747)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NEFM antibody produced in mouse
Human Protein Atlas Number: AMAB91027 Human Protein Atlas characterization data
Кат. номер AMAB91027-100UL AMAB91027-25UL Immunogenneurofilament, medium polypeptideApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL2678, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, human, mouse packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:5000- 1:10000 isotype IgG1 immunogen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH conjugate unconjugated UniProt accession no. P07197, shipped in wet ice storage temp. 20°C Gene Information human ... NEFM(4741)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NET antibody produced in mouse
Human Protein Atlas Number: AMAB91116 Human Protein Atlas characterization data
Кат. номер AMAB91116-100UL AMAB91116-25UL General descriptionSodium-dependent noradrenaline transporter (NET) is also called solute carrier family 6 member 2 (SLC6A2). The SLC6A2 gene is mapped to locus 16q12.2 in the human chromosome. The sodium-dependent noradrenaline transporter (NET) belongs to sodium and chloride-dependent neurotransmitter transporter family and is a glycosylated protein.Immunogensolute carrier family 6 member 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Regulation of noradrenalin transport is the primary function of the norepinephrine transporter (NET).It is crucial for neuronal function and regulates neurotransmitter uptake in the central nervous system. Polymorphisms in NET gene is implicated in attention-deficit/hyperactivity disorder (ADHD). Mutations in NET impacts the transport functionality resulting in orthostatic intolerance disorder. Polymorphisms of SLC6A2 impacts neurotransmission in patients with major depressive disorder.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL3063, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, rat, mouse packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200-1:500 isotype IgG1 immunogen sequence SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... NET(6530)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Monoclonal Anti-NLRP3 antibody produced in mouse
Кат. номер AMAB90569-100UL AMAB90569-25UL ImmunogenNLR family, pyrin domain containing 3ApplicationAll Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0210, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100) isotype IgG1 immunogen sequence FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR conjugate unconjugated UniProt accession no. Q96P20, shipped in wet ice storage temp. 20°C Gene Information human ... NLRP3(114548)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NR5A1 antibody produced in mouse AMAB91540-100UL
ImmunogenRecombinant protein corresponding to nuclear receptor subfamily 5 group A member 1
Sequence
PYGYPEPFSGGPNVPApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL9101, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunofluorescence: 2-10 µg/mL","immunohistochemistry: 1:50-1:200 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000136931, shipped in wet ice storage temp. 20°C Gene Information human ... NR5A1(2516)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-NSD2 antibody produced in mouse
Кат. номер AMAB90851-100UL AMAB90851-25UL ImmunogenNuclear receptor binding set domain protein 2, recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73693,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL1063, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:500- 1:1000 conjugate unconjugated Ensembl | human accession no. ENSG00000109685, shipped in wet ice storage temp. 20°C Gene Information human ... WHSC1(7468)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-OCLN antibody produced in mouse
Кат. номер AMAB90893-100UL AMAB90893-25UL Immunogenoccludin, recombinant protein epitope signature tag (PrEST)
Sequence
DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Epitope
Binds to an epitope located within the peptide sequence RYSSGGNFETPSKRA as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83049,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL1608, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:200- 1:500 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000197822, UniProt accession no. Q16625, shipped in wet ice storage temp. 20°C Gene Information human ... OCLN(100506658)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-OTC antibody produced in mouse
Human Protein Atlas Number: AMAB91265 Human Protein Atlas characterization data
Кат. номер AMAB91265-100UL AMAB91265-25UL General descriptionOrnithine transcarbamylase (OTC) is a mitochondrial enzyme, encoded by the gene mapped to human chromosome Xp21.1. The encoded protein is composed of 354 amino acids.Immunogenornithine carbamoyltransferaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Ornithine transcarbamylase (OTC) catalyzes the second step of the urea cycle, that is, the synthesis of citrulline from ornithine and carbamoyl phosphate.Loss of gene expression is associated with the development of an X-linked inborn error of metabolism, ornithine transcarbamylase deficiency (OTCD).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL4046, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:5000-1:10000 isotype IgG1 immunogen sequence ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT conjugate unconjugated UniProt accession no. P00480, shipped in wet ice storage temp. 20°C Gene Information human ... OTC(5009)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PAX6 antibody produced in mouse
Кат. номер AMAB91372-100UL AMAB91372-25UL ImmunogenRecombinant protein corresponding to paired box 6
Sequence
VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYWApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone CL5414, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, mouse, human packaging antibody small pack of 25 µL application(s) immunofluorescence: 2-10 µg/mL","immunohistochemistry: 1:500-1:1000 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000007372, UniProt accession no. P26367, shipped in wet ice storage temp. 20°C Gene Information human ... PAX6(5080)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Monoclonal Anti-PAX8 antibody produced in mouse AMAB91488-100UL
ImmunogenRecombinant protein corresponding to paired box 8
Sequence
ERQHYPEAYASPSHTKGEQApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL7834, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunofluorescence: 2-10 µg/mL","immunohistochemistry: 1:200-1:500 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000125618, shipped in wet ice storage temp. 20°C Gene Information human ... PAX8(7849)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PCOLCE antibody produced in mouse
Кат. номер AMAB91432-25UL AMAB91432-100UL ImmunogenRecombinant protein corresponding to procollagen C-endopeptidase enhancer
Sequence
PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыantibody form purified immunoglobulin antibody product type primary antibodies clone CL6567, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000106333, shipped in wet ice storage temp. 20°C Gene Information human ... PCOLCE(5118)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PCP4 antibody produced in mouse
Кат. номер AMAB91359-100UL AMAB91359-25UL ImmunogenRecombinant protein corresponding to Purkinje cell protein 4
Sequence
GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
Epitope
Binds to an epitope located within the peptide sequence RAAVAIQSQFRKFQK as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone CL5306, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity mouse, rat, human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:500-1:1000 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000183036, UniProt accession no. P48539, shipped in wet ice storage temp. 20°C Gene Information human ... PCP4(5121)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PDCD1 antibody produced in mouse
Кат. номер AMAB91197-100UL AMAB91197-25UL Immunogenprogrammed cell death 1ApplicationAll Prestige Antibodies® Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL3624, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:200- 1:500 isotype IgG1 immunogen sequence WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS conjugate unconjugated UniProt accession no. Q15116, shipped in wet ice storage temp. 20°C Gene Information human ... PDCD1(5133)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PDIA3 antibody produced in mouse
Кат. номер AMAB90990-100UL AMAB90990-25UL General descriptionMonoclonal Anti-PDIA3 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal andImmunogenProtein disulfide isomerase family A, member 3ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.,
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86567,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL2446, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:5000- 1:10000 isotype IgG1 immunogen sequence PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK conjugate unconjugated UniProt accession no. P30101, shipped in wet ice storage temp. 20°C Gene Information human ... PDIA3(2923)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PGM1 antibody produced in mouse
Human Protein Atlas Number: AMAB91156 Human Protein Atlas characterization data
Кат. номер AMAB91156-100UL AMAB91156-25UL Immunogenphosphoglucomutase 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL3301, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:2500-1:5000 isotype IgG1 immunogen sequence SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD conjugate unconjugated UniProt accession no. P36871, shipped in wet ice storage temp. 20°C Gene Information human ... PGM1(5236)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PHGDH antibody produced in mouse
Кат. номер AMAB90786-100UL AMAB90786-25UL Immunogenphosphoglycerate dehydrogenase, recombinant protein epitope signature tag (PrEST)
Sequence
LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73826,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0555, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunofluorescence: 2-10 µg/mL (Fixation/Permeabilization: PFA/Triton X-100)","immunohistochemistry: 1:500- 1:1000 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000092621, UniProt accession no. O43175, shipped in wet ice storage temp. 20°C Gene Information human ... PHGDH(26227)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PIK3CA antibody produced in mouse AMAB91513-100UL
ImmunogenRecombinant protein corresponding to phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
Sequence
SYSHAGLSNRLARDNELRENDKEQApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL8345, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000121879, shipped in wet ice storage temp. 20°C Gene Information human ... PIK3CA(5290)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PIK3CB antibody produced in mouse AMAB91585-100UL
ImmunogenRecombinant protein corresponding to phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
Sequence
KQTYPPEHEPSIPENLEDKApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL9518, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunofluorescence: 2-10 µg/mL","immunohistochemistry: 1:200-1:500 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000051382, shipped in wet ice storage temp. 20°C Gene Information human ... PIK3CB(5291)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PLA2R1 antibody produced in mouse
Кат. номер AMAB90775-100UL AMAB90775-25UL ImmunogenRecombinant protein corresponding to phospholipase A2 receptor 1, 180kDa.
Sequence
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Epitope
Binds to an epitope located within the peptide sequence VKNCEERLFYICKKA as determined by overlapping synthetic peptides.ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72110,.
Physical form
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL0485, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 1 µg/mL","immunohistochemistry: 1:200- 1:500 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000153246, UniProt accession no. Q13018, shipped in wet ice storage temp. 20°C Gene Information human ... PLA2R1(22925)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PLK1 antibody produced in mouse AMAB91515-100UL
ImmunogenRecombinant protein corresponding to polo like kinase 1
Sequence
SNRKPLTVLNKGLENPLPERPREKApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL8360, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000166851, shipped in wet ice storage temp. 20°C Gene Information human ... PLK1(5347)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-POU3F2 antibody produced in mouse
Кат. номер AMAB91407-100UL AMAB91407-25UL ImmunogenRecombinant protein corresponding to POU class 3 homeobox 2
Sequence
ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone CL6232, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, mouse, rat packaging antibody small pack of 25 µL application(s) immunofluorescence: 2-10 µg/mL","immunohistochemistry: 1:500-1:1000 isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000184486, UniProt accession no. P20265, shipped in wet ice storage temp. 20°C Gene Information human ... POU3F2(5454)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-POU5F1 antibody produced in mouse AMAB91477-100UL
ImmunogenRecombinant protein corresponding to POU class 5 homeobox 1
Sequence
KEKLEQNPEESQDIKALQKApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL7621, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunofluorescence: 2-10 µg/mL","western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000204531, shipped in wet ice storage temp. 20°C Gene Information human ... POU5F1(5460)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PRAME antibody produced in mouse
Кат. номер AMAB91330-100UL AMAB91330-25UL ImmunogenRecombinant protein corresponding to tyrosinase-related protein 1.
Sequence
LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGIApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.,
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone CL5148, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:250-1:500","western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000185686, UniProt accession no. O95452, shipped in wet ice storage temp. 20°C Gene Information human ... GJB6(10804)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PRL
Кат. номер AMAB91430-25UL AMAB91430-100UL ImmunogenRecombinant protein corresponding to prolactin
Sequence
TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыantibody form purified immunoglobulin antibody product type primary antibodies clone CL6553, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) western blot: 1 µg/mL isotype IgG2a conjugate unconjugated Ensembl | human accession no. ENSG00000172179, shipped in wet ice storage temp. 20°C Gene Information human ... PRL(5617)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PRL antibody produced in mouse
Кат. номер AMAB91429-25UL AMAB91429-100UL ImmunogenRecombinant protein corresponding to prolactin
Sequence
TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыantibody form purified immunoglobulin antibody product type primary antibodies clone CL6550, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:2500-1:5000","western blot: 1 µg/mL isotype IgG2b conjugate unconjugated Ensembl | human accession no. ENSG00000172179, shipped in wet ice storage temp. 20°C Gene Information human ... PRL(5617)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-PROM1 antibody produced in mouse AMAB91494-100UL
ImmunogenRecombinant protein corresponding to prominin 1
Sequence
QPSSTDAPKAWNYELPATNYETQDApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CL7971, monoclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human application(s) immunohistochemistry: 1:500-1:1000","western blot: 1 µg/mL isotype IgG1 conjugate unconjugated Ensembl | human accession no. ENSG00000007062, shipped in wet ice storage temp. 20°C Gene Information human ... PROM1(8842)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
