- Главная
- Sigma-Aldrich
- Protein Biology
- Antibodies
- Enhanced Validation Antibodies
Каталог
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
Enhanced Validation Antibodies
- Сортировать:
- Вид таблицей
-
Anti-BRAT1 antibody produced in rabbit
Human Protein Atlas Number: HPA029455 Human Protein Atlas characterization data
Кат. номер HPA029455-100UL HPA029455-25UL ImmunogenHEAT repeat-containing protein C7orf27 Precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74903,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:50-1:200 immunogen sequence LLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPG conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... C7orf27(221927)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRCA1
Human Protein Atlas Number: HPA057371 Human Protein Atlas characterization data
Кат. номер HPA057371-100UL HPA057371-25UL ImmunogenRecombinant protein corresponding to BRCA1, DNA repair associated
Sequence
GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50-1:200 conjugate unconjugated UniProt accession no. P38398, shipped in wet ice storage temp. 20°C Gene Information human ... BRCA1(672)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRD2 antibody produced in rabbit
MDL number: MFCD07370274 Human Protein Atlas Number: HPA042816 Human Protein Atlas characterization data
Кат. номер HPA042816-100UL HPA042816-25UL Immunogenbromodomain containing 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83211,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation RNAi knockdown
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP conjugate unconjugated UniProt accession no. P25440, shipped in wet ice storage temp. 20°C Gene Information human ... BRD2(6046)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRE antibody produced in rabbit
Human Protein Atlas Number: HPA017926 Human Protein Atlas characterization data
Кат. номер HPA017926-100UL HPA017926-25UL General descriptionBrain and reproductive organ-expressed protein (BRE) which is also known as BRCC45 (BRCA1/BRCA2-containing complex subunit 45), is a death receptor-associated protein in the cytoplasm. In the nucleus, it is also a component of breast cancer 1/2 (BRCA 1/2)-containing DNA repair complex.ImmunogenProtein BRE recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Brain and reproductive organ-expressed protein (BRE) has an anti-apoptotic function. It takes part in the synthesis of steroid hormones and controls the ubiquitination of DNA repair complexes. The anti-apoptotic function of TNF (tumor necrosis factor)-α is inhibited by BRE.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74214,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:20-1:50 immunogen sequence ALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALQNLA conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... BRE(9577)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRF2 antibody produced in rabbit
Human Protein Atlas Number: HPA023378 Human Protein Atlas characterization data
Кат. номер HPA023378-100UL HPA023378-25UL General descriptionThe gene BRF2 (b-related factor 2) is mapped to human chromosome 8p11.23.ImmunogenTranscription factor IIIB 50 kDa subunit recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The gene BRF2 (b-related factor 2) encodes a member of the TFIIB (transcription factor IIB) family that forms a subunit of TFIIIB initiation factor, a factor required for accurate transcription by RNA polymerase III. RNA pol III is necessary for the transcription of small, untranslated RNAs, such as U6 snRNA and tRNAs. It acts as an oncogene, with increased expression observed in squamous cell carcinomas of the lung and can serve as a biomarker and a potential therapeutic target in several cancers. Tumor suppressors and oncogenes regulate BRF2-TFIIIB mediated transcription.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76198,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA conjugate unconjugated UniProt accession no. Q9HAW0, shipped in wet ice storage temp. 20°C Gene Information human ... BRF2(55290)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRG1 Antibody, clone 1N12, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1148-25UL ZRB1148-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 1N12 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Transcription activator BRG1. It targets an epitope within 65 amino acids from the N-terminal region.ImmunogenHis-tagged recombinant fragment corresponding to 65 amino acids from the N-terminal region of human Transcription activator BRG1.ApplicationAnti-BRG1, clone 1N12 ZooMAb, Cat. No. ZRB1148, is a highly specific recombinant rabbit monoclonal antibody that specifically targets Transcription activator BRG1 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected BRG1 in HeLa cells nuclear extract.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected BRG1 in HeLa, A431, HUVEC, and NIH 3T3 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected BRG1 in human colon and mouse colon tissue sections.
Note: Actual optimal working dilutions must be determined by the end user as specimens and experimental conditions may vary.
Target description
Transcription activator BRG1 (UniProt: P51532; also known as ATP-dependent helicase, SMARCA4, BRG1-associated factor 190A, BAF190A, Mitotic growth and transcription activator, Protein BRG-1, Protein brahma homolog 1, SNF2-beta, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4) is encoded by the SMARCA4 (also known as BAF190A, BRG1, SNF2B, SNF2L4) gene (Gene ID: 6597) in human. BRG1 is a component of the multiprotein chromatin-remodeling complexes SWI/SNF: SWI/SNF-A (BAF), SWI/SNF-B (PBAF) and related complexes. The SWI/SNF complexes contain 10-12 interchangeable subunits, with either BRG1/SMARCA4 or BRM/SMARCA2 as the ATPase subunit. These complexes drive conformational changes of nucleosomes in an ATP-dependent manner and play important roles in cell-cycle progression, DNA repair, and development. BRG1 is shown to maintain Polycomb-mediated repression of non-mesodermal developmental regulators. Studies have shown that BRG1 knockout leads to disruption of murine ESC cardiomyocyte differentiation and dysregulation of lineage-specific gene expression during mesoderm induction. Mutations in SMARCA4/BRG1 gene can cause rhabdoid tumor predisposition syndrome 2 that predisposes subject to renal or extrarenal malignant rhabdoid tumors. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1N12, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 184.65 kDa, observed mol wt ~185 kDa species reactivity human, mouse packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable (peptide) isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRICD5 antibody produced in rabbit
Human Protein Atlas Number: HPA019197 Human Protein Atlas characterization data
Кат. номер HPA019197-100UL HPA019197-25UL General descriptionBRICD5 (BRICHOS domain-containing protein 5) belongs to the BRICHOS family and contains a BRICHOS domain.ImmunogenHypothetical protein LOC283870 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
BRICHOS (BRI-2, chondromodulin-I (ChM-I), CA11 and surfactant protein C) is a chaperone domain. This domain interacts with the precursor protein areas and blocks them from amyloid formation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72981,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:50-1:200 immunogen sequence LRMTLPSPHMPRPNQTILVDVARNAATITVTPPQSNHSWAVLFDGQSGCICYRPEEHQVCFLRLMEDSDRETLRLLVDTSKVQEAWVPSQDTHHTQELLAVQGS conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... C16orf79(283870)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRIP1 antibody produced in rabbit
Human Protein Atlas Number: HPA005474 Human Protein Atlas characterization data
Кат. номер HPA005474-100UL HPA005474-25UL General descriptionBRCA1 interacting protein C-terminal helicase 1 (BRIP1) is an endogenous protein belonging to DEAH family of DNA helicases. It is an interacting partner of BRCA1 protein. It is a nuclear protein and functions both as an ATP-dependent DNA helicase and DNA-dependent ATPase. This gene is located on chromosome 17q22, is 180kb long and contains 20 exons. BRIP1 protein is composed of 1,249 amino acids and is universally expressed.ImmunogenBRCA1 interacting protein C-terminal helicase 1 recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Biochem/physiol Actions
BRCA1 interacting protein C-terminal helicase 1 (BRIP1) plays a key role in BRCA1-dependent DNA repair and checkpoint activities, and interacts with the BRCT domain of BRCA1. It aids BRCA1 in its tumor suppressor function and the repair of DNA double strand breaks by forming a complex with it. Mutations in BRIP1 are linked with Fanconi anemia, which is characterized by predisposition to cancer, developmental abnormalities and bone marrow failure. Studies suggest that mutations in this gene are linked to early onset breast cancer. Inactivation of BRIP1 gene leads to disruption of mammary morphogenesis and causes aberrant mammary acinar morphogenesis. Studies show that polymorphisms in this gene are linked to susceptibility to cervical cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86956,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL conjugate unconjugated UniProt accession no. Q9BX63, shipped in wet ice storage temp. 20°C Gene Information human ... BRIP1(83990)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
HPA019637-100UL
Anti-BRMS1 antibody produced in rabbit HPA019637-100UL
Human Protein Atlas Number: HPA019637 Human Protein Atlas characterization data ImmunogenBreast cancer metastasis-suppressor 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74786,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: 0.04-0.4 µg/mL immunogen sequence KLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK conjugate unconjugated UniProt accession no. Q9HCU9, shipped in wet ice storage temp. 20°C Gene Information human ... BRMS1(25855)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Brn-3a Antibody, clone 5A3.2 ZooMAb® Mouse Monoclonal
Кат. номер ZMS1050-4X25UL ZMS1050-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 5A3.2 is a ZooMAb® Mouse recombinant monoclonal antibody that specifically detects Brn-3a. It targets an epitope within 39 amino acids from the internal region.ImmunogenRecombinant fusion protein fragment corresponding to 39 amino acids from the internal region of human Brn-3a.ApplicationQuality Control Testing
Evaluated by Western Blotting with recombinant human in Brn-3a.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected recombinant human Brn-3a.
Tested applications
ELISA Analysis: 300 µg/mL from a representative lot detected recombinant human Brn-3a.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected Brn-3a in human retina tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Brn-3a, clone 5A3.2 ZooMAb®, Cat. No. ZMS1050, is a recombinant Mouse monoclonal antibody that detects Brn-3a and is tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
POU domain, class 4, transcription factor 1 (UniProt: Q01851; also known as Brain-specific homeobox/POU domain protein 3A, Brain-3A, Brn-3A, Homeobox/POU domain protein RDC-1, Oct-T1) is encoded by the POU4F1 (also known as BRN3A, RDC1) gene (Gene ID: 5457) in human. Brn-3a is a multifunctional transcription factor that is expressed in the brain and the retina and is present in the developing brain, spinal cord, and eye. Its C-terminal domain is able to act as both DNA-binding domain and a transcriptional activator. Its N-terminal domain is shown to be essential for its transactivation activity on some target genes. Brn-3a also activates Bcl-2 expression and protects neuronal cells from apoptosis. It regulates the expression of specific genes involved in differentiation and survival within a subset of neuronal lineages. It has been reported that neurite outgrowth and expression of genes required for synapse formation are primarily dependent on the C-terminal domain, however the N-terminal domain is required for maximal induction. Two isoforms of Brn-3a have been described that are produced by alternative splicing. Isoform 1 is shown to interact with Brn-3b (POU4F2) and this interaction inhibits both DNA-binding and transcriptional activities of Brn3a. Isoform 2 that lacks amino acids 1-84 can act as transcription factor but cannot regulate the expression of the same subset of genes and does not have antiapoptotic effects on neuronal cells. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 5A3.2, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 42.7 kDa","observed mol wt ~50 kDa purified by using Protein A species reactivity human species reactivity (predicted by homology) rat, chicken packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) ELISA: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG1 epitope sequence Internal conjugate unconjugated UniProt accession no. Q01851, shipped in ambient storage temp. 2-8°C -
Anti-Brn3a Antibody, clone 4L5, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1098-25UL ZRB1098-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 4L5 ZooMAb is a rabbit recombinant monoclonal antibody that specifically detects Brain-specific homeobox/POU domain protein 3A, (Brn-3a).ImmunogenKLH-conjugted linear peptide corresponding to 19 amino acids from the internal region of human homeobox/POU domain protein 3A (Brn-3a).ApplicationAnti-Brn3a, clone 4L5 ZooMAb , Cat. No. ZRB1098, is a highly specific rabbit recombinant monoclonal antibody antibody that targets Brn-3a and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: 1:1,000-1:10,000 from a representative lot detected Brn3a in mouse and rat brain tissue lysates
Immunocytochemistry Analysis: A 1:40 dilution from a representative lot detected Brn3a in Neuro2A cell line.
Immunohistochemistry (Paraffin) Analysis: A 1:10,000 dilution from a representative lot detected Brn3a in human and mouse retina tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user.
Target description
POU domain, class 4, transcription factor 1 (UniProt: Q01851; also known as Brain-specific homeobox/POU domain protein 3A, Brain-3A, Brn-3A, Homeobox/POU domain protein RDC-1, Oct-T1) is encoded by the POU4F1 (also known as BRN3A, RDC1) gene (Gene ID: 5457) in human. Brn-3A is a multifunctional transcription factor with different regions mediating its different effects. It regulates the expression of specific genes involved in differentiation and survival within a subset of neuronal lineages. It is expressed in the brain and the retina and is present in the developing brain, spinal cord and eye. Its expression peaks early in embryogenesis and is undetectable 14 days after birth. Its C-terminal domain can act as both DNA-binding domain and a transcriptional activator. The N-terminal domain is also required for transactivation activity on some target genes acting as a discrete activation domain. Brn-3A acts by binding to sequences related to the consensus octamer motif 5′-ATGCAAAT-3′ in the regulatory regions of its target genes. The POU-specific domain of Brn-3A is localized to amino acids 261-338. Brn-3A is shown to activate Bcl-2 expression and protect neuronal cells from apoptosis. Two isoforms of Brn-3A have been described that are produced by alternative splicing. Isoform 2 can act as a transcription factor but cannot regulate the expression of the same subset of genes and does not have any anti-apoptotic effect on neuronal cells. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 4L5, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 42.70 kDa, observed mol wt ~48 kDa species reactivity human, mouse, rat packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, immunoprecipitation (IP): suitable, western blot: suitable (peptide) isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BRPF1 antibody produced in rabbit
Human Protein Atlas Number: HPA003359 Human Protein Atlas characterization data
Кат. номер HPA003359-100UL HPA003359-25UL General descriptionBRPF1 (bromodomain and plant homeodomain finger containing, 1) protein contains plant homeodomain (PHD) fingers, a bromodomain that recognizes acetylated histones, and a proline-tryptophan-tryptophan-proline (PWWP) domain.ImmunogenPeregrin recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
BRPF1 (bromodomain and plant homeodomain finger containing, 1) gene encodes a component of the monocytic leukemic zinc finger (MOZ) histone acetyltransferase (HAT), a quaternary complex that acetylates histones. This component activates MOZ HAT by linking the MOZ catalytic subunit to the ING5 (inhibitor of growth 5) and hEaf6 subunits and promotes acetylation of histones. It also recruits Moz to active chromatin during mitosis. The MOZ HAT complex also functions in proper patterning for skeletal development. The PWWP domain of this protein associates with H3K36me3 (Trimethylation of Lys36 in histone H3) that mediates the elongation phase of transcription and functions as an epigenetic regulator of cell growth and differentiation. The effector domains of human BRPF1 are involved in gene transcription, chromatin binding and remodeling.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84803,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence SLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTD conjugate unconjugated UniProt accession no. P55201, shipped in wet ice storage temp. 20°C Gene Information human ... BRPF1(7862)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
SAB4200393-200UL
Anti-BRSK1 (C-terminal) antibody produced in rabbit SAB4200393-200UL
NACRES: NA.44 General descriptionBRSK1 is a serine/threonine kinase that facilitates the G(2)/M cell cycle arrest upon UV- or methyl methane sulfonate-induced DNA damage. This kinase also modulates the polarity of neurons and duplication of centrosomes . Anti-BRSK1 (C-terminal) antibody is specific for mouse and human BRSK1. In immunoblotting, detection of the BRSK1 band is specifically inhibited by the BRSK1 immunizing peptide.Immunogensynthetic peptide corresponding to a sequence at the C-terminal of human BRSK1, conjugated to KLH. The corresponding sequence is identical in mouse BRSK1.ApplicationAnti-BRSK1 (C-terminal) antibody is suitable for use in western blot (1-2 μg/mL using S1 fraction extracts of mouse forebrain). The product can also be used for immunoprecipitation (10-20 μg) and indirect immunofluorescence (0.2-0.4 μg/mL) using HEK-293T cells overexpressing mouse BRSK1.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~90 kDa species reactivity mouse, human enhanced validation recombinant expression concentration ~1.5 mg/mL application(s) immunoprecipitation (IP): 10-20 µg using HEK-293T cell lysates overexpressing mouse BRSK1.","indirect immunofluorescence: 0.2-0.4 µg/mL using HEK-293T cells overexpressing mouse BRSK1.","western blot: 1-2 µg/mL using mouse forebrain (S1 fraction). conjugate unconjugated UniProt accession no. Q8TDC3, shipped in dry ice storage temp. 20°C Gene Information human ... BRSK1(84446)
mouse ... Brsk1(381979)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable -
SAB4200392-200UL
Anti-BRSK1 antibody produced in rabbit SAB4200392-200UL
NACRES: NA.44 General descriptionBRSK1 (BR serine/threonine kinase 1), also known as serine/threonine-protein kinase (SAD-1, SAD-B) and BRSK2 (SAD-A) belong to the family of Ser/Thr AMP-activated protein kinase (AMPK)-related kinases that are specifically expressed in the mammalian brain. BRSK1 gene is mapped to human chromosome 19q13.42. BRSK1 protein localizes in the synaptic vesicle in the hippocampus and cerebellum.
Specificity
Anti-BRSK1 specifically recognizes mouse BRSK1.Immunogensynthetic peptide corresponding to an internal sequence of human BRSK1, conjugated to KLH. The corresponding sequence is identical in mouse BRSK1.ApplicationAnti-BRSK1 antibody is suitable for use in western blot (2-4 μg/mL using S1 fraction extracts of mouse forebrain). The product can also be used for immunoprecipitation (10-20 μg) and indirect immunofluorescence (0.2-0.4 μg/mL) using HEK-293T cells overexpressing mouse BRSK1.
Biochem/physiol Actions
BRSK1 (BR serine/threonine kinase 1) is essential for the polarization of cortical neurons. Knock-out mice that lack both BRSK1 and BRSK2 have defects in neuronal polarity and die prematurely after birth. Liver kinase B1(LKB1) phosphorylates and activates the serine/threonine-protein (SAD) kinases at a specific threonine residue within the T-loop activation segment of the kinase domain. BRSK1/2 in turn phosphorylates downstream effectors such as the microtubule-associated protein, tau and the cell cycle checkpoint kinase, Wee1-like protein kinase (Wee1). Phosphorylation of Wee1 by BRSK1/2 is required to regulate its activity and differentiation of polarized neurons. Also, BRSK1/SADB is localized to centrosomes and to control centrosome duplication. SADB phosphorylates γ-tubulin on Ser131 residue, suggesting that it controls centrosome homeostasis by regulating the phosphorylation of γ -tubulin.
BRSK1 is a serine/threonine kinase that facilitates the G(2)/M cell cycle arrest upon UV- or methyl methane sulfonate-induced DNA damage. This kinase also modulates the polarity of neurons and duplication of centrosomes. Anti-BRSK1 antibody is specific for mouse BRSK1. The antibody is also expected to react with human BRSK1. In immunoblotting, detection of the BRSK1 band is specifically inhibited by the BRSK1 immunizing peptide.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers,is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~90 kDa species reactivity mouse enhanced validation recombinant expression concentration ~1.5 mg/mL application(s) immunoprecipitation (IP): 10-20 µg using lysates of HEK-293T cells overexpressing mouse BRSK1","indirect immunofluorescence: 0.2-0.4 µg/mL using HEK-293T cells overexpressing mouse BRSK1","western blot: 2-4 µg/mL using extracts of mouse forebrain (S1 fraction) conjugate unconjugated UniProt accession no. Q5RJI5, shipped in dry ice storage temp. 20°C Gene Information human ... BRSK1(84446)
mouse ... Brsk1(381979)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable -
SAB4200431-200UL
Anti-BRSK2 (N-terminal) antibody produced in rabbit SAB4200431-200UL
NACRES: NA.44 General descriptionBrain selective kinase 2 (BRSK2) (SAD-A) protein is a member of the family Ser/Thr 5′ adenosine monophosphate-activated protein kinase (AMPK) related kinases. This protein is specifically located in the spinal cord and brain of embryonic and postnatal animals. The BRSK2 gene is located on the human chromosome at 11p15.5.
Specificity
Anti-BRSK2 (N-terminal) specifically recognizes mouse BRSK2.Immunogensynthetic peptide corresponding to a sequence near the N-terminus of human BRSK2, conjugated to KLH. The corresponding sequence is identical in rat and mouse BRSK2.ApplicationAnti-BRSK2 (N-terminal) antibody produced in rabbit may be used in immunoblotting and immunofluorescence.
Biochem/physiol Actions
Brain selective kinase 2 (BRSK2) protein is phosphorylated by liver kinase B1 (LKB1) at Thr-174 thereby increasing its kinase activity. This protein is also phosphorylated at Thr-260 by cyclic adenosine monophosphate (cAMP)-dependent protein kinase A (PKA) which is another upstream kinase. Brain selective kinase1/2 (BRSK1/2) phosphorylates downstream effectors like the cell cycle checkpoint kinase Wee1 and microtubule-associated protein tau. Phosphorylation of Wee1 by BRSK1/2 is essential for the regulation of its activity in polarized neurons and is an important step for the differentiation of polarized neurons.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. Storage in “frost-free” freezers is also not recommended. If slight turbidity occurs uponprolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~75 kDa species reactivity human, rat, mouse enhanced validation recombinant expression concentration ~1.0 mg/mL application(s) dot blot: 1-2 µg/mL using HEK-293T cell lysates overexpressing mouse BRSK2.","indirect immunofluorescence: 0.1-0.2 µg/mL using HEK-293T cells overexpressing mouse BRSK2. conjugate unconjugated UniProt accession no. Q8IWQ3, shipped in dry ice storage temp. 20°C Gene Information human ... BRSK2(9024)
mouse ... Brsk2(75770)
rat ... Brsk2(293631)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable -
Anti-BSDC1 antibody produced in rabbit
Human Protein Atlas Number: HPA031358 Human Protein Atlas characterization data
Кат. номер HPA031358-100UL HPA031358-25UL ImmunogenBSD domain containing 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87044,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000","western blot: 0.04-0.4 µg/mL immunogen sequence DLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGEVSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCL conjugate unconjugated UniProt accession no. Q9NW68, shipped in wet ice storage temp. 20°C Gene Information human ... BSDC1(55108)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BSG antibody produced in rabbit
Human Protein Atlas Number: HPA036048 Human Protein Atlas characterization data
Кат. номер HPA036048-100UL HPA036048-25UL Immunogenbasigin (Ok blood group)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79895,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:2500-1:5000 immunogen sequence DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN conjugate unconjugated UniProt accession no. P35613, shipped in wet ice storage temp. 20°C Gene Information human ... BSG(682)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BSN Antibody, clone 2I2 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1779-4X25UL ZRB1779-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 2I2 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Protein Bassoon (BSN). It targets an epitope within the C-terminal half.ImmunogenGST/His-tagged recombinant fragment corresponding to 150 amino acids from the C-terminal half of human Protein Bassoon (BSN).ApplicationAnti-BSN, clone 2I2 ZooMAb®, Cat. No. ZRB1779, is a rabbit recombinant monoclonal antibody that specifically targets Protein Bassoon (BSN) and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in U251 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected BSN in U251 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected BSN in PC12 cell lysate.
Affinity Binding Assay: A representative lot of this antibody bound BSN peptide with a KD of 1.6 x 10-7 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected BSN in human cerebral cortex and human retina tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected BSN in E18 Rat hippocampal neurons.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Protein bassoon (UniProt: Q9UPA5; also known as Zinc finger protein 231, BSN) is encoded by the BSN (also known as KIAA0434, ZNF231) gene (Gene ID: 8927) in human. BSN is a multi-domain peripheral membrane protein that is exclusively expressed in brain. It serves as a scaffold protein of the presynaptic cytomatrix at the active zone, the region in the synapse where neurotransmitter is released. At the presynaptic active zone, it regulates the spatial organization of synaptic vesicle cluster, the protein complexes that execute membrane fusion and compensatory endocytosis. It promotes vesicular replenishment and, consequently, a large standing pool of readily releasable synaptic vesicles at the endbulb synapse. BSN are transported on Golgi-derived membranous organelles, called Piccolo-Bassoon transport vesicles (PTVs), from the neuronal soma to distal axonal locations, where they participate in assembling new synapses. It is known to mediate synapse to nucleus communication leading to reconfiguration of gene expression by associating with the transcriptional corepressor CTBP1 and by subsequently reducing the size of its pool available for nuclear import. Mutant mice deficient in functional Bassoon are reported to suffer from epileptic seizures and have dysfunctional hippocampal synapses. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Dresbach, T., et al. (2003). Mol. Cell. Neurosci. 23(2); 279-291; Fejtova, A., et al. (2009). J. Cell Biol. 185(2); 341-355; Schultz AM., et al. (2014). EMBO J. 33(4); 512-527).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 2I2, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt ~ 416.47 kDa, observed mol wt ~ 240 kDa species reactivity rat, human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BSND
Human Protein Atlas Number: HPA060617 Human Protein Atlas characterization data
Кат. номер HPA060617-100UL HPA060617-25UL ImmunogenRecombinant protein corresponding to barttin CLCNK type accessory beta subunit
Sequence
QPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunohistochemistry: 1:50-1:200 conjugate unconjugated UniProt accession no. Q8WZ55, shipped in wet ice storage temp. 20°C Gene Information human ... BSND(7809)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BSND antibody produced in rabbit
Human Protein Atlas Number: HPA053836 Human Protein Atlas characterization data
Кат. номер HPA053836-100UL HPA053836-25UL Immunogenbarttin CLCNK-type chloride channel accessory beta subunitApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82040,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunohistochemistry: 1:2500-1:5000 immunogen sequence SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL conjugate unconjugated UniProt accession no. Q8WZ55, shipped in wet ice storage temp. 20°C Gene Information human ... BSND(7809)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 -
Anti-BSPH1
Human Protein Atlas Number: HPA048335 Human Protein Atlas characterization data
Кат. номер HPA048335-100UL HPA048335-25UL ImmunogenRecombinant protein corresponding to binder of sperm protein homolog 1
Sequence
SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTYApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200-1:500 conjugate unconjugated UniProt accession no. Q075Z2, shipped in wet ice storage temp. 20°C Gene Information human ... BSPH1(100131137)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BTBD1 antibody produced in rabbit
Human Protein Atlas Number: HPA067671 Human Protein Atlas characterization data
Кат. номер HPA067671-100UL HPA067671-25UL ImmunogenBTB (POZ) domain containing 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88218,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence SSLGPLLPLQREPLYNWQATKASLKERFAFL conjugate unconjugated UniProt accession no. Q9H0C5, shipped in wet ice storage temp. 20°C Gene Information human ... BTBD1(53339)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
HPA031355-100UL
Anti-BTBD6 antibody produced in rabbit HPA031355-100UL
Human Protein Atlas Number: HPA031355 Human Protein Atlas characterization data ImmunogenBTB (POZ) domain containing 6 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70676,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence WEVIDAQAEMALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPITPRNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLEETHSIFLWYTATNKPRLDFPLTKRKGLAPQRCHRFQSSA conjugate unconjugated UniProt accession no. Q96KE9, shipped in wet ice storage temp. 20°C Gene Information human ... BTBD6(90135)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BTBD7 antibody produced in rabbit
Human Protein Atlas Number: HPA049926 Human Protein Atlas characterization data
Кат. номер HPA049926-100UL HPA049926-25UL ImmunogenBTB (POZ) domain containing 7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85261,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIRTGEE conjugate unconjugated UniProt accession no. Q9P203, shipped in wet ice storage temp. 20°C Gene Information human ... BTBD7(55727)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BTG3 antibody produced in rabbit
Human Protein Atlas Number: HPA018400 Human Protein Atlas characterization data
Кат. номер HPA018400-100UL HPA018400-25UL General descriptionThe gene BTG family member 3 (BTG3) is mapped to human chromosome 21q21.1. It belongs to the BTG (B-cell translocation gene) anti-proliferative protein family. The expression of BTG3 is cell cycle dependent and peaks at the end of the G1 phase before the entry of cells in S phase. BTG3 transcript is ubiquitously expressed in adult mice, with highest levels in the heart, lung, kidney, and testis, but low in the spleen and skeletal muscle. BTG3 is also detected in the ovarian fiber cells and fallopian tube. The protein is mainly localized in the nucleus.ImmunogenProtein BTG3 recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73921,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT conjugate unconjugated UniProt accession no. Q14201, shipped in wet ice storage temp. 20°C Gene Information human ... BTG3(10950)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BTK antibody produced in rabbit
MDL number: MFCD01633065 Human Protein Atlas Number: HPA001198 Human Protein Atlas characterization data
Кат. номер HPA001198-100UL HPA001198-25UL ImmunogenTyrosine-protein kinase BTK recombinant protein epitope signature tag (PrEST)ApplicationAnti-BTK antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
BTK (Bruton agammaglobulinemia tyrosine kinase) gene encodes a non-receptor tyrosine kinase that has a crucial role in B lymphocyte development, differentiation and signaling. It is essential for lipopolysaccharide (LPS)-induced as well as Toll-like receptors (TLR2 and TLR4)-induced tumor necrosis factor (TNF) production. Bright, a member of the ARID family of transcription factors, promotes immunoglobulin heavy-chain transcription via association with the transcription factor TFII-I and Btk. Btk interacts with and activates signaling by Toll-like receptors (TLR8 and TLR9) that are involved in the detection of pathogens and activation of host defense. Defects in this gene cause X-linked agammaglobulinaemia (XLA), a humoral immunodeficiency disease.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78234,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL conjugate unconjugated UniProt accession no. Q06187, shipped in wet ice storage temp. 20°C Gene Information human ... BTK(695)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BTLA antibody produced in rabbit
Human Protein Atlas Number: HPA062029 Human Protein Atlas characterization data
Кат. номер HPA062029-100UL HPA062029-25UL ImmunogenB and T lymphocyte associatedApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88753,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:1000- 1:2500 isotype IgG immunogen sequence ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE conjugate unconjugated UniProt accession no. Q7Z6A9, shipped in wet ice storage temp. 20°C Gene Information human ... BTLA(151888)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BTN3A3 antibody produced in rabbit
Human Protein Atlas Number: HPA011871 Human Protein Atlas characterization data
Кат. номер HPA011871-100UL HPA011871-25UL ImmunogenButyrophilin subfamily 3 member A3 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
BTN3A3 (butyrophilin, subfamily 3, member A3) is a member of the butyrophilin (BTN) family with B7 family homology. It consists of IgV-like exoplasmic domain followed by another exoplasmic IgC-like domain. There is a protein binding SPRY/PRY B30.2 region at the cytoplasmic domain. It is expressed on endothelial cells, in the membrane layer surrounding milk fat-secreting droplet from mammary epithelial cells, immune cells, and on some tumor cell lines. It is a potent regulator of the immune system. Study shows the involvement of BTN3A3 in the proliferation of CD4+ and CD8+ and in the cytokine secretion by T-cells. It has also been reported that it may function as a co-stimulatory molecule on CD4+ T cells and NK (Natural Killer) cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71798,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence IALSRETEREREMKEMGYAATEQEISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTANAILLVSEDQRSV conjugate unconjugated UniProt accession no. O00478, shipped in wet ice storage temp. 20°C Gene Information human ... BTN3A3(10384)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BUB3 antibody produced in rabbit
MDL number: MFCD03454834 Human Protein Atlas Number: HPA003601 Human Protein Atlas characterization data
Кат. номер HPA003601-100UL HPA003601-25UL General descriptionMitotic checkpoint protein BUB3 is a protein encoded by the BUB3 gene in humans. In humans, this gene has seven exons and six introns and spans a genomic region of over 16kb. The gene BUB3 is mapped to human chromosome 10q26.ImmunogenMitotic checkpoint protein BUB3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The gene BUB3 encodes a WD-repeat protein that is involved in the mitotic spindle checkpoint pathway. Together with Rae1, another WD-repeat protein, it functions in the prevention of chromosome missegregation. It promotes the formation of stable end-on bipolar attachments and is essential for the establishment of correct K-MT attachments.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86555,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, mouse packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP conjugate unconjugated UniProt accession no. O43684, shipped in wet ice storage temp. 20°C Gene Information human ... BUB3(9184)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BUD13 antibody produced in rabbit
Human Protein Atlas Number: HPA038340 Human Protein Atlas characterization data
Кат. номер HPA038340-100UL HPA038340-25UL ImmunogenBUD13 homolog (S. cerevisiae)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87291,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence HDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKAT conjugate unconjugated UniProt accession no. Q9BRD0, shipped in wet ice storage temp. 20°C Gene Information human ... BUD13(84811)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BVES antibody produced in rabbit
Human Protein Atlas Number: HPA014788 Human Protein Atlas characterization data
Кат. номер HPA014788-100UL HPA014788-25UL General descriptionBVES (blood vessel epicardial substance) is the prototypic member of Popeye Domain Containing (Popdc) family, and is also called POPDC1. This family has two other members called POPDC2 and POPDC3. BVES is a transmembrane epithelial adhesion protein, containing the characteristic Popeye domain made of amino acids 172-266. It spans the membrane 3 times, and its C-terminal faces the cytoplasm. Homotypic interaction of BVES-BVES is essential for its localization to plasma membrane. It was initially identified in the cDNA library of developing heart.ImmunogenBlood vessel epicardial substance recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
BVES (blood vessel epicardial substance) is involved in the control of tight junction formation in epithelial cells. These tight junctions in turn control RhoA and ZONAB/DbpA, which is a y-box transcription factor. Therefore, the expression and residence of BVES has a regulatory effect on RhoA and ZONAB/DbpA activity. Suppression of this protein leads to DNA hypermethylation or the silencing of transcription. It is down-regulated in all stages of human colorectal carcinoma (CRC) and in adenomatous polyps. Its down-regulation is associated with epithelial-mesenchymal transition (EMT), and consequent colon tumorigenesis. BVES is also down-regulated in gastric cancer, and this is associated with enhanced tumorigenesis and poor patient prognosis. This protein is a key player in the development of embryo and cardiocyte differentiation. It is over-expressed in patients with congenital defects of septa and is linked with tetralogy of Fallot (TOF).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73021,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP conjugate unconjugated UniProt accession no. Q8NE79, shipped in wet ice storage temp. 20°C Gene Information human ... BVES(11149)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-BYSL antibody produced in rabbit
Human Protein Atlas Number: HPA031217 Human Protein Atlas characterization data
Кат. номер HPA031217-100UL HPA031217-25UL Immunogenbystin-like recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77379,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, mouse packaging antibody small pack of 25 µL enhanced validation independent application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE conjugate unconjugated UniProt accession no. Q13895, shipped in wet ice storage temp. 20°C Gene Information human ... BYSL(705)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-C-EBP alpha Antibody, clone 2E17, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1367-25UL ZRB1367-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 2E17 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects C-EBP alpha. It targets an epitope within 147 amino acids from the N-terminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 147 amino acids from N-terminal region of human C-EBP alpha, isoform 1.ApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected C-EBP alpha in THP-1 cell lysate.
Flow Cytometry Analysis: 0.01 µg from a representative lot detected C-EBP alpha in one million U937 cells.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected C-EBP alpha in THP-1 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user.
Anti-C-EBP alpha, clone 2E17 ZooMAb, Cat. No. ZRB1367, a recombinant Rabbit monoclonal antibody that specifically targets C-EBP alpha and has been tested for use in Flow Cytometry, Immunocytochemistry, and Western Blotting.
Target description
CCAAT/enhancer-binding protein alpha (UniProt: P49715; also known as C/EBP alpha, C-EBP alpha) is encoded by the CEBPA (also known as CEBP) gene in human. C-EBP alpha belong to the bZIP family of proteins that serves as a transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. It binds directly to the consensus DNA sequence 5′-T[TG]NNGNAA[TG]-3′ acting as an activator on distinct target genes. It can bind DNA as a homodimer or as a stable heterodimer with CEBPB, CEBPD, CEBPE, and CEBPG. It is reported to be essential for the transition from common myeloid progenitors (CMP) to granulocyte/monocyte progenitors (GMP) and has also been shown to be critical for the proper development of the liver and the lung and for terminal adipocyte differentiation. C-EBP alpha down-regulates the expression of genes that maintain cells in an undifferentiated and proliferative state through E2F1 repression, which is critical for its ability to induce adipocyte and granulocyte terminal differentiation. It can be phosphorylated on multiple sites. Phosphorylation at serine 190 is shown to be essential for its interaction with CDK2, CDK4 and SWI/SNF complex leading to cell cycle inhibition. Phosphorylation at threonine 226 and threonine 230 by GSK3 is constitutive in adipose and lung tissue and these sites are also shown to be phosphorylated in liver during feeding, but not during fasting cycle. Four isoforms of C-EBP alpha have been described that are produced by alternative splicing. Mutations in CEBPA gene are known to cause acute myelogenous leukemia (AML). This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Wedel, A., et al. (1995). Immunobiology. 193(2-4); 171-185; Johnson, PF et al. (2005). J. Cell Sci. 118(12); 2545-2555).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 2E17, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 37.56 kDa, observed mol wt ~50 kDa species reactivity human, mouse packaging pkg of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) flow cytometry: suitable, immunocytochemistry: suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 -
Anti-C-EBP beta Antibody, clone 8G18, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1105-25UL ZRB1105-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 8G18 ZooMAb is a rabbit recombinant monoclonal antibody that specifically detects human CCAAT/enhancer-binding protein beta (C/EBP beta). It targets an epitope with in the N-terminal region.ImmunogenHis-tagged recombinant fragment corresponding to 150 amino acids from the N-terminal half of human CCAAT/enhancer-binding protein beta (C/EBP beta).ApplicationImmunocytochemistry Analysis: A 1:100 dilution from a representative lot detected C-EBP beta in HeLa, A431, HUVEC, NIH 3T3 and HepG2 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected C-EBP beta in human colon and mouse colon tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user.
Anti-C-EBP beta, clone 8G18 ZooMAb , Cat. No. ZRB1105, is a highly specific rabbit recombinant monoclonal antibody that targets C-EBP beta and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
CCAAT/enhancer-binding protein beta (UniProt: P17676; also known as C/EBP beta, Liver activator protein, LAP, Liver-enriched inhibitory protein, LIP, Nuclear factor NF-IL6, Transcription factor 5, TCF-5) is encoded by the CEBPB (also known as TCF5) gene (Gene ID: 1051) in human. C/EBP beta is a highly conserved B-Zip family member that acts as a transcription factor regulating the expression of genes involved in immune and inflammatory responses. It is expressed at low levels in the lung, kidney and spleen and is induced by endoplasmic reticulum stress. It can bind to DNA either as a homodimer or a heterodimer with ATF4. C/EBP beta plays a significant role in adipogenesis, as well as in the gluconeogenesis, liver regeneration, and hematopoiesis. During adipogenesis, it is rapidly expressed and, after activation by phosphorylation, induces CEBPA and PPARG, which turn on the series of adipocyte genes giving rise to the adipocyte phenotype. It has a pro-mitotic effect on many cell types, including hepatocytes and adipocytes, but has an anti-proliferative effect on T-cells by repressing MYC expression, facilitating differentiation along the T-helper 2 lineage. C/EBP beta is phosphorylated at threonine 235 by MAPK and CDK2 that serves to prime phosphorylation at threonine 226 and serine 231 by GSK3beta and acquire DNA-binding as well as transactivation activities that are required to induce adipogenesis. However, O-glycosylation at serine 227 and serine 228 is shown to prevent phosphorylation on threonine 235, serine 231, and threonine 226 and reduces its DNA binding activity that delays adipocyte differentiation. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 8G18, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 36.11 kDa, observed mol wt ~42 kDa species reactivity human, mouse packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable (peptide) isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-c-Fos Antibody, clone 1D10, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB457-25UL ZRB457-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.SpecificityClone 1D10 a ZooMAb is a rabbit recombinant monoclonal antibody that specifically detects c-Fos. It targets an epitope with in 14 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids from the N-terminal region of human c-Fos.ApplicationAnti-c-Fos, clone 1D10 ZooMAb, Cat. No. ZRB457, is a recombinant Rabbit Monoclonal Antibody that specifically targets Proto-oncogene c-Fos and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Immunocytochemistry Analysis: A 1:250 dilution from a representative lot detected c-Fos in serum starved HeLa cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected c-Fos in rat brain tissue sections.
Target description
Proto-oncogene c-Fos (UniProt: P01100; also known as Cellular oncogene fos, G0/G1 switch regulatory protein 7) is encoded by the FOS (also known as G0S7) gene (Gene ID: 2353) in human. C-Fos is a nuclear phosphoprotein that forms a tight, but non-covalently linked, complex with the JUN/AP-1 transcription factor. In the heterodimer, c-Fos and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. In quiescent cells, the small amount of c-Fos present is phosphorylated at tyrosine 10 and 30. This tyrosine phosphorylated form is cytosolic. Following induction of cell growth, it first localizes to the endoplasmic reticulum and only later to the nucleus. Localization at the endoplasmic reticulum is shown to require dephosphorylation at tyrosine 10 and 30. In growing cells, c-Fos is dephosphorylated by PTPN2, which leads to its association with endoplasmic reticulum membranes and activation of phospholipid synthesis. A basic motif (aa 139-159) is required for the activation of phospholipid synthesis. Upon stimulation by nerve growth factor it is undergoes phosphorylation in the C-terminal region by MAPK and RSK1. Phosphorylation on both serine 362 and serine 374 leads to its stabilization. Phosphorylation on serine 362 and serine 374 primes further phosphorylation on threonine 325 and 331 through promoting docking of MAPK to the DEF domain. c-Fos is also reported to be constitutively sumoylated with SUMO1, SUMO2 and SUMO3 and sumoylation requires heterodimerization with JUN and is enhanced by mitogenic stimulation. Sumoylation inhibits the AP-1 transcriptional activity and is, itself, inhibited by Ras-activated phosphorylation on threonine 232. Three different isoforms of c-Fos have been described that are produced by alternative splicing. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1D10, monoclonal","recombinant monoclonal product line ZooMAb® form lyophilized mol wt calculated mol wt 40.7 kDa","observed mol wt ~56 kDa species reactivity rat, human packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency.enhanced validation recombinant expression application(s) immunocytochemistry: 1:100-1:250","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using 1:100","western blot: suitable using 1:1,000 isotype IgG conjugate unconjugated UniProt accession no. P01100, shipped in ambient storage temp. 2-8°C Gene Information human ... FOS;G0S7(2353)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-c-Jun Antibody, clone 1G8 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1422-4X25UL ZRB1422-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1G8 is a ZooMAb® Rabbit recombinant monoclonal antibody that specifically detects Transcription Factor c-Jun (AP-1). It targets an epitope within 17 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 17 amino acids from the N-terminal region of human c-Jun.ApplicationQuality Control Testing
Evaluated by Western Blotting in K562 cell lysate.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected c-Jun in K562 cell lysate.
Tested applications
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected c-Jun in PC3, NIH3T3, L6 cell lysates.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected c-Jun in NIH3T3, HUVEC, and A431 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected c-Jun in human skin and human kidney tissue sections.
Affinity Binding Assay: A representative lot of this antibody bound c-Jun with a KD of 2.3 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-c-Jun, clone 1G8 ZooMAb®, Cat. No. ZRB1422, is a recombinant Rabbit monoclonal antibody that detects c-Jun and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Transcription factor AP-1 (UniProt: P05412; also known as Activator protein 1, AP1, Proto-oncogene c-Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39) is encoded by the JUN gene (Gene ID: 3725) in human. c-Jun is a transcription factors that forms homodimers with JunB and JunD or heterodimers with Fos family members. These homodimers and heterodimers bind to specific DNA sequences, known as 12-Otetradecanoylphorbol-13-acetate response elements (TRE), in the promoter regions of target genes and activate transcription. c-Jun recognizes and binds to the enhancer heptamer motif 5-TGA[CG]TCA-3. It is involved in numerous cellular activities, including cell proliferation, apoptosis, survival, tumorigenesis, and tissue morphogenesis. c-Jun is phosphorylated by CaMK4 and DNA dependent protein kinase, which enhances its transcriptional activity. When phosphorylated by HIPK3, it promotes the activity of Nuclear Receptor Subfamily 5 Group A Member 1 (NR5A) that leads to increased steroidogenic gene expression upon stimulation of cAMP signaling pathway. It also undergoes phosphorylation at serine 243 by DYRK2 that primes it for phosphorylation by GSK-3b at threonine 239, serine 243, and serine 249. These phosphorylations reduce its DNA binding ability and allow its ubiquitination and degradation. On the other hand, when ERK activates p70S6 kinase, the activated p70S6 kinase phosphorylates GSK3b at serine 21 that leads to dephosphorylation and increased DNA binding activity of c-Jun. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Lukey, MJ., et al. (2016). Nat. Commun. 7; Article 11321; Qinghang Meng, Q., and Xia, Y. (2011). Protein Cell. 2(11); 889-898; Zhang, Y., et al. (2007). BMC Cancer. 7; Article 145; Lan, HC., et al. (2007). Mol. Cell Biol. 27(6); 2027-2036; Nateri, AS., et al. (2004). Science. 303(5662); 1374-1378).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры