Cloning & Expression
- Сортировать:
- Вид таблицей
-
PSF-TEF1-NH2-6HIS-FLAG®-3C - N-TERMINAL 6 HIS AND FLAG® DUAL TAG YEAST PLASMID OGS1694-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal FLAG epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6781 bp conjugate 6-His tagged, FLAG® tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-6HIS-KRYFP-THR - N-TERMINAL 6 HIS AND YFP DUAL TAG YEAST PLASMID OGS1726-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7456 bp conjugate 6-His tagged, yellow fluorescent protein (YFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage thrombin Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene YFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-6HIS-MBP-TEV - N-TERMINAL 6 HIS AND MBP DUAL TAG YEAST PLASMID OGS1693-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal Maltose Binding Protein (MBP) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7858 bp conjugate 6-His tagged, maltose-binding protein (MBP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-6HIS-TEV - N-TERMINAL 6 HIS TAG YEAST PLASMID OGS1631-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6754 bp conjugate 6-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-A-FACTOR SP - ALPHA FACTOR SECRETION PLASMID OGS1876-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Alpha factor (signal peptide only) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6766 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor SP bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-A-FACTORFL - FULL LENGTH ALPHA FACTOR SECRETION PLASMID OGS1875-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an full length Alpha Factor (A-FactorFL) secretory peptide to allow proteins to be exported from the cytosol. Alpha factor is an endogenous yeast protein that is naturally secreted into the supernatant. The wild-type Alpha Factor protein contains a series of repeating protein sequences that are cleaved out by cellular proteases that recognise a specific site. This produces a series of small peptides that contain the mature alpha peptide sequence. This plasmid contain the wild-type signal peptide from the full length Alpha factor gene but also the coding sequence that leads up to the first endogenous protease cleavage site. The addition of these sequences has been demonstrated to provide more consistent secretion of proteins in comparison to using just the signal peptide alone. All of the wild-type protein sequences will be removed during protein maturation and export by endogenous proteases.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6964 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-A-FACTORFL-10HIS - ALPHA FACTOR SECRETION AND 10HIS TAG PLASMID OGS1867-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an full length Alpha Factor (A-FactorFL) secretory peptide to allow proteins to be exported from the cytosol. Alpha factor is an endogenous yeast protein that is naturally secreted into the supernatant. The wild-type Alpha Factor protein contains a series of repeating protein sequences that are cleaved out by cellular proteases that recognise a specific site. This produces a series of small peptides that contain the mature alpha peptide sequence. This plasmid contain the wild-type signal peptide from the full length Alpha factor gene but also the coding sequence that leads up to the first endogenous protease cleavage site. The addition of these sequences has been demonstrated to provide more consistent secretion of proteins in comparison to using just the signal peptide alone. All of the wild-type protein sequences will be removed during protein maturation and export by endogenous proteases. This plasmid also contains a secondary Deca-Histidine (10His) protein tag. The sequence of this tag is: HHHHHHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6994 bp conjugate 10-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Узнать цену -
PSF-TEF1-NH2-A-FACTORFL-6HIS - ALPHA FACTOR SECRETION AND 6 HIS TAG PLASMID OGS1866-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an full length Alpha Factor (A-FactorFL) secretory peptide to allow proteins to be exported from the cytosol. Alpha factor is an endogenous yeast protein that is naturally secreted into the supernatant. The wild-type Alpha Factor protein contains a series of repeating protein sequences that are cleaved out by cellular proteases that recognise a specific site. This produces a series of small peptides that contain the mature alpha peptide sequence. This plasmid contain the wild-type signal peptide from the full length Alpha factor gene but also the coding sequence that leads up to the first endogenous protease cleavage site. The addition of these sequences has been demonstrated to provide more consistent secretion of proteins in comparison to using just the signal peptide alone. All of the wild-type protein sequences will be removed during protein maturation and export by endogenous proteases. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6982 bp conjugate 6-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-A-FACTORFL-6HIS-THR - ALPHA FACTOR SECRETION AND 6 HIS TAG PLASMID OGS1821-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an full length Alpha Factor (A-FactorFL) secretory peptide to allow proteins to be exported from the cytosol. Alpha factor is an endogenous yeast protein that is naturally secreted into the supernatant. The wild-type Alpha Factor protein contains a series of repeating protein sequences that are cleaved out by cellular proteases that recognise a specific site. This produces a series of small peptides that contain the mature alpha peptide sequence. This plasmid contain the wild-type signal peptide from the full length Alpha factor gene but also the coding sequence that leads up to the first endogenous protease cleavage site. The addition of these sequences has been demonstrated to provide more consistent secretion of proteins in comparison to using just the signal peptide alone. All of the wild-type protein sequences will be removed during protein maturation and export by endogenous proteases. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7000 bp conjugate 6-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage thrombin Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-A-FACTORFL-CMYC - ALPHA FACTOR SECRETION AND CMYC TAG PLASMID OGS1869-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an full length Alpha Factor (A-FactorFL) secretory peptide to allow proteins to be exported from the cytosol. Alpha factor is an endogenous yeast protein that is naturally secreted into the supernatant. The wild-type Alpha Factor protein contains a series of repeating protein sequences that are cleaved out by cellular proteases that recognise a specific site. This produces a series of small peptides that contain the mature alpha peptide sequence. This plasmid contain the wild-type signal peptide from the full length Alpha factor gene but also the coding sequence that leads up to the first endogenous protease cleavage site. The addition of these sequences has been demonstrated to provide more consistent secretion of proteins in comparison to using just the signal peptide alone. All of the wild-type protein sequences will be removed during protein maturation and export by endogenous proteases. This plasmid also contains a secondary C-Myc protein tag. The sequence of this tag is: EQKLISEEDLWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6994 bp conjugate c-Myc tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-A-FACTORFL-HA - ALPHA FACTOR SECRETION AND HA TAG PLASMID OGS1870-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an full length Alpha Factor (A-FactorFL) secretory peptide to allow proteins to be exported from the cytosol. Alpha factor is an endogenous yeast protein that is naturally secreted into the supernatant. The wild-type Alpha Factor protein contains a series of repeating protein sequences that are cleaved out by cellular proteases that recognise a specific site. This produces a series of small peptides that contain the mature alpha peptide sequence. This plasmid contain the wild-type signal peptide from the full length Alpha factor gene but also the coding sequence that leads up to the first endogenous protease cleavage site. The addition of these sequences has been demonstrated to provide more consistent secretion of proteins in comparison to using just the signal peptide alone. All of the wild-type protein sequences will be removed during protein maturation and export by endogenous proteases. This plasmid also contains a secondary Influenza Hemagglutinin (HA) protein tag. The sequence of this tag is: YPYDVPDYAWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6991 bp conjugate Hemagglutinin A (HA) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-AMY-6HIS - ALPHA-AMYLASE SECRETION AND 6 HIS TAG PLASMID OGS1808-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Alpha Amylase (Amy) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6787 bp conjugate 6-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha-amylase bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-AMY-6HIS-THR - ALPHA-AMYLASE SECRETION AND 6 HIS TAG PLASMID OGS1763-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Alpha Amylase (Amy) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6805 bp conjugate 6-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage thrombin Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha-amylase bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-AMY-STREP-3C - ALPHA-AMYLASE SECRETION AND STREP TAG PLASMID OGS1807-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Alpha Amylase (Amy) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Strep protein tag. The sequence of this tag is: WSHPQFEKWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6817 bp conjugate streptavidin conjugate Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha-amylase bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-DAGFP - N-TERMINAL DAGFP TAG YEAST PLASMID OGS1752-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal non-aequorea based green fluorescent protein (daGFP) reporter tag that can be fused to a gene of interest to allow protein detection and/or purification.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7420 bp conjugate green fluorescent protein (GFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene GFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Узнать цену -
PSF-TEF1-NH2-GLUCA - GLUCOAMYLASE SECRETION PLASMID OGS1877-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Glucoamylase (GlucA) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6757 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal glucoamylase bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-HA-TEV - N-TERMINAL HA TAG YEAST PLASMID OGS1634-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6763 bp conjugate Hemagglutinin A (HA) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-ILUMENA - SECRETED LUCIFERASE (ILUMINA REPORTER) TAG YEAST PLASMID OGS1759-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal iLumina reporter tag that can be fused to a gene of interest to allow protein detection and/or purification.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7345 bp conjugate iLumena luciferase conjugate Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene iLumena luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-INTS - INVERTASE SECRETION PLASMID OGS1879-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Invertase (Ints) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6787 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-INUL - INULASE SECRETION PLASMID OGS1878-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Inulase (Inul) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6766 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-KLLR - KILLER PROTEIN SECRETION PLASMID OGS1880-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Killer protein (Kllr) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6763 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-KRYFP - N-TERMINAL YFP TAG YEAST PLASMID OGS1754-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an n-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection and/or purification.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7420 bp conjugate yellow fluorescent protein (YFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene YFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-NH2-LYS - LYSOZYME SECRETION PLASMID OGS1881-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains an Lysozyme (Lys) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6763 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastSecretion signal alpha factor FL bacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-SNAPFUSION - YEAST SNAPFUSION CLONING PLASMID OGS604-5UG
NACRES: NA.85 General descriptionThis vector is a standard Saccharomyces cerevisiae yeast expression plasmid with the exception that it has been modified to allow the direct cloning of gene fragments that have been designed to fit with any of our peptide tag plasmid range. This can be useful if you have created a peptide fusion but you would also like to create a non-tagged gene variant. The multiple cloning site contains two BsgI and BseRI sites that produce overhangs that are compatible with gene designed using our SnapFusion primer designer (see the cloning tab for this product). The promoter in this plasmid (TEF1) is a strong constitutive yeast promoter.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6728 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-CEN6/ARS4-URA3 - LOW COPY ORIGIN YEAST PLASMID
General descriptionThis is a low copy Saccharomyces cerevisiae yeast plasmid that allows for the plasmid to be maintained in cells at an approximate frequency of 1-2 copies per cell. These plasmids are not typically used for protein production because expression is signficantly lower than using the standard 2 micron origin which has a much higher copy number. This plasmid can still be used when large DNA inserts are required and low levels of expression of genes are needed. The plasmid contains the URA3 selection cassette which allows the plasmid to be maintained in cells that are defective for this gene. Cells carrying the plasmid can then be grown in media that is deficient in uracil.
Promoter Expression Level: This expression vector contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae.ApplicationCloning in a gene: PSF-TEFI-CEN6/ARS4-URA3 - LOW COPY ORIGIN YEAST PLASMID has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis Note
Узнать цену -
PSF-TEFI-HIS3 - HISTIDINE YEAST SELECTION PLASMID OGS530-5UG
NACRES: NA.85 General descriptionThe purpose of this expression vector is the expression of genes in Saccharomyces cerevisiae using selective removal of histidine from the media for cell selection. The plasmid contains a gene that is an essential part of the histidine synthesis pathway. By transforming the plasmid into yeast cells that are deficient in this gene and growing the cells on media that does not contain histidine cells can be selected that contain the plasmid. This is one of a range of metabolic selection genes that are available for yeast. Others include tryptophan leucine and uracil. We also provide plasmids using more standard selection methods such as puromycin and hygromycin.
Promoter Expression Level: This snapfast vector contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae.ApplicationCloning in a gene: PSF-TEFI-HIS3 - HISTIDINE YEAST SELECTION PLASMID has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6800 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-LEU2 - LEUCINE YEAST SELECTION PLASMID OGS531-5UG
NACRES: NA.85 General descriptionThis vector has been engineered to allow the expression of a gene of interest in Saccharomyces cerevisiae using the strong yeast TEF-1 promoter and selection in the absence of leucine. The plasmid contains a gene that is essential for the production of leucine within yeast cells thereby allowing the growth of strains that are deficient in this gene to be grown in the absence of leucine. We also provide alternatives to leucine selection including plasmids for selection using histidine tryptophan and uracil synthesis. We also stock more standard selection yeast plasmids such as puromycin and blasticidin selection.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7225 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-BETAGAL-URA3 - BETA GALACTOSIDASE YEAST PLASMID OGS544-5UG
NACRES: NA.85 General descriptionA beta galactosidase reporter plasmid for the expression of genes in Saccharomyces cerevisiae yeast cells. The beta galactosidase reporter is driven by the yeast TPI promoter which is a strong constitutive promoter. The plasmid contains the TEF1 promoter to drive the expression of a gene of interest. This is one of the strongest promoters in Saccharomyces cerevisiae. The vector also encodes a gene that is an essentail component of the uracil synthesis pathway which allows the plasmid to be grown in cells deficient for this gene using media that does not contain uracil.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the expression of the reporter gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 10720 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene beta Gal shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-BLAST - BLASTICIDIN RESISTANT YEAST VECTOR OGS539-5UG
NACRES: NA.85 General descriptionPSF-TEFI-TPI1-BLAST - Blasticidin resistant yeast vector is a blasticidin resistant Saccharomyces cerevisiae expression plasmid. This expression vector contains the yeast EF1-Alpha promoter to drive transgene expression. Saccharomyces cerevisiae yeast expression plasmid using the strong constitutive TEF1 promoter to drive protein production from a gene of interest. The plasmid also contains an antibiotic resistance cassette that provides resistance to blasticidin. This cassette is driven from the strong constitutive TPI yeast promoter.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the antibiotic resistance gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: PSF-TEFI-TPI1-BLAST - Blasticidin resistant yeast vector has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6880 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-CFP-URA3 - YEAST CFP REPORTER VECTOR OGS548-5UG
NACRES: NA.85 General descriptionA cyan fluorescent protein (CFP) reporter gene plasmid that allows for the expression of a transgene alongside the CFP gene. The CFP variant in this plasmid was developed by DNA2. 0 and is called Frosty CFP. Expression of the reporter gene is mediated by the TPI promoter whilst the expression of a gene of interest would be controlled by the TEF1 promoter. These are both endogenous yeast promoters that require no induction for activity. They demonstrate approximately equal expression levels. The plasmid also contains the URA3 selection cassette which encodes an essential component for uracil synthesis. This means the that plasmid can be maintained in media that is deficient in uracil using yeast strains that are defective for the URA3 cassette.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the expression of the reporter gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 8284 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene CFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-DAGFP-URA3 - GFP YEAST REPORTER PLASMID OGS550-5UG
General descriptionA green fluorescent reporter vector expression in Saccharomyces cerevisiae yeast cells. The plasmid is designed to enable the co-expression of a gene of interest alongside the GFP reporter. The plasmid is selected for in yeast using the URA3 cassette which allows stable maintanence provided that the cells are grown in uracil deficient media and the cell line is defective for the URA3 gene. The GFP reporter was developed by DNA2. 0 and is called Dasher GFP. The promoter driving GFP expression (TPI1) is of similar strength to the TEF-1 promoter that is upstream of the main multiple cloning site.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the expression of the reporter gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 8284 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene GFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Узнать цену -
PSF-TEFI-TPI1-FLUC-URA3 - FIREFLY LUCIFERASE YEAST VECTOR OGS545-5UG
NACRES: NA.85 General descriptionA dual transgene Saccharomyces cerevisiae yeast expression plasmid that allows the co-expression of luciferase alongside a gene of interest. The vector also contains a gene that is essential for uracil synthesis allowing the plasmids to be maintained in cells that are defective for this gene when they are grown in media that is missing uracil.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the expression of the reporter gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 9226 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene firefly luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-HYGRO - HYGROMYCIN RESISTANT YEAST PLASMID OGS540-5UG
NACRES: NA.85 General descriptionA hygromycin resistant yeast plasmid for the expression of proteins in Saccharomyces cerevisiae from the TEF1 strong constitutive promoter. The plasmid can be grown in media containing hygromycin to maintain the vector.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the antibiotic resistance gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7486 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-ILUMENA - SECRETED LUCIFERASE YEAST VECTOR OGS551-5UG
NACRES: NA.85 General descriptionPSF-TEFI-TPI1-ILUMENA - SECRETED LUCIFERASE YEAST VECTOR plasmid encodes a secreted luciferase reporter gene (iLumena) that allows for the measurement of plasmid activity in the supernatant of cell cultures from Saccharomyces cerevisiae yeast. This reporter is unique to our product range. The reporter uses coelenterazine as the substrate and substrates desgiend for guassia luciferase will work well with this reporter. Reporter gene expression is driven from the TPI1 cassette. There is a TEF1 promoter upstream of the multiple cloning site to drive the expression of a gene of intererst. These promoters show similar levels of expression. The plasmid is maintained in yeast cells using the URA3 selection method whereby the yeast strain used is defective for this gene (which is essential for uracil synthesis) and the cells are grown in uracil deficient media.
Promoter Expression Level: This molecular cloning vector contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the expression of the reporter gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 8209 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene iLumena luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-NEO/G418 - G418 YEAST SELECTION PLASMID OGS542-5UG
NACRES: NA.85 General descriptionThis is a yeast expression plasmid containing the strong TEF1 constitutive promoter that allows for the expression of transgenes in Saccharomyces cerevisiae. The vector also contains a resistance gene for G418 and allows plasmids to be selected and grown in yeast cells using this antibiotic.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the antibiotic resistance gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7252 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-PURO - PUROMYCIN SELECTION YEAST PLASMID OGS541-5UG
NACRES: NA.85 General descriptionPSF-TEFI-TPI1-PURO - puromycin selection yeast plasmid is a Saccharomyces cerevisiae expression vector with puromycin resistance. This plasmid vector allows the expression of transgene using the strong constitutive TEF1 promoter. The vector also contains the resistance marker for puromycin to allow the growth and selection of cells containing the plasmid. Resistance is driven by the constitutive TPI1 yeast promoter.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the antibiotic resistance gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: PSF-TEFI-TPI1-PURO - puromycin selection yeast plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7057 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-RLUC-URA3 - RENILLA LUCIFERASE YEAST PLASMID OGS546-5UG
General descriptionA renilla luciferase Saccharomyces cerevisiae yeast plasmid that allows the co-expression of a gene of interest alongside the luciferase reporter. The vector also contains the URA3 selection cassette that allows the plasmid to be grown in cells that are defective for this gene when they are grown in uracil deficient media.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the expression of the reporter gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 8512 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-YFP-URA3 - YEAST YFP REPORTER PLASMID OGS549-5UG
NACRES: NA.85 General descriptionA yellow fluorescent protein (YFP) expression vector that eneables the co-expression of a gene of interest alongside the reporter. The plasmid also encodes the URA3 gene which is essential for uracil synthesis. This allows the plasmid to be maintained in cells in urcail deficient media. The cells must be deleted for the endogenous URA3 cassette to allow selection. The YFP reporter gene is called Kringle YFP and was developed by DNA2. 0. Reporter expression is controlled by the TPI promoter and transgene expression is controlled by the TEF1 promoter. These promoters demonstrate similar levels of expression.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the expression of the reporter gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 8284 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene YFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TPI1-ZEO - ZEOCIN YEAST SELECTION VECTOR OGS543-5UG
NACRES: NA.85 General descriptionThis plasmid can be used for the expression of transgenes in Saccharomyces cerevisiae under the control of the constitutive TEF1 yeast promoter. The vector also contains a resistance gene that allows for cells containing the plasmid to be selected using the antibiotic zeocin. The vector contains our standard multiple cloning site that allows you to clone in a transgene of interest.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae. It also contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter to drive the antibiotic resistance gene. The TPI promoter demonstrates similar levels of expression to the translation elongation factor 1 promoter (TEF-1).ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6832 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-TRP1 - TRYTOPHAN YEAST SELECTION PLASMID OGS532-5UG
NACRES: NA.85 General descriptionAn expression vector designed for the production of proteins in Saccharomyces cerevisiae in the absence of tryptophan. The expression of a gene of interest is controlled by the strong yeast TEF-1 constitutive promoter. The vector also contains a gene that is essential for the production of the amino acid tryptophan. It can be used in yeast cells that are deficient in this gene to select for cells carrying the plasmid when plated onto media that does not contain tryptophan. Other metabolic selection options are available in our product range including leucine uracil and histidine selection. We also provide standard selection options such as puromycin and hygromycin resistance.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6626 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEFI-URA3 - URACIL YEAST SELECTION PLASMID OGS534-5UG
NACRES: NA.85 General descriptionPSF-TEFI-URA3 – uracil yeast selection plasmid is a yeast expression plasmid vector containing the yeast EF1a strong constitutive promoter and the URA3 selection marker to allow growth in the absence of uracil. PSF-TEFI-URA3 – uracil yeast selection expression plasmid is designed for the production proteins in Saccharomyces cerevisiae with selection on media that is deficient in the metabolite uracil. The vector contains the constitutive TEF1 yeast promoter to drive the expression of a gene of interest. It also contains a gene that is an essential component of the uracil synthesis pathway. This allows the plasmid to be maintained in yeast cells that have this gene deleted on media that does not contain uracil. This is the most commonly used selection method for Saccharomyces cerevisiae. We also provide other metabolite selection yeast plasmids that use histidine leucine or tryptophan as the selection method. We also provide plasmids using small molecule selection such as puromycin and blasticidin.
Promoter Expression Level: This plasmid contains the yeast translation elongation factor 1 promoter. It is the strongest promoter that we provide for expression in Saccharomyces cerevisiae.ApplicationCloning in a gene: PSF-TEFI-URA3 – uracil yeast selection plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6720 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TPI1-URA3 - STRONG PROMOTER YEAST PLASMID OGS538-5UG
NACRES: NA.85 General descriptionA strong promoter (TPI1) Saccharomyces cerevisiae yeast expression plasmid for expressing proteins of interest. The vector can be selected using the URA3 metabolite cassette that allows the plasmid to be selected for in cells deficient this gene when they are grown on media that does not contain uracil.
Promoter Expression Level: This plasmid contains the strong yeast constitutive triosephosphate isomerase (TPI1) gene promoter. It demonstrates similar levels of expression to the translation elongation factor 1 promoter.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
SequenceПараметрыform buffered aqueous solution mol wt size 7023 bp Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-U6 - SIRNA/RNAI EXPRESSION PLASMID OGS51-5UG
NACRES: NA.85 General descriptionThe expression of short hairpin RNA in eukaryotic cells. The U6 is transcribed by RNA polymerase III (RNA pol III) which terminates transcription at a string of thymidine residues typically a minimum of five residues in mammalian cells. Unlike most of our vectors, this vector contains an RNA pol III terminator downstream of the XhoI site although it is more common to insert a terminator sequence at the end of the sequence you insert into the MCS that encodes a shRNA.
Promoter Expression Level:ApplicationMultiple cloning site notes: This vector has a modified MCS compared to standard plasmids. The ATG start codon in the NcoI site has been removed as have the Shine-Dalgarno and KOZAK sequences as these are not required for RNA Pol3 expressed transcripts.
The terminator for RNA polymerase III has been positioned immediately downstream of the XhoI site. There is an additional string of Thymidine residues (the terminator sequence for RNA Pol III) at the end of the SV40 polyA region however using this site will produce a long transcript and has not been validated. We recommend inserting your hairpin DNA sequence between Hind3 and XhoI. The theoretical RNA position +1 is the first base of the NotI restriction site.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 3932 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: U6
Promoter activity: siRNA
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-UB - UBIQUITIN PROMOTER EXPRESSION PLASMID OGS46-5UG
NACRES: NA.85 General descriptionPSF-UB – ubiquitin promoter expression plasmid contains the Ub promoter upstream of the multiple cloning site (MCS) for expression in mammalian cells. Transcription termination is mediated by the SV40 poly-adenylation signals downstream of the MCS.
Promoter Expression Level:ApplicationCloning in a gene: PSF-UB – ubiquitin promoter expression plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 4880 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: ubiquitin
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
pT7 MAT-Tag® FLAG®-1 Expression Vector E5155-10UG
NACRES: NA.32 ApplicationCytoplasmic expression of N-terminal MAT-Tag®-FLAG dual tagged fusion proteins under the T7/lac promoter.Other NotesSupplied with a pT7-FLAG-MAT™-1+BAP Control Vector.
Browse additional application references in our FLAG® Literature, portal.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
MAT-Tag is a registered trademark of Sigma-Aldrich Co. LLC
pT7-FLAG-MAT is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, concentration 0.5 mg/mL shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Узнать цену -
pT7-FLAG™-2 Expression Vector P1243-10UG
NACRES: NA.85 General descriptionpT7-FLAG-2 is a 4.8 kb E . coli expression vector used for cloning and cytoplasmic expression of a properly inserted open reading frame as a C-terminal FLAG® fusion protein containing the FLAG epitope (DYKDDDDK). The promoter region of the very strong phage T7 promoter drives transcription of ORFFLAG fusion constructs. This vector requires the use of E. coli cells containing a source of the T7 polymerase, such as BL21(DE3)T1R cells, Catalog Number B2935.
The C-terminal FLAG fusion protein may be detected using Monoclonal ANTI-FLAG?M2, Catalog Number
F3165, and purified using the ANTI-FLAG M2 Affinity Gel, Catalog Number A2220.
Vector Maps and Sequences
Components- pT7-FLAG-2 Expression Vector, 10 µg (P6867) is supplied as 0.5 mg/ml in 10 mM Tris-HCl (pH 8.0) with 1 mM EDTA.
- pT7-FLAG-2-BAP Control Vector 1 µg ( P7117) is supplied as 0.5 mg/ml in 10 mM Tris-HCl (pH 8.0) with 1 mM EDTA.
Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
pT7-FLAG is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, grade for molecular biology shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Узнать цену -
pT7-FLAG™-4 Expression Vector
NACRES: NA.32
Кат. номер P9743-10UG P9743-20UG ApplicationpT7-FLAGa-4 is a 6451 bp Escherichia coli expression vector used for cloning and cytoplasmic expression of a properly inserted open reading frame as a C-terminal FLAG fusion protein containing the FLAG epitope (DYKDDDDK). The promoter region of the very strong phage T7 promoter drives transcription of ORF-FLAG fusion constructs.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
pT7-FLAG is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Узнать цену -
pT7-FLAG™-MAT-Tag®-2 Expression Vector E5030-10UG
NACRES: NA.32 ApplicationCytoplasmic expression of C-terminal FLAG®-MAT-Tag® dual tagged fusion proteins under the T7/lac promoter.
Browse additional application references in our FLAG® Literature, portal.Other NotesSupplied with a pT7-FLAG-MAT™-1+BAP Control Vector.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
MAT-Tag is a registered trademark of Sigma-Aldrich Co. LLC
pT7-FLAG is a trademark of Sigma-Aldrich Co. LLC
pT7-FLAG-MAT is a trademark of Sigma-Aldrich Co. LLCПараметрыQuality Level 200, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
