Cloning & Expression
- Сортировать:
- Вид таблицей
-
PSF-TEF1-COOH-3C-FLAG® - C-TERMINAL FLAG® TAG YEAST PLASMID OGS1924-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Flag affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6765 bp conjugate FLAG® tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-FLAG®-6HIS - C-TERMINAL 6 HIS AND FLAG® DUAL TAG YEAST PLASMID OGS1977-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal FLAG epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6783 bp conjugate 6-His tagged, FLAG® tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-FLUC-6HIS - C-TERMINAL 6 HIS AND FLUC DUAL TAG YEAST PLASMID OGS2032-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Firefly luciferase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 8406 bp conjugate 6-His tagged, firefly luciferase conjugate Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene firefly luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-GST - C-TERMINAL GST TAG YEAST PLASMID OGS1927-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7395 bp conjugate GST tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-GST-6HIS - C-TERMINAL 6 HIS AND GST DUAL TAG YEAST PLASMID OGS1980-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7413 bp conjugate 6-His tagged, GST tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-HA - C-TERMINAL HA TAG YEAST PLASMID OGS1926-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6768 bp conjugate Hemagglutinin A (HA) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-HA-6HIS - C-TERMINAL 6 HIS AND HA DUAL TAG YEAST PLASMID OGS1979-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6786 bp conjugate 6-His tagged, Hemagglutinin A (HA) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-KRYFP-6HIS - C-TERMINAL 6 HIS AND YFP DUAL TAG YEAST PLASMID OGS2030-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7464 bp conjugate 6-His tagged, yellow fluorescent protein (YFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene YFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-MBP - C-TERMINAL MBP TAG YEAST PLASMID OGS1931-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7845 bp conjugate maltose-binding protein (MBP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-MBP-6HIS - C-TERMINAL 6 HIS AND MBP DUAL TAG YEAST PLASMID OGS1984-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7863 bp conjugate 6-His tagged, maltose-binding protein (MBP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-RLUC-6HIS - C-TERMINAL 6 HIS AND RLUC DUAL TAG YEAST PLASMID OGS2031-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Renilla luciferase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7692 bp conjugate 6-His tagged, Renilla luciferase conjugate Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-T7 - C-TERMINAL T7 TAG YEAST PLASMID OGS1929-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal T7 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: MASMTGGQQMG.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6774 bp conjugate T7 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-T7-6HIS - C-TERMINAL 6 HIS AND T7 DUAL TAG YEAST PLASMID OGS1982-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal T7 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: MASMTGGQQMG. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6792 bp conjugate 6-His tagged, T7 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-3C-V5-6HIS - C-TERMINAL 6 HIS AND V5 DUAL TAG YEAST PLASMID OGS3453-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6801 bp conjugate 6-His tagged, V5 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage 3C Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-BETAGAL - C-TERMINAL BETA GAL TAG YEAST PLASMID OGS2040-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Beta Galactosidase reporter tag that can be fused to a gene of interest to allow protein detection.
About the Cleavage Tag: This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 8364 bp conjugate beta-galactosidase tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene beta Gal shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-CMYC - C-TERMINAL C-MYC TAG YEAST PLASMID OGS3459-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal CMyc epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EQKLISEEDL.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6747 bp conjugate c-Myc tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-DAGFP - C-TERMINAL DAGFP TAG YEAST PLASMID OGS2035-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based green fluorescent protein (daGFP) reporter tag that can be fused to a gene of interest to allow protein detection.
About the Cleavage Tag: This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7413 bp conjugate green fluorescent protein (GFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene GFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Узнать цену -
PSF-TEF1-COOH-EKT-10HIS - C-TERMINAL 10HIS TAG YEAST PLASMID OGS1932-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Deca-Histidine (10His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6762 bp conjugate 10-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS - C-TERMINAL 6 HIS TAG YEAST PLASMID OGS3441-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6750 bp conjugate 6-His tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS-CMYC - C-TERMINAL CMYC AND 6 HIS DUAL TAG YEAST PLASMID OGS1942-5UG
General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH. This plasmid also contains a secondary CMyc protein tag. The sequence of this tag is: EQKLISEEDLWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6780 bp conjugate 6-His tagged, c-Myc tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS-FLAG® - C-TERMINAL FLAG® AND 6 HIS DUAL TAG YEAST PLASMID OGS1941-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH. This plasmid also contains a secondary Flag protein tag. The sequence of this tag is: DYKDDDDKWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6774 bp conjugate 6-His tagged, FLAG® tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS-GST - C-TERMINAL GST AND 6 HIS DUAL TAG YEAST PLASMID OGS1944-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH. This plasmid also contains a secondary Glutathione-S-Transferase (GST) protein tag. The sequence of this tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7404 bp conjugate 6-His tagged, GST tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS-HA - C-TERMINAL HA AND 6 HIS DUAL TAG YEAST PLASMID OGS1943-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH. This plasmid also contains a secondary Influenza Hemagglutinin (HA) protein tag. The sequence of this tag is: YPYDVPDYAWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6777 bp conjugate 6-His tagged, Hemagglutinin A (HA) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS-MBP - C-TERMINAL MBP AND 6 HIS DUAL TAG YEAST PLASMID OGS1940-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH. This plasmid also contains a secondary Maltose Binding Protein (MBP) protein tag. The sequence of this tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7854 bp conjugate 6-His tagged, maltose-binding protein (MBP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS-T7 - C-TERMINAL T7 AND 6 HIS DUAL TAG YEAST PLASMID OGS1938-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH. This plasmid also contains a secondary T7 protein tag. The sequence of this tag is: MASMTGGQQMGWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6783 bp conjugate 6-His tagged, T7 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-6HIS-V5 - C-TERMINAL V5 AND 6 HIS DUAL TAG YEAST PLASMID OGS3447-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH. This plasmid also contains a secondary V5 protein tag. The sequence of this tag is: GKPIPNPLLGLDSTWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6774 bp conjugate 6-His tagged, V5 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-BETAGAL-6HIS - C-TERMINAL 6 HIS AND BETA GAL DUAL TAG YEAST PLASMID OGS1998-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Beta Galactosidase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 9891 bp conjugate 6-His tagged, beta-galactosidase tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene beta Gal shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-CMYC - C-TERMINAL CMYC TAG YEAST PLASMID OGS3443-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal CMyc epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EQKLISEEDL.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6762 bp conjugate c-Myc tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-CMYC-6HIS - C-TERMINAL 6 HIS AND CMYC DUAL TAG YEAST PLASMID OGS1986-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal CMyc epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EQKLISEEDL. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6780 bp conjugate 6-His tagged, c-Myc tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-FLAG® - C-TERMINAL FLAG® TAG YEAST PLASMID OGS3442-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Flag affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6756 bp conjugate FLAG® tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-FLAG®-6HIS - C-TERMINAL 6 HIS AND FLAG® DUAL TAG YEAST PLASMID OGS1985-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal FLAG epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6774 bp conjugate 6-His tagged, FLAG® tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-FLUC-6HIS - C-TERMINAL 6 HIS AND FLUC DUAL TAG YEAST PLASMID OGS1997-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Firefly luciferase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 8397 bp conjugate 6-His tagged, firefly luciferase conjugate Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene firefly luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-FRCFP-6HIS - C-TERMINAL 6 HIS AND CFP DUAL TAG YEAST PLASMID OGS1994-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based cyan/blue fluorescent protein (FrCFP) reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7455 bp conjugate 6-His tagged, cyan fluorescent protein (CFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene CFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-GST - C-TERMINAL GST TAG YEAST PLASMID OGS3445-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7386 bp conjugate GST tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-GST-6HIS - C-TERMINAL 6 HIS AND GST DUAL TAG YEAST PLASMID OGS1988-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7404 bp conjugate 6-His tagged, GST tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-HA - C-TERMINAL HA TAG YEAST PLASMID OGS3444-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6759 bp conjugate Hemagglutinin A (HA) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-HA-6HIS - C-TERMINAL 6 HIS AND HA DUAL TAG YEAST PLASMID OGS1987-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6777 bp conjugate 6-His tagged, Hemagglutinin A (HA) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-KRYFP-6HIS - C-TERMINAL 6 HIS AND YFP DUAL TAG YEAST PLASMID OGS1995-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7455 bp conjugate 6-His tagged, yellow fluorescent protein (YFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene YFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-MBP - C-TERMINAL MBP TAG YEAST PLASMID OGS1936-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7836 bp conjugate maltose-binding protein (MBP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-MBP-6HIS - C-TERMINAL 6 HIS AND MBP DUAL TAG YEAST PLASMID OGS1992-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7854 bp conjugate 6-His tagged, maltose-binding protein (MBP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-RLUC-6HIS - C-TERMINAL 6 HIS AND RLUC DUAL TAG YEAST PLASMID OGS1996-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Renilla luciferase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7683 bp conjugate 6-His tagged, Renilla luciferase conjugate Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-T7 - C-TERMINAL T7 TAG YEAST PLASMID OGS1934-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal T7 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: MASMTGGQQMG.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6765 bp conjugate T7 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-T7-6HIS - C-TERMINAL 6 HIS AND T7 DUAL TAG YEAST PLASMID OGS1990-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal T7 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: MASMTGGQQMG. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6783 bp conjugate 6-His tagged, T7 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-V5 - C-TERMINAL V5 TAG YEAST PLASMID OGS3446-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal V5 affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6774 bp conjugate V5 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-EKT-V5-6HIS - C-TERMINAL 6 HIS AND V5 DUAL TAG YEAST PLASMID OGS3454-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6792 bp conjugate 6-His tagged, V5 tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage EKT Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-FLAG® - C-TERMINAL FLAG® TAG YEAST PLASMID OGS3458-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal FLAG epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Analysis NoteLegal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLCПараметрыform buffered aqueous solution mol wt size 6741 bp conjugate FLAG® tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-FLUC - C-TERMINAL FLUC TAG YEAST PLASMID OGS2039-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Firefly luciferase reporter tag that can be fused to a gene of interest to allow protein detection.
About the Cleavage Tag: This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7650 bp conjugate firefly luciferase conjugate Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene firefly luciferase shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-TEF1-COOH-FRCFP - C-TERMINAL CFP TAG YEAST PLASMID OGS2036-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based cyan/blue fluorescent protein (FrCFP) reporter tag that can be fused to a gene of interest to allow protein detection.
About the Cleavage Tag: This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7422 bp conjugate cyan fluorescent protein (CFP) tagged Origin of replication 2Micron, pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeastbacteria selection kanamycin reporter gene CFP shipped in ambient storage temp. 20°C yeast selection uracil
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
