Cloning & Expression
- Сортировать:
- Вид таблицей
-
PSF-CMV-PURO-COOH-FRCFP - C-TERMINAL CFP TAG MAMMALIAN PLASMID OGS1366-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based cyan/blue fluorescent protein (FrCFP) reporter tag that can be fused to a gene of interest to allow protein detection.
About the Cleavage Tag: This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Analysis NoteOther NotesOXGENEs technology platforms and expert solutions accelerate the discovery, development and manufacture of cell and gene therapies. We work with you to express your gene of interest at scale, with high levels of purity. In addition, our integrated bioinformatics and high-throughput gene editing technology creates a streamlined workflow for automated cell line production. learn more at www.oxgene.com ,Параметрыform buffered aqueous solution mol wt size 6855 bp conjugate cyan fluorescent protein (CFP) tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene CFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-GST - C-TERMINAL GST TAG MAMMALIAN PLASMID OGS3426-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6804 bp conjugate GST tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-HA - C-TERMINAL HA TAG MAMMALIAN PLASMID OGS3425-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6177 bp conjugate Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-HIS6 - C-TERMINAL 6 HIS TAG MAMMALIAN PLASMID OGS3421-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6168 bp conjugate 10-His tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-KRYFP - C-TERMINAL YFP TAG MAMMALIAN PLASMID OGS1368-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection.
About the Cleavage Tag: This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6855 bp conjugate yellow fluorescent protein (YFP) tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene YFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-S-TAG - C-TERMINAL S-TAG TAG MAMMALIAN PLASMID OGS3429-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal STag epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: KETAAAKFERQHMDS.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6195 bp conjugate S-Tag Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-STREP - C-TERMINAL STREP TAG MAMMALIAN PLASMID OGS3427-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Strep affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: WSHPQFEK.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6174 bp conjugate streptavidin conjugate Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-T7 - C-TERMINAL T7 TAG MAMMALIAN PLASMID OGS3428-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal T7 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: MASMTGGQQMG.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6183 bp conjugate T7 tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-10HIS - C-TERMINAL 10HIS TAG MAMMALIAN PLASMID OGS1120-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Deca-Histidine (10His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6201 bp conjugate 10-His tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-6HIS - C-TERMINAL 6 HIS TAG MAMMALIAN PLASMID OGS1122-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6189 bp conjugate 6-His tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-BETAGAL-6HIS - C-TERMINAL 6 HIS AND BETA GAL DUAL TAG MAMMALIAN PLASMID OGS1346-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Beta Galactosidase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 9330 bp conjugate 6-His tagged, beta-galactosidase tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene beta Gal shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-CMYC - C-TERMINAL CMYC TAG MAMMALIAN PLASMID OGS1126-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal CMyc epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EQKLISEEDL.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6201 bp conjugate c-Myc tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-CMYC-6HIS - C-TERMINAL 6 HIS AND CMYC DUAL TAG MAMMALIAN PLASMID OGS1234-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal CMyc epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EQKLISEEDL. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6219 bp conjugate 6-His tagged, c-Myc tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-FLAG® - C-TERMINAL FLAG® TAG MAMMALIAN PLASMID OGS1124-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Flag epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteLegal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLCПараметрыform buffered aqueous solution mol wt size 6195 bp conjugate FLAG® tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-FLAG®-6HIS - C-TERMINAL 6 HIS AND FLAG® DUAL TAG MAMMALIAN PLASMID OGS1232-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal FLAG epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteLegal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLCПараметрыform buffered aqueous solution mol wt size 6213 bp conjugate 6-His tagged, FLAG® tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-GST - C-TERMINAL GST TAG MAMMALIAN PLASMID OGS1130-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6825 bp conjugate GST tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-GST-6HIS - C-TERMINAL 6 HIS AND GST DUAL TAG MAMMALIAN PLASMID OGS1238-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6843 bp conjugate 6-His tagged, GST tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-HA - C-TERMINAL HA TAG MAMMALIAN PLASMID OGS1128-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6198 bp conjugate Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-HA-6HIS - C-TERMINAL 6 HIS AND HA DUAL TAG MAMMALIAN PLASMID OGS1236-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6216 bp conjugate 6-His tagged, Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-KRYFP-6HIS - C-TERMINAL 6 HIS AND YFP DUAL TAG MAMMALIAN PLASMID OGS1340-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6894 bp conjugate 6-His tagged, yellow fluorescent protein (YFP) tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene YFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-MBP - C-TERMINAL MBP TAG MAMMALIAN PLASMID OGS3403-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7275 bp conjugate maltose-binding protein (MBP) tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-MBP-6HIS - C-TERMINAL 6 HIS AND MBP DUAL TAG MAMMALIAN PLASMID OGS1246-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 7293 bp conjugate 6-His tagged, maltose-binding protein (MBP) tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-RLUC-6HIS - C-TERMINAL 6 HIS AND RLUC DUAL TAG MAMMALIAN PLASMID OGS1342-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Renilla luciferase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7122 bp conjugate 6-His tagged, Renilla luciferase conjugate Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-STREP - C-TERMINAL STREP TAG MAMMALIAN PLASMID OGS1132-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Strep affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: WSHPQFEK.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6195 bp conjugate streptavidin conjugate Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-STREP-6HIS - C-TERMINAL 6 HIS AND STREP DUAL TAG MAMMALIAN PLASMID OGS1240-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Strep epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: WSHPQFEK. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteOther NotesOXGENEs technology platforms and expert solutions accelerate the discovery, development and manufacture of cell and gene therapies. We work with you to express your gene of interest at scale, with high levels of purity. In addition, our integrated bioinformatics and high-throughput gene editing technology creates a streamlined workflow for automated cell line production. learn more at www.oxgene.com ,Параметрыform buffered aqueous solution mol wt size 6213 bp conjugate 6-His tagged, streptavidin conjugate Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-T7 - C-TERMINAL T7 TAG MAMMALIAN PLASMID OGS1134-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal T7 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: MASMTGGQQMG.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6204 bp conjugate T7 tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-T7-6HIS - C-TERMINAL 6 HIS AND T7 DUAL TAG MAMMALIAN PLASMID OGS1242-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal T7 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: MASMTGGQQMG. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6222 bp conjugate 6-His tagged, T7 tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-TEV-V5-6HIS - C-TERMINAL 6 HIS AND V5 DUAL TAG MAMMALIAN PLASMID OGS3417-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6231 bp conjugate 6-His tagged, V5 tagged Origin of replication pUC (500 copies) Peptide cleavage TEV Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-10HIS - C-TERMINAL 10HIS TAG MAMMALIAN PLASMID OGS1080-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Deca-Histidine (10His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6198 bp conjugate 10-His tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-6HIS - C-TERMINAL 6 HIS TAG MAMMALIAN PLASMID OGS1082-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Hexa-Histidine (6His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6186 bp conjugate 6-His tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-CMYC - C-TERMINAL CMYC TAG MAMMALIAN PLASMID OGS1086-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal CMyc epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EQKLISEEDL.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6198 bp conjugate c-Myc tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-CMYC-6HIS - C-TERMINAL 6 HIS AND CMYC DUAL TAG MAMMALIAN PLASMID OGS1202-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal CMyc epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EQKLISEEDL. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6216 bp conjugate 6-His tagged, c-Myc tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-FLAG® - C-TERMINAL FLAG® TAG MAMMALIAN PLASMID OGS1084-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Flag epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6192 bp conjugate FLAG® tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-FLAG®-6HIS - C-TERMINAL 6 HIS AND FLAG® DUAL TAG MAMMALIAN PLASMID OGS1200-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal FLAG epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: DYKDDDDK. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationFLAG is a registered trademark of Sigma-Aldrich Co. LLC
Oxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6210 bp conjugate 6-His tagged, FLAG® tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-FRCFP-6HIS - C-TERMINAL 6 HIS AND CFP DUAL TAG MAMMALIAN PLASMID OGS1310-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based cyan/blue fluorescent protein (FrCFP) reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6891 bp conjugate 6-His tagged, cyan fluorescent protein (CFP) tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene CFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-GST - C-TERMINAL GST TAG MAMMALIAN PLASMID OGS1090-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture. For this reason we stock a range of other promoters that are compatible with this plasmid and are available on request.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6822 bp conjugate GST tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-GST-6HIS - C-TERMINAL 6 HIS AND GST DUAL TAG MAMMALIAN PLASMID OGS1206-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6840 bp conjugate 6-His tagged, GST tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-HA - C-TERMINAL HA TAG MAMMALIAN PLASMID OGS1088-5UG
General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6195 bp conjugate Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-HA-6HIS - C-TERMINAL 6 HIS AND HA DUAL TAG MAMMALIAN PLASMID OGS1204-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Influenza Hemagglutinin (HA) epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: YPYDVPDYA. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6213 bp conjugate 6-His tagged, Hemagglutinin A (HA) tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-KRYFP-6HIS - C-TERMINAL 6 HIS AND YFP DUAL TAG MAMMALIAN PLASMID OGS1312-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal non-aequorea based yellow fluorescent protein (KrYFP) reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6891 bp conjugate 6-His tagged, yellow fluorescent protein (YFP) tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene YFP shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-MBP - C-TERMINAL MBP TAG MAMMALIAN PLASMID OGS1098-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7272 bp conjugate maltose-binding protein (MBP) tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-MBP-6HIS - C-TERMINAL 6 HIS AND MBP DUAL TAG MAMMALIAN PLASMID OGS1214-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7290 bp conjugate 6-His tagged, maltose-binding protein (MBP) tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-RLUC-6HIS - C-TERMINAL 6 HIS AND RLUC DUAL TAG MAMMALIAN PLASMID OGS1314-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal Renilla luciferase reporter tag that can be fused to a gene of interest to allow protein detection. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Quick-reference Plasmid Map,
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 7119 bp conjugate 6-His tagged, Renilla luciferase conjugate Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene Renilla luciferase shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-V5 - C-TERMINAL V5 TAG MAMMALIAN PLASMID OGS3401-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6210 bp conjugate V5 tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-THR-V5-6HIS - C-TERMINAL 6 HIS AND V5 DUAL TAG MAMMALIAN PLASMID OGS3415-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.
About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a Thrombin cleavage tag. The protein sequence of the cleavage tag is: LVPRGS. It cleaves preferentially between the Arg and Gly residues. Off target cleavage can often occur at non-specific sites normally from other contaminating proteases. To ensure maximal protein integrity the enzyme reagent must be highly pure.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6228 bp conjugate 6-His tagged, V5 tagged Origin of replication pUC (500 copies) Peptide cleavage thrombin Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-COOH-V5 - C-TERMINAL V5 TAG MAMMALIAN PLASMID OGS3422-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains a c-terminal V5 epitope tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: GKPIPNPLLGLDST.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6192 bp conjugate V5 tagged Origin of replication pUC (500 copies) Peptide cleavage no cleavage Peptide tag location C-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-10HIS-3C - N-TERMINAL 10HIS TAG MAMMALIAN PLASMID OGS1137-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Deca-Histidine (10His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname PreScission protease.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.
Genebank Vector Sequence File,
FASTA Vector Sequence File,
Full Plasmid Map,
Quick-reference Plasmid Map,
Analysis NoteOther NotesLooking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics™. Find out more at Oxford Genetics, - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.Legal InformationOxford Genetics is a trademark of Oxford Genetics LtdПараметрыform buffered aqueous solution mol wt size 6203 bp conjugate 10-His tagged Origin of replication pUC (500 copies) Peptide cleavage 3C Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
PSF-CMV-PURO-NH2-10HIS-EKT - N-TERMINAL 10HIS TAG MAMMALIAN PLASMID OGS1157-5UG
NACRES: NA.85 General descriptionThis plasmid is designed to express tagged proteins in mammalian cells either by transient transfection or by creating stable cell lines. It contains a puromycin resistance expression cassette using the human Ubiquitin promoter to drive expression and allow for the selection of cells containing the plasmid.
About the Peptide Tag:This plasmid contains an n-terminal Deca-Histidine (10His) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: HHHHHHHHHH.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a EKT cleavage tag. The protein sequence of the cleavage tag is: DDDDK. Enterokinase (EKT) protease cleaves after the Lysine residue. It can cleave at other basic residues but this is dependent on protein confirmation. If a proline follows the site it will not cut. None of our products contain a proline after the site.
Promoter Expression Level: This plasmid contains the mammalian CMV promoter to drive gene expression. We have tested all of our mammalian promoters in a range of cell types and CMV is consistently the strongest in those we have studied. However there are many reports of the CMV promoter demonstrating silencing by methylation in long-term culture.
Sequence
Analysis NoteПараметрыform buffered aqueous solution mol wt size 6194 bp conjugate 10-His tagged Origin of replication pUC (500 copies) Peptide cleavage EKT Peptide tag location N-terminal Promoter Promoter name: CMV
Promoter activity: constitutive
Promoter type: mammalianbacteria selection kanamycin mammalian cells selection puromycin reporter gene none shipped in ambient storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
