Cloning & Expression
- Сортировать:
- Вид таблицей
-
PSF-CMV-PURO-NH2-HIS10 - N-TERMINAL 10 HIS TAG MAMMALIAN PLASMID OGS3210-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Deca-Histidine (10His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHHHHHH.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6179 bp conjugate 10-His tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-HIS6 - N-TERMINAL 6 HIS TAG MAMMALIAN PLASMID OGS3211-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6167 bp conjugate 6-His tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-IL-2 - INTERLEUKIN-2 SECRETION PLASMID OGS1497-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Interleukin-2 (IL-2) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6185 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human IL-2 bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP - INSULIN SECRETION PLASMID OGS1436-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6215 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-10HIS - INSULIN SECRETION AND 10HIS TAG PLASMID OGS1428-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Deca-Histidine (10His) protein tag. The sequence of this tag is: HHHHHHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6245 bp conjugate 10-His tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-6HIS - INSULIN SECRETION AND 6 HIS TAG PLASMID OGS1427-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6233 bp conjugate 6-His tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-6HIS-3C - INSULIN SECRETION AND 6 HIS TAG PLASMID OGS1384-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6257 bp conjugate 6-His tagged Origin of replication pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-6HIS-TEV - INSULIN SECRETION AND 6 HIS TAG PLASMID OGS1379-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Hexa-Histidine (6His) protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6254 bp conjugate 6-His tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-CMYC-3C - INSULIN SECRETION AND CMYC TAG PLASMID OGS1396-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary C-Myc protein tag. The sequence of this tag is: EQKLISEEDLWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6269 bp conjugate c-Myc tagged Origin of replication pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-FLAG®-3C - INSULIN SECRETION AND FLAG® TAG PLASMID OGS1408-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary FLAG protein tag. The sequence of this tag is: DYKDDDDKWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6263 bp conjugate FLAG® tagged Origin of replication pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-FLAG®-EKT - INSULIN SECRETION AND FLAG® TAG PLASMID OGS1404-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary FLAG protein tag. The sequence of this tag is: DYKDDDDKWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteLegal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLCПараметрыform buffered aqueous solution mol wt size 6254 bp conjugate FLAG® tagged Origin of replication pUC (500 copies) Peptide cleavage EKT Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-FLAG®-TEV - INSULIN SECRETION AND FLAG® TAG PLASMID OGS1403-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary FLAG protein tag. The sequence of this tag is: DYKDDDDKWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6260 bp conjugate FLAG® tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-HA-3C - INSULIN SECRETION AND HA TAG PLASMID OGS1402-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Influenza Hemagglutinin (HA) protein tag. The sequence of this tag is: YPYDVPDYAWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6266 bp conjugate Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-HA-EKT - INSULIN SECRETION AND HA TAG PLASMID OGS1398-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Influenza Hemagglutinin (HA) protein tag. The sequence of this tag is: YPYDVPDYAWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6257 bp conjugate Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage EKT Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-HA-TEV - INSULIN SECRETION AND HA TAG PLASMID OGS1397-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Influenza Hemagglutinin (HA) protein tag. The sequence of this tag is: YPYDVPDYAWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6263 bp conjugate Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-HA-THR - INSULIN SECRETION AND HA TAG PLASMID OGS1400-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary Influenza Hemagglutinin (HA) protein tag. The sequence of this tag is: YPYDVPDYAWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6260 bp conjugate Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-V5-3C - INSULIN SECRETION AND V5 TAG PLASMID OGS1390-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary V5 protein tag. The sequence of this tag is: GKPIPNPLLGLDSTWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6281 bp conjugate V5 tagged Origin of replication pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-V5-EKT - INSULIN SECRETION AND V5 TAG PLASMID OGS1386-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary V5 protein tag. The sequence of this tag is: GKPIPNPLLGLDSTWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6272 bp conjugate V5 tagged Origin of replication pUC (500 copies) Peptide cleavage EKT Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-INSULINSP-V5-TEV - INSULIN SECRETION AND V5 TAG PLASMID OGS1385-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an Human Insulin (iSP) secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases. This plasmid also contains a secondary V5 protein tag. The sequence of this tag is: GKPIPNPLLGLDSTWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6278 bp conjugate V5 tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal human Insulin bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-KRYFP - N-TERMINAL YFP TAG MAMMALIAN PLASMID OGS1367-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6854 bp conjugate yellow fluorescent protein (YFP) tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene YFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-MBP - N-TERMINAL MBP TAG MAMMALIAN PLASMID OGS3220-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7253 bp conjugate maltose-binding protein (MBP) tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-MBP-TEV - N-TERMINAL MBP TAG MAMMALIAN PLASMID OGS3195-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is:EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7274 bp conjugate maltose-binding protein (MBP) tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-RLUC - N-TERMINAL RLUC TAG MAMMALIAN PLASMID OGS1369-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Renilla luciferase reporter tag that can be fused to a gene of interest to allow protein detection.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7082 bp conjugate Renilla luciferase conjugate Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-STREP-EKT - N-TERMINAL STREP TAG MAMMALIAN PLASMID OGS1159-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Strep affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: WSHPQFEK.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6188 bp conjugate streptavidin conjugate Origin of replication pUC (500 copies) Peptide cleavage EKT Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-STREP-TEV - N-TERMINAL STREP TAG MAMMALIAN PLASMID OGS1131-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Strep affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: WSHPQFEK.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6194 bp conjugate streptavidin conjugate Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-V5 - N-TERMINAL V5 TAG MAMMALIAN PLASMID OGS3212-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6191 bp conjugate V5 tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-V5-TEV - N-TERMINAL V5 TAG MAMMALIAN PLASMID OGS3194-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6212 bp conjugate V5 tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-VSV G - VSV G SECRETION PLASMID OGS1495-5UG
NACRES: NA.85 General descriptionPSF-CMV-PURO-NH2-VSV G - VSV G secretion plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:PSF-CMV-PURO-NH2-VSV G - VSV G secretion plasmid contains a Vesicular Stomatitis Virus G (VSVG) protein secretory signal peptide (SP) to allow proteins to be exported from the cytosol. During translocation from the cytosol the signal peptide is removed from the protein by endogenous proteases.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
N-terminal Vesicular Stomatitis Virus (VSV) G secretory signal peptide plasmid. This mammalian expression vector has no protease or other cleavage tags.
Transcription Termination:
This plasmid contains three alternative transcription terminators for mammalian bacterial and bacteriophage (T7) expression. This means that only the promoter needs to be changed to alter the expression system you are using. We sell multiple promoters that can be used in each of these systems. The presence of each terminator does not reduce expression in the alternative systems.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6191 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianSecretion signal VSV G bacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RAT-IGG1 HC - RAT IGG1 HEAVY CHAIN ANTIBODY PLASMID OGS524-5UG
NACRES: NA.85 General descriptionThis plasmid is designed for the generation and expression of heavy chain rat (Rattus rattus) immunoglobulin antibody genes. The vector has been formatted so that it can be cleaved to produce a restriction site overhang (using BseRI) within the first codon of the antibody constant region. This allows the variable regions of antibodies to be inserted to create full length heavy chain expression cassettes. As part of this product range we also have antibody vectors for the production of mouse and human antibodies as well as plasmids for the production of rat Kappa and Lambda antibody light chains (pSF-CMV-Rat-Kappa and pSF-CMV-Rat-Lambda respectively).
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationThe plasmid encodes a constant region an antibody in the main multiple cloning site positioned so that it can be cleaved to produce an overhang that allows seamless fusion with a variable region from any antibody. This allows you to create full length antibody genes with no cloning scars.
To enable this immediately upstream of the constant region coding sequence there is a BseRI restriction site. This is a type-IIS restriction enzyme that binds in one position (CAGCAG) and then cleaves a specific number of nucleotides away from the binding site regardless of the sequence at the cleavage point. We use this site in all of our antibody expression cassettes in the same position. In this plasmid cutting with BseRI will result in an overhang consisting of the first two nucleotides of the first codon of the constant region. This means that any variable region with the same overhang at its 3 prime end can be ligated into this plasmid when used in conjunction with any 5 prime site (NotI-NcoI). To add this overhang the variable region must be PCR amplified to contain any of the following sites at its 3 prime end: BseRI BsgI BtsI or BsrDI. By using this system it allows antibody variable regions to PCR amplified and fused to any of our constant region plasmids without having to re-synthesise the entire antibody expression cassette each time.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5236 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RAT-KAPPA LC - RAT KAPPA LIGHT CHAIN ANTIBODY PLASMID OGS525-5UG
General descriptionThis vector is for the production of kappa antibody light chains for rat (Rattus rattus). It has been engineered so that when the vector is cut with the restriction enzyme BseRI it produces an overhang from the first codon of the constant region. This allows antibody light chain variable regions to be seamlessly ligated into this vector to create full length rat kappa light chain antibody expression cassettes. As part of this vector range we also provide plasmids for the production of both human and mouse antibodies as well as vectors for the creation of Heavy IgG chain and Lambda light chain rat antibodies (named pSF-CMV-Rat-IgG HC and pSF-CMV-Rat-Lambda respectively)
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationThe plasmid encodes a constant region an antibody in the main multiple cloning site positioned so that it can be cleaved to produce an overhang that allows seamless fusion with a variable region from any antibody. This allows you to create full length antibody genes with no cloning scars.
To enable this immediately upstream of the constant region coding sequence there is a BseRI restriction site. This is a type-IIS restriction enzyme that binds in one position (CAGCAG) and then cleaves a specific number of nucleotides away from the binding site regardless of the sequence at the cleavage point. We use this site in all of our antibody expression cassettes in the same position. In this plasmid cutting with BseRI will result in an overhang consisting of the first two nucleotides of the first codon of the constant region. This means that any variable region with the same overhang at its 3 prime end can be ligated into this plasmid when used in conjunction with any 5 prime site (NotI-NcoI). To add this overhang the variable region must be PCR amplified to contain any of the following sites at its 3 prime end: BseRI BsgI BtsI or BsrDI. By using this system it allows antibody variable regions to PCR amplified and fused to any of our constant region plasmids without having to re-synthesise the entire antibody expression cassette each time.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 4576 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RAT-LAMBDA LC - RAT LAMBDA LIGHT CHAIN ANTIBODY VECTOR OGS526-5UG
NACRES: NA.85 General descriptionThis cloning plasmid is designed for the production and expression of rat (Rattus rattus) lambda light chain antibody genes. The constant region of the antibody lambda gene has been positioned adjacent to a BseRI restriction site in this plasmid which when cleaved produces an overhang within the first codon of the antibody gene. This allows variable regions of antibodies to be cloned in creating seamless fusion between the the variable and constant regions. As part of this product range we can also provide expression plasmids for both human and mouse antibodies as well as cloning vectors for rat IgG heavy chain and Kappa light chain (pSF-CMV-Rat-IgG HC and pSF-CMV-Rat-Kappa respectively).
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationThe plasmid encodes a constant region an antibody in the main multiple cloning site positioned so that it can be cleaved to produce an overhang that allows seamless fusion with a variable region from any antibody. This allows you to create full length antibody genes with no cloning scars.
To enable this immediately upstream of the constant region coding sequence there is a BseRI restriction site. This is a type-IIS restriction enzyme that binds in one position (CAGCAG) and then cleaves a specific number of nucleotides away from the binding site regardless of the sequence at the cleavage point. We use this site in all of our antibody expression cassettes in the same position. In this plasmid cutting with BseRI will result in an overhang consisting of the first two nucleotides of the first codon of the constant region. This means that any variable region with the same overhang at its 3 prime end can be ligated into this plasmid when used in conjunction with any 5 prime site (NotI-NcoI). To add this overhang the variable region must be PCR amplified to contain any of the following sites at its 3 prime end: BseRI BsgI BtsI or BsrDI. By using this system it allows antibody variable regions to PCR amplified and fused to any of our constant region plasmids without having to re-synthesise the entire antibody expression cassette each time.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 4570 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RLUC - CMV RENILLA LUCIFERASE PLASMID OGS103-5UG
NACRES: NA.85 General descriptionThe expression of the Renilla reniformis (Sea Pansy) luciferase reporter gene under the control of the CMV promoter. The luciferase gene is within the primary multiple cloning site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.ApplicationCloning in a gene: This plasmid contains a gene within the main multiple cloning site (NotI-ClaI). Any plasmid that we sell where the gene is this configuration will be located in the exact same position in relation to the start and stop codon of the gene. The only exceptions to this rule are fusions proteins where the fusion gene may be positioned at the front or end of the MCS to allow gene fusion.
By positioning all of our genes in the same location it allows them to be transferred between plasmids using the same cloning method and restriction sites regardless of the plasmid being used from our product range. Inserting a new gene into this plasmid should be easily possible using a range of standard restriction enzyme sites that flank the gene currently in the vector.
Multiple cloning site notes: In the multiple cloning site there are two important restriction sites called BsgI and BseRI sites. These sites both cut the DNA at the same position and cleave the stop codon of the gene in the multiple cloning site in this plasmid thereby producing a TA overhang. This overhang is compatible with any of our peptide or reporter fusion tag plasmids also cut with either of these enzymes. This allows seamless C-terminal fusions to be made with the gene in this multiple cloning site using a single cloning step from our C-terminal peptide and reporter tag product range. Normally the easiest method is to clone the C-terminal tag from our other plasmid products into this plasmid using BsgI or BseRI and the downstream ClaI restriction site.
BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding sites. This allows them to cut the upstream stop codon in the gene in this plasmid regardless of the gene sequence.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5222 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection ampicillin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-BLAST ASCI - RSV PROMOTER BLASTICIDIN PLASMID OGS383-5UG
NACRES: NA.85 General descriptionThis vector contains a blasticidin (blast) resistance gene driven by the RSV promoter that is designed as an add-on to any of our vectors. The entire RSV blast expression cassette is flanked by AscI sites. The RSV promoter is considerably weaker than CMV. We have a stronger Ubiquitin promoter driven vector (pSF-CMV-Ub-Blast AscI) in the same format if you require high levels of reporter gene activity.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5224 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection blasticidin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-FLUC ASCI - FIREFLY LUCIFERASE PLASMID OGS15-5UG
NACRES: NA.85 General descriptionThis plasmid contains a luciferase cassette that is designed as an add-on to any of our other plasmids. The RSV luciferase cassette is flanked by AscI sites but is not designed to be split up. If you would like the luciferase gene alone or the RSV promoter alone please see the reporter gene section or the promoter section on our website. The RSV promoter is considerably weaker than CMV. We have a stronger Ubiquitin promoter driven vector in the same format if you require high levels of reporter gene activity.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6443 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene firefly luciferase shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-FRCFP - RSV PROMOTER CFP PLASMID OGS515-5UG
NACRES: NA.85 General descriptionThis plasmid is dual purpose because it contains the CMV promoter upstream from a multiple cloning site that allows you to insert your own genes and it also contains a Cyan fluorescent reporter gene driven by the human Ubiquitin promoter. The reporter gene was developed by DNA2. 0 and is called Frosty CFP.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. The RSV promoter driving reporter gene expression is one of the weakest mammalian promoters that we provide for many cell types but expression can vary significantly between cell types from different species. For example we have found that the RSV promoter shows significantly lower expression levels in human 293 cells when compared to hamster CHO cells.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5506 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene CFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-ILUMENA - RSV PROMOTER SECRETED LUCIFERASE PLASMID OGS517-5UG
NACRES: NA.85 General descriptionThis vector is designed for the expression of transgenes under the control of the CMV promoter for protein production in mammalian cells. The vector also contains a secreted luciferase reporter gene under the control of the RSV promoter. This allows for the detection of plasmid activity in the supernatant of mammalian cells.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. The RSV promoter driving reporter gene expression is one of the weakest mammalian promoters that we provide for many cell types but expression can vary significantly between cell types from different species. For example we have found that the RSV promoter shows significantly lower expression levels in human 293 cells when compared to hamster CHO cells.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5426 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene iLumena luciferase shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-KRYFP - RSV PROMOTER YFP PLASMID OGS516-5UG
NACRES: NA.85 General descriptionThis plasmid is dual purpose because it contains the CMV promoter upstream of a multiple cloning site that allows you to insert your own genes and it also contains a Cyan fluorescent reporter gene driven by the human Ubiquitin promoter. The reporter gene was developed by DNA2. 0 and is called Frosty CFP.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. The RSV promoter driving reporter gene expression is one of the weakest mammalian promoters that we provide for many cell types but expression can vary significantly between cell types from different species. For example we have found that the RSV promoter shows significantly lower expression levels in human 293 cells when compared to hamster CHO cells.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5501 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene YFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-NEO/G418 ASCI - RSV PROMOTER G418 PLASMID OGS381-5UG
NACRES: NA.85 General descriptionThis vector contains a Neomycin (Neo)/G418 resistance expression cassette under control of the RSV promoter. The entire RSV Neo/G418 cassette is flanked by AscI sites. The RSV promoter is considerably weaker than CMV. We have a stronger Ubiquitin promoter driven vector (pSF-CMV-Ub-Neo/G418 AscI) in the same format if you require high levels of reporter gene activity.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5585 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection neomycin / G418 reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-PURO ASCI - RSV PROMOTER PUROMYCIN PLASMID OGS379-5UG
NACRES: NA.85 General descriptionThis vector contains a puromycin resistance expression cassette that is designed as an add-on to any of our vectors. The entire RSV puromycin cassette is flanked by AscI sites. The RSV promoter is considerably weaker than CMV. We have a stronger Ubiquitin promoter driven vector (pSF-CMV-Ub-Puro AscI) in the same format if you require higher levels of resistance.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5395 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianmammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-RLUC ASCI - RENILLA LUCIFERASE PLASMID OGS16-5UG
NACRES: NA.85 General descriptionThis plasmid contains a renilla luciferase cassette that is designed as an add-on to any of our other plasmids. The RSV Luciferase cassette is flanked by AscI sites but is not designed to be split up. If you would like the renilla luciferase gene alone or the RSV promoter alone please see the reporter gene section or the promoter section on our website. The RSV promoter is considerably weaker than CMV. We have a stronger Ubiquitin promoter driven plasmid in the same format if you require high levels of reporter gene activity.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5729 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-SEAP ASCI - ALKALINE PHOSPHATASE PLASMID OGS17-5UG
NACRES: NA.85 General descriptionThis plasmid contains a Secreted Alkaline Phosphatase (SEAP) cassette that is designed as an add-on to any of our other plasmids. The RSV SEAP cassette is flanked by AscI sites but is not designed to be split up. If you would like the SEAP gene alone or the RSV promoter alone please see the reporter gene section or the promoter section on our website. The RSV promoter is considerably weaker than CMV which can make low abundance SEAP signals difficult to detect. We have a stronger Ubiquitin promoter driven plasmid in the same format if you require higher levels of reporter gene activity.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6356 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene SEAP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-RSV-ZEO ASCI - RSV PROMOTER ZEOCIN PLASMID OGS382-5UG
NACRES: NA.85 General descriptionThis vector contains a zeocin (Zeo) resistance expression cassette that is designed as an add-on to any of our vectors. The entire RSV Zeo expression cassette is flanked by AscI sites. The RSV promoter is considerably weaker than CMV. We have a stronger Ubiquitin promoter driven vector (pSF-CMV-Ub-Zeo AscI) in the same format if you require high levels of reporter gene activity.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteLegal InformationZeocin is a registered trademark of Cayla SarlПараметрыform buffered aqueous solution mol wt size 5170 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection Zeocin® reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-SEAP - CMV SEAP PLASMID OGS105-5UG
NACRES: NA.85 General descriptionThe expression of the human secreted alkaline phosphatase (SEAP) reporter gene under the control of the CMV promoter. The SEAP gene is within the primary multiple cloning site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.ApplicationCloning in a gene: This plasmid contains a gene within the main multiple cloning site (NotI-ClaI). Any plasmid that we sell where the gene is this configuration will be located in the exact same position in relation to the start and stop codon of the gene. The only exceptions to this rule are fusions proteins where the fusion gene may be positioned at the front or end of the MCS to allow gene fusion.
By positioning all of our genes in the same location it allows them to be transferred between plasmids using the same cloning method and restriction sites regardless of the plasmid being used from our product range. Inserting a new gene into this plasmid should be easily possible using a range of standard restriction enzyme sites that flank the gene currently in the vector.
Multiple cloning site notes: In the multiple cloning site there are two important restriction sites called BsgI and BseRI sites. These sites both cut the DNA at the same position and cleave the stop codon of the gene in the multiple cloning site in this plasmid thereby producing a TA overhang. This overhang is compatible with any of our peptide or reporter fusion tag plasmids also cut with either of these enzymes. This allows seamless C-terminal fusions to be made with the gene in this multiple cloning site using a single cloning step from our C-terminal peptide and reporter tag product range. Normally the easiest method is to clone the C-terminal tag from our other plasmid products into this plasmid using BsgI or BseRI and the downstream ClaI restriction site.
BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding sites. This allows them to cut the upstream stop codon in the gene in this plasmid regardless of the gene sequence.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 5849 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection ampicillin reporter gene SEAP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-SNAPFUSION - CMV MAMMALIAN SNAPFUSION EXPRESSION PLASMID OGS603-5UG
NACRES: NA.85 General descriptionThis vector is a standard mammalian expression plasmid with the exception that it has been modified to allow the direct cloning of gene fragments that have been designed to fit with any of our peptide tag plasmid range. This can be useful if you have created a peptide fusion but you would also like to create a non-tagged gene variant. The multiple cloning site contains two BsgI and BseRI sites that produce overhangs that are compatible with gene designed using our SnapFusion primer designer (see the cloning tab for this product).
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 4255 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-SPEC - SPECTINOMYCIN RESISTANT PLASMID OGS7-5UG
NACRES: NA.85 General descriptionThe expression of proteins in mammalian cells from the CMV promoter. This vector also contains a spectinomycin resistance cassette for selection and growth in bacteria.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 4210 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection spectinomycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-SV40 ORI SBFI - SV40 ORIGIN PLASMID OGS114-5UG
NACRES: NA.85 General descriptionA versatile cloning vector for the expression of genes in mammalian cells. This vector also contains the origin of replication from Simian Virus 40 (SV40) which enables it to be replicated in cells that express the SV40 large T antigen (such as 293T cells). The SV40 origin can be used to increase the level of transcription in cells that are transfected with the plasmid because the plasmid is replicated. It is also reported that by using selectable markers in conjunction with the SV40 origin stable cell lines can be produced. However we have not validated it for this purpose. We currently sell a range of antibiotic selection genes that can be used for this purpose in a range of positions within our vector system. In this vector the SV40 origin is inserted within the SbfI site and is flanked by two SbfI sites.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.Analysis NoteПараметрыform buffered aqueous solution mol wt size 4436 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-SV40 PA - SV40 POLYA SINGLE TERMINATOR PLASMID OGS176-5UG
NACRES: NA.85 General descriptionA versatile cloning vector for the expression of genes in mammalian cells using the CMV immediate early promoter.
Promoter Expression Level: This expression vector contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: PSF-CMV-SV40 PA - SV40 POLYA SINGLE TERMINATOR PLASMID has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 4008 bp Origin of replication pUC (500 copies) Peptide cleavage no cleavage Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-SV40E SBFI - SV40 ENHANCER PLASMID OGS112-5UG
NACRES: NA.85 General descriptionA versatile cloning vector for the expression of genes in mammalian cells. This vector also contains the enhancer from Simian Virus 40 (SV40) inserted into the SbfI site. The enhancer is downstream of the terminators in the SnapFast vector but it is upstream of the 3 prime insulator sequence. In this vector the presence of the enhancer does not significantly enhance expression however this is likely to be due to the high level of expression mediated by the CMV promoter which already contains an enhancer region. The SV40 enhancer is provided in this vector backbone to enable it to be transferred into any vectors with weaker promoters to increase expression. If you would like the SV40 enhancer transferring into any of our other vectors please contact us for more information.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.ApplicationCloning in a gene: This plasmid has been designed to be compatible with a range of cloning techniques. The multiple cloning site contains a range of standard commonly used restriction sites for cloning. Using these sites genes can be inserted using standard cloning methods with DNA ligase. Other methods such as ligase independent cloning (LIC) Gibson Assembly InFusionHD or Seamless GeneArt can also be used and because all of our plasmids are based on the same backbone the same method can be used for cloning into all of our catalogue vectors.
Multiple cloning site notes: There are a few important sites within the MCS. These include the NcoI site the XbaI site and the BsgI and BseRI sites. The NcoI site contains a start codon that is immediately downstream of both a Kozak and Shine-Dalgarno ribosomal binding site. These allow for optimal positioning of genes when the start codon is placed in this location. If this is not required and you wish to use a downstream site for gene cloning you can remove the NcoI site by cleaving the plasmid with KpnI.
The XbaI site contains a stop codon. This stop codon is positioned in a specific position in relation to the BsgI and BseRI sites that are immediately downstream. When either BseRI or BsgI cleave the plasmid they produce a TA overhang from the stop codon in the XbaI site that is compatible with all of our peptide tag plasmids cut with the same sites. BseRI and BsgI sites are non-palindromic and cleave a defined number of bases away from their binding site.
Whenever we clone a gene into our multiple cloning site we always position the start and stop codon in the same positions in the MCS. If the start and ends of the genes are not compatible with NcoI and XbaI we extend the sequence to the nearest external sites but keep the start and stop codons locations consistent.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 4503 bp Peptide cleavage no cleavage reporter gene none shipped in ambient storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
