Anti-ARPC1B antibody produced in rabbit

Human Protein Atlas Number:

HPA004832    Human Protein Atlas characterization data

Кат. номер

HPA004832-100UL

HPA004832-25UL

The Arp2/3 complex is composed of seven subunits, such as Arp2, Arp3, p41-Arc, p34-Arc, p21-Arc, p20-Arc, and p16-Arc (p complex). Among all the subunits, ARPC1B is a novel member of the Sop2 family of WD (tryptophan and aspartate) repeat-containing proteins.
Actin-related protein 2/3 complex subunit 1B recombinant protein epitope signature tag (PrEST)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Biochem/physiol Actions
ARPC1B (actin related protein 2/3 complex, subunit 1B, 41kDa) is involved in the formation of actin filamentous network at the cell cortex. The protein subunit (ARPC1B) may maintain the structure and activity of the Arp2/3 complex. Overexpression of p41-Arc, a regulatory component of Arp2/3 complex causes the alteration of actin filaments. It gets accumulated in nuclei. Further, this alteration can trigger an intrinsic premature senescence in the tumor suppression process.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86831,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	mouse, human, rat
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
conjugate	unconjugated
UniProt accession no.	O15143,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... ARPC1B(10095)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable