Anti-ACOX2 antibody produced in rabbit

Human Protein Atlas Number:

HPA064845    Human Protein Atlas characterization data

Кат. номер

HPA064845-100UL

HPA064845-25UL

ACOX2 (acyl-CoA oxidase 2) is the rate limiting enzyme located on human chromosome 3p14. It codes for the peroxisomal branched-chain acyl-CoA oxidase. ACOX2 is expressed in the liver and kidney.
acyl-CoA oxidase 2, branched chain
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-ACOX2 antibody has been used in western blotting.
Biochem/physiol Actions
ACOX2 (acyl-CoA oxidase 2) participates in the β-oxidation of branched, long chain fatty acids and in the production of bile-acid precursor molecules. Loss of ACOX2 leads to inborn error of bile acid production with persistent hypertransaminasemia. ACOX2 may participates in the degradation of long branched fatty acids (phytanic and pristanic acids).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST90117,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq recombinant expression independent
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	VTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCL
conjugate	unconjugated
UniProt accession no.	Q99424,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... ACOX2(8309)

pictograms	GHS07
signalword	Warning
hcodes	H315 - H319
pcodes	P305 + P351 + P338
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable