Anti-CLDN7 antibody produced in rabbit

Human Protein Atlas Number:

HPA014703    Human Protein Atlas characterization data

Кат. номер

HPA014703-100UL

HPA014703-25UL

CLDN7 (claudin-7) belongs to the family of tight junction proteins called claudins, which are responsible for the maintenance of epithelial barrier function. This family has at least 24 members, and they are all membrane proteins. It has a short N-terminal facing the cytosol, two extraplasmic domains, and cytosolic C-terminal. Its spans the membrane four times.
Claudin-7 recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CLDN7 (claudin-7) prevents the invasion and migration of human lung cancer cells, and induces apoptosis by activating caspases, post cisplatin treatment of lung cancer cells. It interacts with CD44 and EpCAM, and might form a membrane-anchoring protein complex, which helps it to reside in the plasma membrane. It is up-regulated in colon cancer, where it facilitates tumorigenesis. Its expression is also associated with inflammatory bowel disease (IBD) and colitis-associated cancer. It is either completely inactivated or under-expressed in human breast cancer, and is also linked with relapse of the same. Studies on human breast cancer MCF-7 cell line, show that tumor necrosis factor (TNF)α induces the expression of CLDN7, which leads to accumulation of β-catenin in the cytosol. This way CLDN7 regulates apoptosis of MCF-7 cell line. It is over-expressed in epithelial ovarian cancer, where it might be involved in its invasion.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73174,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:20- 1:50
immunogen sequence	PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS
conjugate	unconjugated
UniProt accession no.	O95471,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CLDN7(1366)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable