- Производитель:
- Sigma-Aldrich
Human Protein Atlas Number: | HPA004003 Human Protein Atlas characterization data |
Кат. номер |
HPA004003-100UL |
HPA004003-25UL |
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
biological source | rabbit |
Quality Level | 100, |
antibody form | affinity isolated antibody |
antibody product type | primary antibodies |
clone | polyclonal |
product line | Prestige Antibodies® Powered by Atlas Antibodies |
form | buffered aqueous glycerol solution |
species reactivity | human |
packaging | antibody small pack of 25 µL |
enhanced validation | independent Learn more about Antibody Enhanced Validation, |
application(s) | immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:500-1:1000, western blot: 0.04-0.4 µg/mL |
immunogen sequence | TVSSQASPSGGAALSSSTAGSSAAAATSAAIFITDEASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPEGGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQPCRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPCSGAST |
conjugate | unconjugated |
Featured Industry | Research Pathology |
shipped in | wet ice |
storage temp. | 20°C |
Gene Information | human ... CXorf67(340602) |
RIDADR | NONH for all modes of transport |
WGK Germany | WGK 1 |
Flash Point F | Not applicable |
Flash Point C | Not applicable |
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа

С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии

Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.

У большинства компаний срок ожидания составляет 10-12 недель.

Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.

Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.

В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.

Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.