- Производитель:
- Sigma-Aldrich
NACRES: | NA.85 |
About the Peptide Tag:This plasmid contains an n-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis Note
form | buffered aqueous solution |
mol wt | size 6842 bp |
conjugate | 6-His tagged, GST tagged |
Origin of replication | pUC (500 copies) |
Peptide cleavage | TEV |
Peptide tag location | N-terminal |
Promoter | Promoter name: CMV Promoter activity: constitutive Promoter type: mammalian |
bacteria selection | kanamycin |
mammalian cells selection | puromycin |
reporter gene | none |
shipped in | ambient |
storage temp. | 20°C |
RIDADR | NONH for all modes of transport |
Flash Point F | Not applicable |
Flash Point C | Not applicable |
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа

С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии

Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.

У большинства компаний срок ожидания составляет 10-12 недель.

Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.

Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.

В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.

Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.