Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.
-
Привезем под заказ -
Срок поставки с завода 6-8 недель
- Производитель:
- Sigma-Aldrich
| MDL number: | MFCD01092266 |
| Human Protein Atlas Number: | HPA010607 Human Protein Atlas characterization data |
| Кат. номер |
| HPA010607-100UL |
| HPA010607-25UL |
General description
AFP (α fetoprotein) is a 70kDa serum glycoprotein, and is produced during gestation from fetal liver and yolk sac.Immunogen
α-Fetoprotein precursor recombinant protein epitope signature tag (PrEST)Application
Anti-AFP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.Biochem/physiol Actions
AFP (α fetoprotein) levels decrease by the second year of birth and its ectopic expression is linked with tumors, such as hepatobastoma, hepatocellular carcinoma (HCC) and yolk sac tumors. Maximum AFP-expressing tumors are of stomach, bile duct or pancreatic origin. AFP-expressing rectal cancer is extremely rare and is usually metastasized to liver with poor prognosis. In patients with chronic hepatitis C, high levels of this protein are linked with increased risk of developing HCC. In patients with metastatic gastric cancer (GC), follow-up of AFP concentrations can help determine early treatment response. For early and intermediate stages of HCC, the addition of this protein and ascites in the BCLC Barcelona Clinic Liver Cancer (BCLC) staging can improvise prognosis determination.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST86803,.Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCDisclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Параметры
| biological source | rabbit |
| Quality Level | 100 |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| packaging | antibody small pack of 25 µL |
| enhanced validation | recombinant expression recombinant expression RNAi knockdown |
| application(s) | immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 |
| immunogen sequence | FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR |
| conjugate | unconjugated |
| Featured Industry | Research Pathology |
| UniProt accession no. | P02771, |
| shipped in | wet ice |
| storage temp. | 20°C |
| Gene Information | human ... AFP(174) |
Safety Information
| Personal Protective Equipment | Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), |
| RIDADR | NONH for all modes of transport |
| WGK Germany | WGK 1 |
| Flash Point F | Not applicable |
| Flash Point C | Not applicable |
Пуско-наладка
Выполним распаковку, визуальную проверку, сборку и установку, запуск и настройку, проверку функциональности, проведем инструктаж персонала.
Техническое обслуживание
Проведем периодические регламентные работы: визуальный осмотр, очистка засоренных узлов и частей, замена расходных материалов и изношенных деталей, тестирование прибора, проверка показателей и измерение параметров, калибровка и настройка, обновление программного обеспечения.
IQ/OQ/PQ квалификация, валидация
Проведем монтажную (IQ), операционную (OQ) и эксплуатационную (PQ) квалификацию оборудования по протоколам производителя в полном соответствии с стандартами GMP/GLP.
Ремонт
Проведем диагностику в нашем сервисном центре или у Вас на предприятии, выявим причину поломки, устраним неисправность, проведем тестирование, настройку, калибровку отремонтированного оборудования.
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
Отзывы
В числе наших клиентов организации
из разных отраслей
Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.
-
Привезем под заказ
-
Срок поставки с завода 6-8 недель
