Antibodies
- Сортировать:
- Вид таблицей
-
Anti-VPS28 ABS1679-25UL
eCl@ss: 32160702 General descriptionVacuolar protein sorting-associated protein 28 homolog (UniProt: Q9UK41; also known as H-Vps28, ESCRT-I complex subunit VPS28) is encoded by the VPS28 gene (Gene ID: 51160) in human. VPS28 is a component of the Endosomal Sorting Complex Required for Transport (ESCRT)-I complex that regulates the vesicular trafficking process. This complex forms the machinery driving protein sorting from endosomes to lysosomes. It is located in the cell membrane and late endosome membrane. Two isoforms of VPS28 have been described that are generated by alternative splicing. ESCRT complexes play a vital role in receptor down-regulation, lysosome biogenesis, and budding of HIV. In humans, ESCRT-I complex consists of TSG101, VPS28, and one of four potential human VPS37 homologues. The main role of ESCRT-I is to recognize ubiquitinated cargo via the UEV domain of the VPS23/TSG101 subunit. The N-terminal domain of VPS28 contains a conformationally dynamic hydrophobic binding site on its surface. The C-terminal domain of VPS28 is reported to bind the ESCRT-II complex. (Ref.: Kostelansky, MS et al. (2006). Cell 125(1); 113-126).
Specificity
This rabbit polyclonal antibody detects ESCRT-I complex subunit VPS28 in human cells.ImmunogenA full-length recombinant ESCRT-I complex subunit VPS28 (VPS28).ApplicationAnti-VPS28, Cat. No. ABS1679, is a rabbit polyclonal antibody that detects ESCRT-I complex subunit VPS28 and has been tested for use in Immunofluorescence and Western Blotting.
Research Category
Signaling
Western Blotting Analysis: A representative lot detected recombinant VPS28 protein and VPS28 in cell extracts (Stuchell, M.D., et. al. (2004). J Biol Chem. 279(34):36059-71). Immunofluorescence Analysis: A representative lot detected VPS28 in HEK293T cells transfected with VPS28 (Silvestri, L.S., et. al. (2007). J Infect Dis. 196 Suppl 2:S264-70).
Quality
Evaluated by Western Blotting in GST-VPS28 recombinant protein.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected recombinant GST-VPS28 protein.
Target description
~51 kDa observed; 25.43 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: suitable","western blot: suitable isotype IgG UniProt accession no. Q9UK41,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-VSV Glycoprotein antibody, Mouse monoclonal
NACRES: NA.46
Кат. номер SAB4200695-100UL SAB4200695-25UL General descriptionAnti-VSV Glycoprotein antibody, Mouse monoclonal (mouse IgG1 isotype) is derived from the hybridoma P5D4 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide of Vesicular Stomatitis Virus Glycoprotein (VSV-G), conjugated to KLH.ApplicationAnti-VSV Glycoprotein antibody, Mouse monoclonal has been used in immunoblotting, immunofluorescence, immunoprecipitation, immunocytochemistry, transmission electron microscopy (TEM) and studies applying microinjection of the antibody.
Biochem/physiol Actions
Vesicular Stomatitis Virus Glycoprotein (VSV-G) constitutes an attractive model to study maturation and intracellular transport of membrane proteins. It mediates attachment of VSV to the cell surface and induces pH-dependent fusion between viral and target membranes. In addition, it possesses information for intracellular sorting in its cytoplasmic domain, including efficient export from the endoplasmic reticulum (ER), basolateral delivery and endocytosis. The unidirectional transport between golgi cisternae was demonstrated using golgi membranes containing VSV-G. Temperature sensitive mutants of VSV-G are used to study exit of folding intermediates from the endoplasmic reticulum.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone P5D4, monoclonal form buffered aqueous solution species reactivity virus (Vesicular stomatitis virus (VSV)) packaging antibody small pack of 25 μL concentration ~1 mg/mL application(s) immunoblotting: 0.5-1 μg/mL using whole extract of human HEK-293T cells over-expressing Vinculin with VSV-G tagged fusion protein., immunocytochemistry: suitable, immunofluorescence: 5-10 μg/mL using COS7 cells over-expressing Vinculin with VSV-G tagged fusion protein., immunoprecipitation (IP): suitable isotype IgG1 shipped in dry ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-WBP11 antibody produced in rabbit
Human Protein Atlas Number: HPA046403 Human Protein Atlas characterization data
Кат. номер HPA046403-100UL HPA046403-25UL ImmunogenWW domain binding protein 11ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87470,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME conjugate unconjugated UniProt accession no. Q9Y2W2, shipped in wet ice storage temp. 20°C Gene Information human ... WBP11(51729)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-WDR35 antibody produced in rabbit
Human Protein Atlas Number: HPA044147 Human Protein Atlas characterization data
Кат. номер HPA044147-100UL HPA044147-25UL ImmunogenWD repeat domain 35 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83397,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY conjugate unconjugated UniProt accession no. Q9P2L0, shipped in wet ice storage temp. 20°C Gene Information human ... WDR35(57539)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-WDR47 antibody produced in rabbit
Human Protein Atlas Number: HPA027287 Human Protein Atlas characterization data
Кат. номер HPA027287-100UL HPA027287-25UL General descriptionWD repeat domain 47 (WDR47) is localized to cytoplasmic microtubules. The gene encoding this protein is localized on human chromosome 1p13.3.ImmunogenWD repeat domain 47 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
WD repeat domain 47 (WDR47) interacts with ubiquitin carboxyl-terminal hydrolase 21 and microtubule-associated protein 8 (MAP8).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76551,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence LLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYP conjugate unconjugated UniProt accession no. O94967, shipped in wet ice storage temp. 20°C Gene Information human ... WDR47(22911)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Wee1
eCl@ss: 32160702
Кат. номер ABE1336-25UG ABE1336-100UG General descriptionWee1-like protein kinase (UniProt: P30291; also known as EC: 2.7.10.2, WEE1hu, Wee1A kinase) is encoded by the WEE1 gene (Gene ID: 7465) in human. Wee1 is a magnesium-dependent nuclear kinase that belongs to the Serine/Threonine family of protein kinases. It serves as a negative regulator of entry into mitosis (G2 to M transition) by protecting the nucleus from cytoplasmically activated cyclin B1-complexed Cdk1 prior to the onset of mitosis. Two isoforms of Wee1 have been described that are produced by alternative splicing. In isoform 1 the nucleotide binding site is localized to amino acids 305-313 and its protein kinase domain lies within amino acids 299-569. Wee1 specifically phosphorylates and inactivates cyclin B1-complexed Cdk1, reaching a maximum during G2 phase and a minimum as cells enter into M phase. Phosphorylation of cyclin B1-Cdk1 is shown to occur exclusively on Tyrosine 15. Wee1 levels are believed to increase during S and G2 phases due to increase in transcription and a decline in M phase has been attributed to reduced synthesis and higher degradation. Phosphorylation at serine 642 by BRSK1 and BRSK2 in post-mitotic neurons is reported to down-regulate Wee1 activity in polarized neurons. Also, phosphorylation at serine 53 by PLK1 and at serine 123 by Cdk1 generates a signal for its ubiquitination and proteasomal degradation at the onset of G2/M phase.
Specificity
This rabbit polyclonal antibody detects Wee1-like kinase in human cells. It targets an epitope within 15 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal region of human Wee1-like protein kinase. The immunogen sequence is conserved between isoforms 1 and 2.ApplicationWestern Blotting Analysis: 2 µg/mL from a representative lot detected Wee1 in 10 µg of K562 cell lysate.
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Wee1 in human placenta and human testis cancer tissues.
Anti-Wee1, Cat. No. ABE1336-100UG, is a highly specific rabbit polyclonal antibody that targets Wee1-like protein kinase and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HepG2 cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Wee1 in 10 µg of HepG2 cell lysate.
Target description
~72 kDa observed; 71.60 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), bovine (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_001137448.1, UniProt accession no. P30291, Gene Information human ... WEE1(7465)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Wilms Tumor (WT33)
eCl@ss: 32160702
Кат. номер ABC1690-25UG ABC1690-100UG General descriptionWilms tumor protein (UniProt: P19544; also known as WT33) is encoded by the WT1 gene (Gene ID: 7490) in human. WT33 serves as a transcription factor that plays an important role in cellular development and cell survival. It is expressed in the kidney and a subset of hematopoietic cells. It regulates the expression of numerous target genes, including EPO. WT33 plays an essential role for development of the urogenital system and has a tumor suppressor as well as an oncogenic role in tumor formation. Eight different isoforms of WT33 have been described that are produced by alternative splicing. Isoforms lacking the KTS motif act as transcription factors while isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. The N-terminal region of WT33 contains a proline-rich region (aa 27-83) involved in transcriptional regulation, self-association, and RNA recognition, while its C-terminal region contains four C2H2-type zinc fingers (aa 323-347, 353-377, 383-405, 414-438) that mediate DNA and RNA binding. The zinc finger domain of WT33 can bind to GC-rich sequences, such as the EGR-1 consensus sequence (5 -GCG(T/G)GGGCG-3 ), the WTE motif (5-GCGTGGGAGT-3), or (TCC)n motif. Mutations in WT1 gene are reported to cause Wilms tumors characterized by embryonal malignancy of the kidney. Some mutations are reported to cause nephrotic syndrome 4, which causes severe proteinuria, resulting in complications such as hypoalbuminemia, hyperlipidemia and edema.
Specificity
This rabbit polyclonal antibody detects Wilms tumor protein in human. It targets an epitope within 16 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids from the N-terminal region of human Wilms Tumor Protein. The immunogen is conserved in isoforms 1,2,3 and 4.ApplicationWestern Blotting Analysis: 2 µg/mL from a representative lot detected Wilms Tumor (WT33) in human testis tissue lysate.
Immunohistochemistry Analysis: A 1: 250-1,000 dilution from a representative lot detected Wilms Wilms Tumor (WT33) in human testis and human kidney tissues.
Research Category
Apoptosis & Cancer
Anti-Wilms Tumor (WT33), Cat. No. ABC1690, is a rabbit polyclonal antibody that detects Wilms tumor protein and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in human kidney tissue lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Wilms Tumor (WT33) in human kidney tissue lysate.
Target description
~59 kDa observed; 49.19 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_000369.3, UniProt accession no. P19544, Gene Information human ... WT1(7490) Узнать цену -
Anti-XPD Antibody, clone 22TF2-2F6
eCl@ss: 32160702
Кат. номер MABE1819-25UG MABE1819-100UG General descriptionGeneral transcription and DNA repair factor IIH helicase subunit XPD (UniProt: P18074; also known as EC: 3.6.4.12, TFIIH subunit XPD, Basic transcription factor 2 80 kDa subunit, BTF2 p80, CXPD, DNA excision repair protein ERCC-2, DNA repair protein complementing XP-D cells, TFIIH basal transcription factor complex 80 kDa subunit, TFIIH 80 kDa subunit, TFIIH p80, Xeroderma pigmentosum group D-complementing protein) is encoded by the ERCC2 (also known as XPD, XPDC) gene (Gene ID: 2068) in human. XPD is an ATP-dependent 5-3 DNA helicase component of the general transcription and DNA repair factor IIH (TFIIH) core complex that is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA. Its ATP-binding region is localized to amino acids 7-283 and its nuclear localization is in amino acids 682-695. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH plays an essential role in transcription initiation. When the pre-initiation complex has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail of the largest subunit of RNA polymerase II by CDK-activating kinase (CAK) complex controls the initiation of transcription. XPD acts by forming a bridge between CAK and the core-TFIIH complex. Mutations in ERCC2 gene are known to cause Xeroderma pigmentosum complementation group D that is characterized by solar hypersensitivity of the skin, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities. The skin develops marked freckling and other pigmentation abnormalities.
Specificity
Clone 22TF2-2F6 detects General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2) in human cells. It targets an epitope with in 32 amino acids from the C-terminal region.ImmunogenEpitope: C-terminus
Ovalbumin-conjugated linear peptide corresponding to 32 amino acids from the C-terminal region of human General transcription and DNA repair factor IIH helicase subunit XPD (XPD/ERCC2).ApplicationWestern Blotting Analysis: A representative lot detected XPD in Western Blotting applications (Alekseev, S., et. al. (2017). Mol Cell. 65(3):504-514.e4).
Immunocytochemistry Analysis: A representative lot detected XPD in Immunocytochmeistry applications (Vermeulen, W., et. al. (2000). Nat Genet. 26(3):307-13). .
Immunoprecipitation Analysis: A representative lot immunoprecipitated XPD in Immunoprecipitation applications (Coin, F., et. al. (1998). Nat Genet. 20(2):184-8; Seroz, T., et. al. (2000). Nucleic Acids Res. 28(22):4506-13).
Anti-XPD, clone 22TF2-2F6, Cat. No. MABE1819, is a highly specific mouse monoclonal antibody that targets human General transcription and DNA repair factor IIH helicase subunit XPD and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Immunocytochemistry in HeLa cells.
Immunocytochemistry Analysis: A 1:250 dilution of this antibody detected XPD in HeLa cells.
Target description
86.91 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 22TF2-2F6, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_000391.1, UniProt accession no. P18074, Узнать цену -
Anti-XRCC5 (Ku86) Antibody, clone N9C1
eCl@ss: 32160702
Кат. номер MABE1892-25UL MABE1892-100UL General descriptionX-ray repair cross-complementing protein 5 (UniProt: P13010; also known as 86 kDa subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC box-binding factor 85 kDa subunit, CTC85, CTCBF,+D13 DNA repair protein XRCC5, Ku80, Ku86, Lupus Ku autoantigen protein p86, Nuclear factor IV, Thyroid-lupus autoantigen, TLAA, X-ray repair complementing defective repair in Chinese hamster cells 5) is encoded by the XRCC5 (also known as G22P2) gene (Gene ID: 7520) in human. XRCC5 is a single stranded DNA-dependent ATP-dependent helicase that exists as a heterodimer composed on XRCC5/XRCC6. This dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by about 100-fold. It plays a role in chromosome translocation. It binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It stabilizes broken DNA ends and bring them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ (Non-homologous end joining) ligation step. In association with NAA15, the XRCC5/6 dimer is shown to bind to the osteocalcin promoter and activates osteocalcin expression. The Ku domain of XRCC5 is localized in amino acids 251-260. It also contains an EEXXXDL motif (aa 720-728), which is required for the interaction with catalytic subunit PRKDC and its recruitment to sites of DNA damage. It undergoes phosphorylation on serine residues by PRKDC that enhances its helicase activity.
Specificity
Clone N9C1 is a mouse monoclonal antibody that specifically detects DNA repair protein XRCC5.ImmunogenFull-length human recombinant DNA repair protein XRCC5 (Ku86).ApplicationWestern Blotting Analysis: A representative lot detected XRCC5 (Ku86) in Western Blotting applications (Knuth, M.W., et. al. (1990). J Biol Chem. 265(29):17911-20).
Anti-XRCC5 (Ku86), clone N9C1, Cat. No. MABE1892, is a highly specific mouse monoclonal antibody that targets DNA repair protein XRCC5 and has been tested for use in Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in SW480 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected XRCC5 (Ku86) in SW480 cell lysate.
Target description
~80 kDa observed; 82.71 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone N9C1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_066964, UniProt accession no. P13010,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-XTP3-B antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200062-25UL SAB4200062-200UL General descriptionXTP3-transactivated gene B precursor (XTP3-B), also known as Erlectin is an ER-resident lectin. XTP3-B contains two mannose 6-phosphate receptor homology (MRH) domains in its sequence. The XTP3-B gene is mapped to human chromosome 2p16.2.ApplicationAnti-XTP3-B antibody produced in rabbit has been used in immunoblotting and immunofluorescence.
Biochem/physiol Actions
XTP3-transactivated gene B precursor (XTP3-B), plays a role in endoplasmic-reticulum-associated protein degradation (ERAD) selection and targeting processes. Human XTP3-B associates with the SEL1L/HRD1 ubiquitin ligase complex in the ER membrane and with the ER chaperone BiP, forming an ER quality control scaffold complex. This large complex is involved in identifying and sorting of misfolded glycoproteins and non-glycosylated proteins prior to retrotranslocation into the cytoplasm for degradation.
Physical form
Solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~54 kDa species reactivity rat, human, mouse packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) indirect immunofluorescence: 2-5 µg/mL using rat NRK cells","western blot: 1-2 µg/mL using whole extracts of human G361 and mouse 3T3 cells conjugate unconjugated UniProt accession no. Q96DZ1, shipped in dry ice storage temp. 20°C Gene Information human ... ERLEC1(27248)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-YAP Antibody, clone 8G5
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2029-25UG MABS2029-100UG General descriptionTranscriptional coactivator YAP1 (UniProt: P46937; also known as Yes-associated protein 1, Protein yorkie homolog, Yes-associated protein YAP65 homolog) is encoded by the YAP1 (also known as YAP65) gene (Gene ID: 10413) in human. YAP1 is a transcriptional regulator that can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway. It also plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. YAP1 contains two WW domains (aa 171-204 and 230-263) and a transactivation domain (aa 291-504). It also has two coiled coil regions (aa 86-100 and 298-359) and the first coiled-coil region is reported to mediate most of the interaction with TEAD transcription factors. The presence of TEAD transcription factors is required for YAP1 to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. YAP1 phosphorylation status and cell density can regulate its subcellular localization. Its phosphorylation by LATS1 and LATS2 leads to its cytoplasmic translocation and inactivation. YAP1 can also be phosphorylated by ABL1, which leads to its stabilization, increased interaction with TP73, and recruitment onto proapoptotic genes in response to DNA damage. Nine isoforms of YAP1 have been described that are produced by alternative splicing. Mutations in YAP1 gene have been linked to ocular coloboma that is characterized by uveal colobomata, microphthalmia, cataract and cleft lip/palate. Higher expression of YAP1 has been reported in some liver and prostate cancers.
Specificity
Clone 8G5 is a rat monoclonal antibody that detects Transcriptional coactivator YAP1. It targets an epitope with in 12 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 12 amino acids from the C-terminal region of human Transcriptional coactivator YAP1.ApplicationAnti-YAP, clone 8G5, Cat. No. MABS2029, is a rat monoclonal antibody that detects Transcriptional coactivator YAP1 and has been tested or use in Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected YAP in mouse colon tissue sections.
Western Blotting Analysis: A representative lot detected YAP in Western Blotting applications (Miyamura, N.,et. al. (2017). Nat Commun. 8:16017; Matsudaira, T., et. al. (2017). Nat Commun. 8(1):1246; Hata, S., et. al. (2012). J Biol Chem. 287(26):22089-98; Maruyama, J., et. al. (2017). Mol Cancer Res. 16(2):197-211).
Immunoprecipitation Analysis: A representative lot detected YAP in Immunoprecipitation applications (Hata, S., et. al. (2012). J Biol Chem. 287(26):22089-98).
Immunofluorescence Analysis: A representative lot detected YAP in Immunofluorescence applications (Miyamura, N.,et. al. (2017). Nat Commun. 8:16017).
Immunocytochemistry Analysis: A representative lot detected YAP in Immunocytochemistry applications (Matsudaira, T., et. al. (2017). Nat Commun. 8(1):1246; Hata, S., et. al. (2012). J Biol Chem. 287(26):22089-98).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human placenta tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected YAP in human placenta tissue sections.
Target description
54.46 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 8G5, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_001123617.1, UniProt accession no. P46937, Gene Information human ... YAP1(10413) Узнать цену -
Anti-YL-1 Antibody, clone EX-1Y32
eCl@ss: 32160702
Кат. номер MABE1796 MABE1796-25UG General descriptionVacuolar protein sorting-associated protein 72 homolog (UniProt: Q15906; also known as Protein YL-1, Transcription factor-like 1) is encoded by the VPS72 (also known as TCFL1, YL1) gene (Gene ID: 6944) in human. YL-1 is a nuclear protein that may serve as a DNA-binding transcriptional regulator and may be involved in chromatin modification and remodeling. YL-1 is plays multiple roles in chromatin modification and remodeling in cells and it is shown to be a subunit of TRRAP/TIP60 HAT complex and of chromatin remodeling SCCAP-containing complex. It has a DNA binding region that includes amino acids 156 to 206. In addition, it has an aspartic/glutamic acid rich acidic region (aa 22-77) and a proline rich region (aa 333-354). Two isoforms of YL-1 have been described that are produced by alternative splicing. (Ref.: Cai, Y., et al. (2006). J. Biol. Chem. 280 (14); 13665-70).
Specificity
Clone EX-1Y32 detects Vacuolar protein sorting-associated protein 72 homolog (YL-1) in human and murine cells.ImmunogenGST-tagged full-length recombinant human YL-1 protein.ApplicationWestern Blotting Analysis: A representative lot detected YL-1 in Western Blotting applications (Obri, A., et. al. (2014). Nature. 505(7485):648-53).
Immunocytochemistry Analysis: A 1:800 dilution from a representative lot detected YL-1 in HeLa cells.
Western Blotting Analysis: 2 µg/mL from a representative lot detected YL-1 in 10 µg of HeLa cell lysate.
Immunoprecipitation Analysis: 1-10 µg from a representative lot detected YL-1 in Mouse embryonic fibroblast (MEF) total cell extracts.
Research Category
Epigenetics & Nuclear Function
Anti-YL-1, clone EX-1Y32, Cat. No. MABE1796, is a highly specific mouse monoclonal antibody that targets Vacuolar protein sorting-associated protein 72 homolog and has been tested for use in Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in Mouse embryonic fibroblast (MEF) cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected YL-1 in Mouse embryonic fibroblast (MEF) cell lysate.
Target description
~48 kDa observed, 40.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide and 40% glycerol.
Protein A + Protein G
Format: Purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone EX-1Y32, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_005988, UniProt accession no. Q15906,
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-ZBTB38
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1341-100UL ABE1341-25UL General descriptionZinc finger and BTB domain-containing protein 38 (UniProt: Q8NAP3, ZBTB38) is encoded by the ZBTB38 gene (Gene ID: 253461) in human. ZBTB38 is a transcriptional regulator with bimodal DNA-binding specificity. It binds with a higher affinity to methylated CpG dinucleotides in the consensus sequence 5-CGCG-3, but can also bind to E-box elements (5-CACGTG-3). It can also bind specifically to a single methyl-CpG pair and represses transcription in a methyl-CpG-dependent manner. ZBTB38 protein is reported to play an important role in regulating DNA replication and common fragile sites (CFS) stability in a RBBP6- and MCM10-dependent manner and is shown to repress expression of MCM10, which plays an important role in DNA-replication. It is also believed to be involved in the differentiation and/or survival of late post-mitotic neurons. ZBTB38 protein contains ten C2H2-type zinc fingers and its BTB (Broad-Complex, Tramtrack and Bric a brac) domain is localized in the amino acids 33-100. However, the BTB domain is not required for its activation. ZBTB38 is down-regulated under conditions of endoplasmic reticulum (ER) stress, which promotes ER stress-associated apoptosis in human bone marrow neuroblastoma cells. In mice subjected to spinal cord injury (SCI) a repression of ZBTB38 is observed and this is linked to reduced secondary tissue damage after SCI. (Ref.:Cai, Y., et al. (2017). Oncotarget 8(28); 45356-45366).
Specificity
This rabbit polyclonal antibody specifically detects Zinc finger and BTB domain-containing protein 38 in human cells. It targets an epitope within 20 amino acids from the C-terminus region.ImmunogenKLH-conjugated linear peptide corresponding to 20 amino acids from the C-terminus region of human Zinc finger and BTB domain-containing protein 38.
Epitope: C-terminusApplicationImmunohistochemistry Analysis: A 1:250 dilution from a representative lot detected ZBTB38 in human testis and human kidney tissue sections.
Anti-ZBTB38 Antibody, Cat. No. ABE1341, is a highly specific rabbit polyclonal antibody that targets ZBTB38 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HeLa cell nuclear extract.
Western Blotting Analysis: A 1:500 dilution of this antibody detected ZBTB38 in HeLa cell nuclear extract.
Target description
~170 kDa observed; 134.26 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_001073881, UniProt accession no. Q8NAP3, Gene Information human ... ZBTB38(253461)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ZBTB4 (KAISO-L1)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1342-25UG ABE1342-100UG General descriptionZinc finger and BTB domain-containing protein 4 (UniProt: Q9P1Z0; also known as KAISO-like zinc finger protein 1, KAISO-L1, ZBTB4) is encoded by the ZBTB4 (also known as KIAA1538) gene (Gene ID: 57659) in human. ZBTB4 is an epigenetic regulator that localizes at pericentromeric heterochromatin. It is shown to be an essential component in maintaining genomic stability in mammals. It serves as a transcriptional repressor with bimodal DNA-binding specificity. It represses transcription in a methyl-CpG-dependent manner and binds with a higher affinity to methylated CpG dinucleotides in the consensus sequence 5-CGCG-3, but can also bind to the non-methylated consensus sequence 5-CTGCNA-3 (also known as the consensus kaiso binding site). ZBTB4 contains six C2H2-type zinc-finger domains and two proline-rich regions (aa 435-536 and 610-654). Its BTB (Broad-Complex, Tramtrack and Bric a brac) domain is localized in the amino acids 30-152. It is shown to be is frequently downregulated in cancer. ZBTB4 is phosphorylated by HIPK2 (Homeodomain Interacting Protein Kinase 2) and phosphorylation reduces its stability and triggers its degradation in response to DNA damage. (Ref.: Roussel-Gervais A., et al. (2017). Cancer Res; 77(1); 62-73; Yamada, D., et al (2009). Oncogene. 28(27); 2535-2544).
Specificity
This rabbit polyclonal antibody detects Zinc finger and BTB domain-containing protein 4 (KAISO-L1) in human cells. It targets an epitope within 17 amino acids from the internal region.ImmunogenKLH-conjugated linear peptide corresponding to 17 amino acids from the internal region of human Zinc finger and BTB domain-containing protein 4.ApplicationImmunohistochemistry Analysis: A 1:250 dilution from a representative lot detected ZBTB4 (KAISO-L1) in human fallopian tube and human cervical cancer tissue sections.
Research Category
Epigenetics & Nuclear Function
Anti-ZBTB4 (KAISO-L1), Cat. No. ABE1342, is a highly specific rabbit polyclonal antibody that targets Zinc finger and BTB domain-containing protein 4 and has been tested for use in Immunohistochemistry (Paraffin) and in Western Blotting.
Quality
Evaluated by Western Blotting in PC3 cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected ZBTB4 (KAISO-L1) in PC3 cell lysate.
Target description
~105 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human species reactivity (predicted by homology) monkey (based on 100% sequence homology), bovine (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_001122305, UniProt accession no. Q9P1Z0, Gene Information human ... ZBTB4(57659)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ZDHHC13 Antibody, clone 26D1
eCl@ss: 32160702
Кат. номер MABT1498-25UL MABT1498-100UL General descriptionPalmitoyltransferase ZDHHC13 (UniProt: Q8IUH4; also known as EC: 2.3.1.22, Huntingtin-interacting protein 14-related protein, HIP14-related protein, Huntingtin-interacting protein HIP3RP, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DHHC domain-containing protein 13, DHHC-13) is encoded by the ZDHHC13 (also known as HIP14L, HIP3RP) gene (Gene ID: 54503) in human. DHHC-13 is a multi-pass membrane protein that serves as a palmitoyl acyltransferase (PAT) specific for a subset of neuronal proteins, including HD and GAD2 and may play a role in the pathogenesis of Huntington disease (HD). It is reported to be dysfunctional in the presence of the HD mutation and HIP-14 deficient mice are shown to develop features of HD. DHHC-13 also plays a role in cellular magnesium homeostasis. It contains a DHHC domain (aa 426-476 in isoform 1 and 250-300 in isoform 2), which is required for its palmitoyltransferase activity. (Ref.: Young, FB et al. (2011). Prog. Neurobiol. 97(2); 220-238).
Specificity
Clone 26D1 detects human Palmitoyltransferase ZDHHC13. It targets an epitope within 111 amino acids from the N-terminal region of isoforms 1 and 2. This sequence is conserved in both isoforms.ImmunogenMBP-tagged recombinant fragment corresponding to 111 amino acids from the N-terminal region of human Palmitoyltransferase ZDHHC13, isoform 2.ApplicationResearch Category
Neuroscience
Anti-ZDHHC13, clone 26D1, Cat. No. MABT1498, is a mouse monoclonal antibody that detects Palmitoyltransferase ZDHHC13 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected ZDHHC13 in A431 cell lysate.
Target description
~55 kDa observed; 56.51 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 26D1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_001001483, UniProt accession no. Q8IUH4-2, Gene Information human ... ZDHHC13(54503) Узнать цену -
Anti-Zika virus Antibody, clone ZV-13
eCl@ss: 32160702
Кат. номер MABF2043-25UG MABF2043 General descriptionGenome polyprotein (UniProt: Q32ZE1) from Zika virus strain Mr 766 is a large molecular weight protein. In Zika virus surface proteins are arranged in an icosahedral-like symmetry. Attachment of the viral envelope protein E to host receptors mediates internalization into the host cell by apoptotic mimicry. Following the fusion of virus membrane with host endosomal membrane, RNA genome is released into the cytoplasm. Polyprotein components include Protein C homodimerizes and plays a role in virus budding by binding to membrane and gathering the viral RNA into a nucleocapsid that forms the core of a mature virus particle. The Pr peptide prevents premature fusion activity of the envelope proteins in trans golgi by binding to envelope protein E (at pH 6.0). The PrM peptide serves as a chaperone for envelope protein E during intracellular virion assembly. Polyprotein also has a RNA-directed RNA polymerase NS5 that replicates the viral (+) and (-) genome and methylates viral RNA cap at guanine N-7 and ribose 2 -O positions. The non-structural protein 1 can form homodimers and homohexamers is involved in immune evasion, pathogenesis and viral replication and non-structural protein 2A functions in virion assembly and antagonizes the host immune response. The non-structural protein 2B is essential for the serine protease function of NS3. The serine protease NS3 has three different enzymatic activities - serine protease, NTPase and RNA helicase. The non-structural protein 4A of virus regulates the ATPase activity of the NS3 helicase while the non-structural protein 4B inhibits interferon-induced host STAT1 phosphorylation and its nuclear translocation. The 2k peptide serves as a signal peptide for NS4B and is required for the interferon antagonism.
Specificity
Clone ZY-13 specifically detects Zika virus envelope protein. It binds to the ectodomain region.ImmunogenZika virus strains MR-766.ApplicationAnti-Zika virus, clone ZV-13, Cat. No. MABF2043, is amouse monoclonal antibody that detects Zika virus envelope protein and has been tested for use in Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in the ectodomain of Zika Virus Envelope recombinant protein.
Western Blotting Analysis: A 1:250 dilution of this antibody detected Zika virus envelope recombinant protein.
Target description
~50 kDa observed (recombinant fragment); 378.74 kDa whole protein. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone ZV-13, monoclonal species reactivity virus species reactivity (predicted by homology) all packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2a NCBI accession no. YP_002790881.1, UniProt accession no. Q32ZE1 (strain Mr 766),
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Zika virus Antibody, clone ZV-2
eCl@ss: 32160702
Кат. номер MABF2048-25UG MABF2048 General descriptionGenome polyprotein (UniProt: Q32ZE1) from Zika virus strain Mr 766 is a large molecular weight protein. In Zika virus surface proteins are arranged in an icosahedral-like symmetry. Attachment of the viral envelope protein E to host receptors mediates internalization into the host cell by apoptotic mimicry. Following the fusion of virus membrane with host endosomal membrane, RNA genome is released into the cytoplasm. Polyprotein components include Protein C homodimerizes and plays a role in virus budding by binding to membrane and gathering the viral RNA into a nucleocapsid that forms the core of a mature virus particle. The Pr peptide prevents premature fusion activity of the envelope proteins in trans golgi by binding to envelope protein E (at pH 6.0). The PrM peptide serves as a chaperone for envelope protein E during intracellular virion assembly. Polyprotein also has a RNA-directed RNA polymerase NS5 that replicates the viral (+) and (-) genome and methylates viral RNA cap at guanine N-7 and ribose 2 -O positions. The non-structural protein 1 can form homodimers and homohexamers is involved in immune evasion, pathogenesis and viral replication and non-structural protein 2A functions in virion assembly and antagonizes the host immune response. The non-structural protein 2B is essential for the serine protease function of NS3. The serine protease NS3 has three different enzymatic activities - serine protease, NTPase and RNA helicase. The non-structural protein 4A of virus regulates the ATPase activity of the NS3 helicase while the non-structural protein 4B inhibits interferon-induced host STAT1 phosphorylation and its nuclear translocation. The 2k peptide serves as a signal peptide for NS4B and is required for the interferon antagonism.
Specificity
Clone ZV-2 detects Zika virus envelope protein.ImmunogenWhole Zika virus strain Mr 766 and strain H/PF/2013.
Epitope: extracellular domainApplicationAnti-Zika virus, clone ZV-2, Cat. No. MABF2048, is a mouse monoclonal antibody that detects Zika virus envelope protein and has been tested for use in Electron Microscopy, Flow Cytometry, Immunocytochemistry, and Western Blotting.
Electron Microscopy Analysis: A representative lot detected Zika virus in Electron Microscopy applications (Miner, J.J., et. al. (2016). Cell. 165(5):1081-91).
Immunocytochemistry Analysis: A representative lot detected Zika virus in Immunochemistry applications (Miner, J.J., et. al. (2016). Cell. 165(5):1081-91).
Flow Cytometry Analysis: A representative lot detected Zika virus in Flow Cytometry applications (Miner, J.J., et. al. (2016). Cell. 165(5):1081-91).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in Zika virus envelope recombinant protein.
Western Blotting Analysis: 1 µg/mL of this antibody detected Zika virus envelope recombinant protein.
Target description
~50 kDa observed (recombinant fragment); 378.74 kDa whole protein. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone ZV-2, monoclonal species reactivity virus species reactivity (predicted by homology) all packaging antibody small pack of 25 µg application(s) electron microscopy: suitable","flow cytometry: suitable","immunocytochemistry: suitable","western blot: suitable isotype IgG2a NCBI accession no. YP_002790881.1, UniProt accession no. Q32ZE1 (strain Mr 766),
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Zika Virus Antibody, clone ZV-54 MABF2046-25UG
eCl@ss: 32160702 General descriptionGenome polyprotein (UniProt: Q32ZE1) from Zika virus strain Mr 766 is a large molecular weight protein. In Zika virus surface proteins are arranged in an icosahedral-like symmetry. Attachment of the viral envelope protein E to host receptors mediates internalization into the host cell by apoptotic mimicry. Following the fusion of virus membrane with host endosomal membrane, RNA genome is released into the cytoplasm. Polyprotein components include Protein C homodimerizes and plays a role in virus budding by binding to membrane and gathering the viral RNA into a nucleocapsid that forms the core of a mature virus particle. The Pr peptide prevents premature fusion activity of the envelope proteins in trans golgi by binding to envelope protein E (at pH 6.0). The PrM peptide serves as a chaperone for envelope protein E during intracellular virion assembly. Polyprotein also has a RNA-directed RNA polymerase NS5 that replicates the viral (+) and (-) genome and methylates viral RNA cap at guanine N-7 and ribose 2 -O positions. The non-structural protein 1 can form homodimers and homohexamers is involved in immune evasion, pathogenesis and viral replication and non-structural protein 2A functions in virion assembly and antagonizes the host immune response. The non-structural protein 2B is essential for the serine protease function of NS3. The serine protease NS3 has three different enzymatic activities - serine protease, NTPase and RNA helicase. The non-structural protein 4A of virus regulates the ATPase activity of the NS3 helicase while the non-structural protein 4B inhibits interferon-induced host STAT1 phosphorylation and its nuclear translocation. The 2k peptide serves as a signal peptide for NS4B and is required for the interferon antagonism. Clone ZV-54 is reported to neutralize infection of African, Asian, and American strains of Zika virus to varying degrees. (Ref.: Zhao, H et al. (2016). Cell 166(4); 1016-27).
Specificity
Clone ZV-54 specifically detects Zika virus envelope protein. It binds to the ectodomain III and displays high affinity (Kd = 7.9 nM) for Zika virus.ImmunogenZika virus strains MR-766 and H/PF/2013ApplicationFlow Cytometry Analysis: A representative lot detected Zika Virus in Flow Cytometry applications (Zhao, H., et. al. (2016). Cell. 166(4):1016-27).
This mouse monoclonal Anti-Zika Virus, clone ZV-54, Cat. No. MABF2046 is tested for use in Western Blotting, Neutralizing, and Flow Cytometry, for the detection of Zika virus envelope protein.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in recombinant Zika virus envelope protein.
Physical form
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone monoclonal species reactivity virus packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","neutralization: suitable","western blot: suitable isotype IgG2a UniProt accession no. Q32ZE1 (strain Mr 766),
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ZKSCAN3 (Zf47)
eCl@ss: 32160702
Кат. номер ABC441-25UL ABC441-100UL General descriptionZinc finger protein with KRAB and SCAN domains 3 (UniProt: Q9BRR0; also known as Zinc finger and SCAN domain-containing protein 13, Zinc finger protein 306, Zinc finger protein 309, Zinc finger protein 47 homolog, Zf47, Zfp-47) is encoded by the ZKSCAN3 (also known as ZFP47, ZNF306, ZNF309, ZSCAN13) gene (Gene ID: 80317) in human. Zf47 is a member of the krueppel C2H2-type zinc-finger protein family. Two isoforms of Zf47 have been described that are produced by alternative splicing. It contains 7 C2H2 type zinc-fingers. It serves as a transcriptional factor that binds to the consensus sequence 5-[GT][AG][AGT]GGGG-3 and acts as a repressor of autophagy. It is shown to specifically repress expression of genes involved in autophagy and lysosome biogenesis/function such as MAP1LC3B, ULK1 or WIPI2. It is mainly localized in the nucleus, however, under conditions of starvation, it translocates to the cytoplasm, allowing expression of target genes involved in autophagy and lysosome biogenesis/function. Overexpression of Zf47 is observed in various tumors, including multiple myeloma, colorectal and prostate cancers.
Specificity
This rabbit polyclonal antibody detects Zinc finger protein with KRAB and SCAN domains 3 in human cells. It targets an epitope within 12 amino acids from the N-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 12 amino acids from the N-terminal half of human Zinc finger protein with KRAB and SCAN domains 3. The immunogen sequence is conserved in both isoforms, 1 and 2.
Epitope: unknownApplicationAnti-ZKSCAN3 (Zf47), Cat. No. ABC441, is a rabbit polyclonal antibody that detects Zinc finger protein with KRAB and SCAN domains 3 and has been tested for use in Immunocytochemistry and Western Blotting.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected ZKSCAN3 (Zf47) with KRAB and SCAN domains 3 in HeLa and A431 cell lines.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected ZKSCAN3 (Zf47) with KRAB and SCAN domains 3 in HeLa cell lysate.
Target description
~65 kDa observed; 60.64 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","western blot: suitable NCBI accession no. NP_001229823.1, UniProt accession no. Q9BRR0, Узнать цену -
Anti-ZMYM2 Antibody, clone 9F12.1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABN2263 MABN2263-25UG General descriptionZinc finger MYM-type protein 2 (UniProt: Q9UBW7; also known as Fused in myeloproliferative disorders protein; Rearranged in atypical myeloproliferative disorder protein; Zinc finger protein 198) is encoded by the ZMYM2 (also known as FIM, RAMP, ZNF198) gene (Gene ID: 7750) in human. Zinc finger MYM-type protein 2 is a nuclear protein that may function as a transcription factor. Two isoforms of Zinc finger MYM-type protein 2 have been described that are produced by alternative splicing. The SUMO-interacting motifs (SIM) of Zinc finger MYM-type protein 2 are shown to be essential for its recruitment to chromatin. The SIM motifs play an important role in its gene-regulatory activities, however, they are not required for the intrinsic transcriptional repressive properties of Zinc finger MYM-type protein 2. A chromosomal aberration involving ZMYM2 is reported to cause stem cell leukemia lymphoma syndrome (SCLL), which is characterized as lymphoblastic lymphoma in association with a myeloproliferative disorder accompanied by pronounced peripheral eosinophilia and/or prominent eosinophilic infiltrates in the affected bone marrow. (Ref.: Aguilar-Martinez, E., et al. (2015). Proc. Natl. Acad. Sci. USA. 112 (35); E4854-E4863).
Specificity
Clone 9F12.1 detects Zinc finger MYM-type protein 2 in human cells. It targets an epitope within 167 amino acids from the C-teminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 167 amino acids from the C-terminal region of human Zinc finger MYM-type protein 2.ApplicationAnti-ZMYM2, clone 9F12.1, Cat. No. MABN2263, is a highly specific mouse monoclonal antibody that targets Zinc finger MYM-type protein 2 and has been tested in Western Blotting.
Quality
Evaluated by Western Blotting in human hippocampus tissue lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected ZMYM2 in human hippocampus tissue lysate.
Target description
~155 kDa observed; 154.91 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 9F12.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2a NCBI accession no. NP_001177893, UniProt accession no. Q9UBW7, shipped in ambient Gene Information human ... ZMYM2(7750)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-ZNF175 (OTK18) Antibody, clone 2113.11
eCl@ss: 32160702
Кат. номер MABT1491-25UG MABT1491-100UG General descriptionZinc finger protein 175 (UniProt: Q9Y473; also known as Zinc finger protein OTK18) is encoded by the ZNF175 gene (Gene ID: 7728) in human. ZNF175 is zinc finger protein that contains 13 C2H2 type zinc fingers and is shown to be ubiquitous in its expression. ZNF175 displays antiviral activity and it is produced during HIV-1 infection of mononuclear phagocytes in human and interferes with HIV-1 replication by suppressing Tat-induced viral LTR promoter activity. It down-regulates the expression of several chemokine receptors and plays a role in the interaction of viral and host cell factors leading to HIV-1 associated dementia and HIV-1 encephalitis. ZNF175 contains a Kruppel associated box (KBAB; aa 26-89) domain that is responsible for its repressive activity. Plasma levels of ZNF175 are reported to correlate with CD8 count and HIV status. (Ref.: Buescher, J., et al. (2008). J Neuroimmune Pharmacol. 3(4); 230-235).
Specificity
Clone 211 3.1 1 specifically detects human Zinc finger protein 175. It targets an epitope with in the first 178 amino acids from the N-terminal region.ImmunogenEpitope: N-terminus
His-tagged recombinant fragment corresponding to the first 178 amino acids from the N-terminal region of human Zinc finger protein 175.ApplicationAnti-OTK18(ZNF175) clone 211 3.1 1, Cat. No. MABT1491, is a mouse monoclonal antibody that detects Zinc finger protein 175 (OTK18) and has been tested for use in ELISA and Immunocytochemistry.
ELISA Analysis: A representative lot detected OTK18(ZNF175) in ELISA applications (Buescher, J.L., et. al. (2008). J Neuroimmune Pharmacol. 3(4):230-5).
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunocytochemistry in HeLa cells.
Immunocytochemistry Analysis: A 1:50 dilution of this antibody detected OTK18(ZNF175) in HeLa cells.
Target description
81.61 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 2113.11, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunocytochemistry: suitable isotype IgG1 NCBI accession no. NP_009078.1, UniProt accession no. Q9Y473, Узнать цену -
Anti-ZNF281 antibody produced in rabbit
Human Protein Atlas Number: HPA051228 Human Protein Atlas characterization data
Кат. номер HPA051228-100UL HPA051228-25UL Immunogenzinc finger protein 281 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85659,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL immunogen sequence SSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQ conjugate unconjugated UniProt accession no. Q9Y2X9, shipped in wet ice storage temp. 20°C Gene Information human ... ZNF281(23528)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ZNF319 antibody produced in rabbit
Human Protein Atlas Number: HPA052584 Human Protein Atlas characterization data
Кат. номер HPA052584-100UL HPA052584-25UL Immunogenzinc finger protein 319 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85684,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence KCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLKIFHQATDLLEHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSSHS conjugate unconjugated UniProt accession no. Q9P2F9, shipped in wet ice storage temp. 20°C Gene Information human ... ZNF319(57567)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ZNF598 antibody produced in rabbit
Human Protein Atlas Number: HPA041760 Human Protein Atlas characterization data
Кат. номер HPA041760-100UL HPA041760-25UL Immunogenzinc finger protein 598 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82298,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence VVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRPKKEEAAARGPEDPRGPRRSPRTQGEGPGPKETSTNGPVSQ conjugate unconjugated UniProt accession no. Q86UK7, shipped in wet ice storage temp. 20°C Gene Information human ... ZNF598(90850)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ZO-1 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер AB2272-25UG AB2272 General descriptionTight junctions are complexes of proteins that create intercellular boundaries between the plasma membrane domains of epithelial and endothelial cells. Many of the tight junction-associated proteins are members of the membrane associated guanylate kinase (MAGUK) family and include occludin and zona occludin family members ZO-1, ZO-2 and ZO-3. These proteins are thought to have both structural and signaling roles, and are characteristically defined by three protein-protein interaction modules: the PDZ domain, the SH3 domain and the guanylate kinase (GuK) domain. ZO-1 forms complexes with either ZO-2 or ZO-3. In addition, these proteins can also associate with claudin, occludin and F-actin, at tight junction stands, where they provide a linkage between the actin cytoskeleton and the tight junction. ZO-1 expression is significantly reduced in many breast cancer lines. ZO-2 and ZO-3 are ubiquitously expressed within epithelial tight junctions, and unlike ZO-1, which is also expressed at cell junctions of cardiac myocytes, ZO-2 is not expressed in nonepithelial tissue.
Specificity
Other homologies: Rat ( 89% sequence homology).ImmunogenKLH-conjugated linear peptide corresponding to human ZO-1.ApplicationResearch Sub Category
Neuronal & Glial Markers
Detect ZO-1 using this Anti-ZO-1 Antibody validated for use in WB, IH(P).
Research Category
Neuroscience
Immunohistochemistry Analysis: 1:500 dilution from a previous lot detected ZO-1 in normal human testis tissue.
Quality
Evaluated by Western Blot in HepG2 cell lysate.
Western Blot Analysis: 0.1 µg/mL of this antibody detected ZO-1 on 10 µg of HepG2 cell lysate.
Target description
~260 kDa observed
Physical form
Purified rabbit polyclonal in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Affinity purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
HepG2 cell lysateOther NotesConcentration: Please refer to lot specific datasheet.
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_003248, UniProt accession no. Q07157, shipped in ambient","wet ice storage temp. 2-8°C Gene Information human ... TJP1(7082)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-ZP-2 Antibody, clone IE-3
eCl@ss: 32160702
Кат. номер MABE1142-25UG MABE1142 General descriptionZona pellucida sperm-binding protein 2 (UniProt: P20239; also known as Zona pellucida glycoprotein 2, Zp-2, Zona pellucida protein A) is encoded by the Zp2 (also known as Zp-2, Zpa) gene (Gene ID: 22787) in murine species. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The mammalian zona pellucida mediates species-specific sperm binding, induction of the acrosome reaction, and prevents post-fertilization polyspermy. ZP2 is expressed during the 2-week growth phase of oogenesis, prior to ovulation and may act as a secondary sperm receptor and is proteolytically cleaved in the N-terminal part by the metalloendopeptidase ASTL and is exocytosed from cortical granules after fertilization, yielding an N-terminal peptide of about 30 kDa which remains covalently attached to the C-terminal peptide via disulfide bond(s). This cleavage plays an important role in the post-fertilization block to polyspermy. Female mice lacking Zp2 gene do not form a stable zona matrix and are sterile. (Ref.: Hinsch, KD and Hinsch, E. (1999). Andrologia.31(5):320-322.)
Specificity
Clone IE-3 detects Zona pellucida sperm-binding protein 2 in murine species.ImmunogenEpitope: N-terminus
Purified mouse zonae pellucidae.ApplicationAnti-ZP-2, clone IE-3, Cat. No. MABE1142, is a highly specific rat monoclonal antibody that targets Zona pellucida sperm-binding protein 2 and has been tested in ELISA, Immunofluorescence, Immunoprecipitation, and Western Blotting.
Immunoprecipitation Analysis: A representative lot detected ZP-2 in Immunoprecipitation applications (East, I.J., et. al. (1984). J Cell Biol. 98(3):795-800).
Immunofluorescence Analysis: A representative lot detected ZP-2 in Immunofluorescence applications (East, I.J., et. al. (1984). J Cell Biol. 98(3):795-800).
Immunofluorescence A representative lot detected ZP-2 in Immunofluorescence applications (Avella, M.A., et. al. (2016). Sci Transl Med. 8(336):336ra60).
ELISA Analysis: A representative lot detected ZP-2 in Western Blotting applications (East, I.J., et. al. (1984). J Cell Biol. 98(3):795-800; Sun, W., et. al. (1999). Biol Reprod. 60(4):900-7).
Western Blotting Analysis: A representative lot detected ZP-2 in ELISA applications (Sun, W., et. al. (1999). Biol Reprod. 60(4):900-7).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in mouse ovary tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected ZP-2 in 10 µg of mouse ovary tissue lysate.
Target description
~120 kDa observed; 80.21 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone IE-3, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_035905.1, UniProt accession no. P20239, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Zyxin
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABC1387 ABC1387-25UL General descriptionZyxin (UniProt: Q15942; also known as Zyxin-2) is encoded by the ZYX gene (Gene ID: 7791) in human. Zyxin is an evolutionarily conserved LIM domain protein that acts as an adhesion plaque protein concentrated at sites of cell adhesion and is widely expressed. It has been implicated in cell adhesion, cell motility, and signaling. Zyxin is reported to associate with members of the Enabled (Ena)/vasodilator-stimulated phosphoprotein (VASP) family of cytoskeletal regulators and plays a role in cytoskeletal dynamics and signaling. Zyxin contains three LIM zinc binding domains (aa 384-443; 444-503; and 504-570), which act as a negative regulator of Zyxin-VASP complexes. Also, it contains four proline rich ActA repeats (aa 64-77; 94-108; 115-121; and 127-137) that are known to interact directly with Ena/VASP proteins. Loss of Zyxin results in inability to thicken stress fibers in response to mechanical stimuli. (Ref.: Hoffman LM et al (2003). Mol. Cell Biol. 23(1); 70-79; Moody JD et al. (2009). Biochem. Biophys. Res. Commun. 378(3), 625-628; Yoshigi et al (2005). J. Cell Biol. 171(2), 209-215.).
Specificity
This rabbit polyclonal antibody detects Zyxin in human and murine cells. It targets an epitope within 20 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 20 amino acids from the N-terminal region of human Zyxin.ApplicationAnti-Zyxin Antibody, Cat. No. ABC1387, is a rabbit polyclonal antibody that detects Zyxin in human and murine cells and has been tested for use in Immunocytochemistry and Western Blotting.
Western Blotting Analysis: A 1:5,000 dilution from a representative lot detected Zyxin in 10 µg of NIH/3T3 cell lysate.
Immunocytochemistry Analysis: A representative lot detected Zyxin in Immunocytochemistry applications (Hoffman, L.M., et. al. (2003). Mol Cell Biol. 23(1):70-9; Hoffman, L.M., et. al. (2006). J Cell Biol. 172(5):771-82).
Western Blotting Analysis: A representative lot detected Zyxin in Western Blotting applications(Hoffman, L.M., et. al. (2003). Mol Cell Biol. 23(1):70-9; Hoffman, L.M., et. al. (2006). J Cell Biol. 172(5):771-82).
Immunocytochemistry Analysis A 1:600 dilution from a representative lot detected Zyxin in mouse fibroblasts (Courtesy of Dr. Laura Hoffman at Huntsman Cancer Institute, University of Utah).
Western Blotting Analysis: A representative lot detected Zyxin in Western Blotting applications (Moody, J.D., et. al. (2009). Biochem Biophys Res Commun. 378(3):625-8).
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected Zyxin in mouse fibroblast, HeLa, and U2OS cell lysates (Courtesy of Dr. Laura Hoffman at Huntsman Cancer Institute, University of Utah).
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Zyxin in 10 µg of A431 cell lysate.
Target description
~75 kDa observed; 61.28 kDa calculated. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity human, mouse species reactivity (predicted by homology) monkey (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_003452, UniProt accession no. Q15942,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Zyxin antibody, Mouse monoclonal
MDL number: MFCD01634364 NACRES: NA.41
Кат. номер Z0377-200UL Z0377-25UL General descriptionAnti-Zyxin antibody, Mouse monoclonal (mouse IgG2a isotype) is derived from the hybridoma ZOL301 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with a synthetic peptide corresponding to human Zyxin conjugated to KLH via an N-terminal added cysteine. Zyxin is a relatively low abundance component of focal adhesion plaques, stress fibers, and dynamic cell membrane areas such as the leading edge. It may also be found in the cell nucleus. Zyxin is a member of the LIM domain protein family that also includes LPP (Lipoma preferred partner), Trip6 (thyroid hormone interacting protein 6), and Ajuba. It is a phosphoprotein and comprises two major domains, an extended N-terminal domain that contains proline-rich sequence, and a C-terminal domain that contains a functional nuclear export signal and three double zinc-finger cysteine and histidine-rich LIM domains.ApplicationAnti-Zyxin antibody, Mouse has been used in:- Western blotting
- Immunofluorescence staining
- Enzyme linked immunosorbent assay (ELISA)
- Immunocytochemistry
Biochem/physiol Actions
Zyxin interacts with multiple cytoskeletal, signaling and other proteins such as α -actinin, vasodilator-stimulated phosphoprotein (VASP), Mena, LIM-only cysteine-rich proteins (CRP1, CRP2, CRP3/MLP), Vav, breast cancer anti-estrogen resistance protein 1 (p130Cas), CRK-associated substrate-related protein/ (Human Enhancer of Filamentation 1) (CasL/HEF1, and serine-arginine(SR)-related protein (SON) DNA-binding protein. During mitosis a fraction of zyxin was reported to associate with the tumor suppressor h-warts/LATS1 (large tumor suppressor kinase 1) on the mitotic apparatus. Zyxin has been implicated in the regulation and modulation of actin filaments organization, cell adhesion, cell motility, mitosis, and signal transduction. Zyxin may shuttle between focal adhesion plaques and the nucleus. Involvement of zyxin in gene transcription by its association with transcription factors in the nucleus has been suggested.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone ZOL301, monoclonal form buffered aqueous solution mol wt antigen 82-84 kDa species reactivity human, mouse, rat packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","indirect ELISA: suitable","microarray: suitable","western blot: 1-2 µg/mL using total cell extract of HeLa cells. isotype IgG2a conjugate unconjugated UniProt accession no. Q15942, shipped in dry ice storage temp. 20°C Gene Information human ... ZYX(7791)
mouse ... Zyx(22793)
rat ... Zyx(114636)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Hamster IgG Isotype Control (PIP) ColorWheel® Dye-Ready mAb CWA-1014-25UL
Specificity
Clone PIP is an isotype control antibody for Armenian Hamster IgG.ApplicationArmenian Hamster IgG Isotype Control (PIP) ColorWheel<® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any Colorwheel® antibody with any Colorwheel® dye, researchers can quickly and simply produce primary conjugated antibodies for use in single color or multicolor flow cytometry analysis. Each Colorwheel® antibody and dye is lyophilized for long long-term storage, allowing for simplicity and flexibility without compromise
Quality Control Testing:
Evaluated by Flow Cytometry in Protein A/G beads.
Flow Cytometry Analysis: Armenian Hamster IgG Isotype Control (PIP) Colorwheel® Dye-Ready mAb was tested by flow cytometry using Protein A/G beads.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Isotype control antibodies are ideal negative controls for various immunological applications. They can help discriminate between specific antibody signal from non-specific background signal. In selecting an isotype control consideration of host, isotype, conjugation, light chain, and concentration are important. It should be of the same species and isotype as the antibody of interest and must be used at the same concentration and conjugated to the same fluorophore. Armenian Hamster IgG Isotype Control, clone PIP is suitable for use an isotype-matched control for Armenian Hamster IgG. It has unknown binding specificity and can be used for evaluation of background staining caused by non-specific interactions between a Armenian Hamster IgG antibody and the sample under defined experimental conditions.
Physical form
Lyophilized from PBS containing D-Mannitol and Sucrose, normal appearance is a dried pellet. Reconstituted antibody solution is stable and functional as assessed by functional testing. Contains no biocide or preservatives, such as azide.
Reconstitution
1.0 mg/mL after reconstitution at 25 μL in PBS. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C. Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial. Reconstitute each vial by adding 25 μL of PBS. Protect from light.Legal InformationColorWheel is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыbiological source hamster Quality Level 200, antibody form purified antibody antibody product type primary antibodies clone PIP, monoclonal product line ColorWheel® form lyophilized species reactivity hamster packaging antibody small pack of 25 µL application(s) flow cytometry: suitable isotype IgG shipped in ambient storage temp. 2-8°C Узнать цену -
Monoclonal Anti--Amyloid antibody produced in mouse
MDL number: MFCD00803867 NACRES: NA.41
Кат. номер A3981-100UL A3981-200UL A3981-25UL General descriptionThe antibody reacts specifically with β-amyloid protein. The epitope recognized by the antibody resides within amino acids 1-12 of the β-amyloid protein. It specifically stains amyloid plaques within the cortex and amyloid deposits in blood vessels using formic acid-treated, formalin-fixed, paraffin-embedded, and Methacarn-fixed sections of human Alzheimer′s disease (AD) brain tissue.
β-amyloid gene is located on human chromosome 21q21.
The β-amyloid precursor protein (APP) is cleaved sequentially by the proteolytic enzymes β-and γ-secretase to produce β-amyloid (Aβ) peptides with the Aβ1-42 and the Aβ1-40 forms being the most prevalent. Secreted Aβ peptides are degraded either via a re-uptake mechanism followed by endosomal degradation, or by an extracellular insulin degrading enzyme. Extracellular accumulation of Aβ leads to the formation of aggregates, fibrils and eventually amyloid deposits called neuritic plaques, which is the hallmark of Alzheimer′s disease (AD).ImmunogenSynthetic β-amyloid peptide, conjugated to KLH.ApplicationThe antibody is useful in immunohistochemistry, immunoblotting, ELISA, and competitive ELISA. Also, this antibody has been used to neutralize A assemblies in brains of transgenic mice expressing a mutant form of amyloid precursor protein, and for in vivo deep tissue imaging using near-IR optical spectrum.
Mouse monoclonal anti-ABETA was used to treat old WT PDAPP mice with amyloid accumulation and learning deficits in an attempt to improve learning and decrease accumulation, however no response was observed.
Monoclonal Anti-β-Amyloid antibody has been used in immunoprecipitation analysis, microarray-based immunoassay and microarray.
Biochem/physiol Actions
β-amyloid gene acts as the substrate of insulin-degrading enzyme (IDE). It plays a major role in the pathogenesis of Alzheimers disease (AD) and type 2 diabetes mellitus (DM2).
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone BAM-10, monoclonal form buffered aqueous solution species reactivity human packaging antibody small pack of 25 µL concentration ~1.5 mg/mL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 2.5-5 µg/mL using formic-acid treated tissue sections of human Alzheimer disease brain tissue","indirect ELISA: suitable","western blot: suitable isotype IgG1 conjugate unconjugated UniProt accession no. P05067, shipped in dry ice storage temp. 20°C Gene Information human ... APP(351), APP(351)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti--Tubulin antibody produced in mouse
MDL number: MFCD00677366 NACRES: NA.41
Кат. номер T5326-200UL T5326-100UL T5326-25UL General descriptionγ-Tubulin, mapped on human chromosome 17q21.2, codes for a member of the tubulin family. It is localized to the microtubule organizing centres. γ-Tubulin consists of two isoforms tubulin γ 1 (TUBG1) and tubulin γ 2 (TUBG2) with 97.3% amino acid identity. In addition to these two isoforms, γ-tubulin pseudogene (TUBG1P) is also been identified on human chromosome 17. Human TUBG1 and TUBG2 transcripts are widely expressed in preimplantation embryos and the brain, respectively. γ-tubulin is a component of γ-tubulin ring complex (γ-TuRC), which has roughly the same diameter as a microtubule.
Specificity
The antibody recognizes an epitope located within the N-terminal region of γ-tubulin.Immunogensynthetic γ-tubulin peptide, conjugated to KLHApplicationMonoclonal Anti--Tubulin antibody produced in mouse has been used in following studies:- Western blot analysis
- Immunohistochemistry
- Immunocytology
Biochem/physiol Actions
-Tubulin nucleates microtubule assembly throughout the mammalian cell cycle in vivo. In Aspergillus nidulans, -tubulin facilitates attachment of microtubules to the spindle pole body, nuclear division and microtubule assembly. Ubiquitination of -tubulin by breast cancer 1 protein (BRCA1) is a crucial step in the regulation of centrosome number. Overexpression of -tubulin is observed in lung cancer. Tubulin 2 (TUBG2) plays a vital role in cell growth. Aberration in the -tubulin gene alters microtubule assembly. The expression levels of -tubulin can be considered as an important prognostic indicator for patients with astrocytomas.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2-8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody (purified from hybridoma cell culture) antibody product type primary antibodies clone GTU-88, monoclonal form buffered aqueous solution mol wt antigen 48 kDa species reactivity bovine, mouse, rat, chicken, Xenopus, human, hamster, canine packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunocytochemistry: 1-2 µg/mL using HeLa cells","immunoprecipitation (IP): suitable","indirect ELISA: suitable","microarray: suitable","western blot: 1-2 µg/mL using total cell extract of chicken fibroblasts isotype IgG1 UniProt accession no. P23258, shipped in dry ice storage temp. 20°C Gene Information human ... TUBG1(7283)
mouse ... Tubg1(103733)
rat ... Tubg1(252921)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti--Tubulin I+II antibody produced in mouse
MDL number: MFCD00145892
Кат. номер T8535-.2ML T8535-100UL T8535-25UL T8535-.5ML General descriptionβ-tubulin belongs to the subfamily of tubulins, which are the major building blocks of microtubules. β-tubulin has a molecular weight of 55kDa. β-tubulin structure is characterized with a core of two β-sheets enclosed by α-helices. In addition, it also contains an N-terminal domain with the guanine nucleotide-binding region, an intermediate domain with taxol-binding site and a C-terminal domain that contains the binding surface for molecular motor proteins. β-tubulin I and II is encoded by the gene mapped to human chromosome 20 and 6p25.2 respectively.
Monoclonal Anti-β-Tubulin Isotype I + II (mouse IgG2b isotype) is derived from the JDR.3B8 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from immunized BALB/c mice.
Specificity
The antibody specifically recognizes an epitope located on isotypes I and II of β-tubulin. No cross-reactivity with other tubulin isotypes is observed.Immunogensynthetic peptide corresponding to the C-terminal sequence of human β-tubulin isotype II coupled to BSAApplicationMonoclonal Anti--Tubulin I+II antibody produced in mouse has been used in following studies:- immunoblot
- immunofluorescence technique
- immunohistochemistry.
Monoclonal Anti--Tubulin I+II antibody produced in mouse has been used in:- enzyme linked immunosorbent assay (ELISA)
- immunohistochemistry
- western blotting
- immunoblotting
- dot blot
- immunocytochemistry
Biochem/physiol Actions
β-1 tubulin, also known as class VI or TUBB1, plays a vital role in platelet production and is considered to be a potential biomarker candidate for immune thrombocytopenia (ITP). Mutation in the gene leads to various neuronal migration disorders such as lissencephaly, pachygyria and polymicrogyria malformations. B2702 peptide binds to β-tubulin and inhibits natural killer (NK) cell cytotoxicity and it influences microtubule polymerization, which damages cytoskeleton organization and chaperone-like activity of tubulin. Tubulin β 2B class IIb (TUBB2B)/β-tubulin II plays a vital role in migration/organization and axon guidance processes. Mutation in β-tubulin gene is associated with the development of asymmetric polymicrogyria (PMG).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form ascites fluid antibody product type primary antibodies clone JDR.3B8, monoclonal contains 15 mM sodium azide species reactivity human, chicken, mouse, rat, bovine, pig packaging antibody small pack of 25 µL application(s) indirect ELISA: suitable","indirect immunofluorescence: suitable","microarray: suitable","western blot: 1:1,000 using a chicken fibroblast extract or a chicken brain microtubule proteins preparation isotype IgG2b conjugate unconjugated UniProt accession no. Q13885,","Q9H4B7, shipped in dry ice storage temp. 20°C Gene Information human ... TUBB1(81027), TUBB2A(7280), TUBB2C(10383)
mouse ... Tubb1(545486), Tubb2a(22151), Tubb2c(227613)
rat ... Tubb2(29212), Tubb2c(296554)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti--Tubulin III (neuronal) antibody produced in mouse
MDL number: MFCD01323870 NACRES: NA.41
Кат. номер T8578-100UL T8578-25UL T8578-200UL General descriptionTubulin β 3 class III (TUBB3) also known as β-Tubulin III, is encoded by the gene mapped to human chromosome 16q24.3. TUBB3 protein expression is restricted to neurons.ApplicationMonoclonal Anti--Tubulin III (neuronal) antibody produced in mouse has been used in following studies:- Immunofluorescence.
- Immunocytochemistry.
Biochem/physiol Actions
Tubulin β 3 class III (TUBB3) plays a vital role in nervous system development and axon guidance. Mutation of the gene encoding protein leads to the ocular motility disorder, congenital fibrosis of the extraocular muscle type 3 (CFEOM3), and various neurological syndromes. Altered expression of the protein affects microtubule dynamics and microtubule-kinesin interactions. Increased expression of TUBB3 is observed in tumor tissues. Decreased expression of TUBB3 can be considered as an important marker for poor prognosis of cutaneous malignant melanoma. TUBB3 is implicated in the suppression of invasive growth of tumor tissue;therefore, it is considered to be a potential target for development of antitumor drugs.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 2G10, monoclonal form buffered aqueous solution mol wt antigen ~50 kDa species reactivity human, rat, mouse packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 0.25-0.5 µg/mL using PC12 cell extract isotype IgG2a conjugate unconjugated UniProt accession no. Q13509, shipped in dry ice storage temp. 20°C Gene Information human ... TUBB3(10381)
mouse ... Tubb3(22152)
rat ... Tubb3(246118)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti--Tubulin III antibody produced in mouse
MDL number: MFCD01323870 NACRES: NA.41
Кат. номер T8660-25UL T8660-100UL T8660-.2ML T8660-.5ML General descriptionMonoclonal Anti-μ Tubulin Isotype III (mouse IgG2b isotype) is derived from the SDL.3D10 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice.
Tubulin β 3 class III (TUBB3) also known as β-Tubulin III, is encoded by the gene mapped to human chromosome 16q24.3. TUBB3 protein expression is restricted to neurons.
Specificity
The antibody specifically recognizes an epitope located on isotype III of β-tubulin. No cross-reactivity with other tubulin isotypes is observed. The antibody can stimulate microtubule assembly when reconstituted with tubulin and either tau or MAP2.Immunogensynthetic peptide corresponding to the C-terminal sequence of human β-tubulin isotype III coupled to BSAApplicationIt has also been used in immunofluorescence analysis.
Monoclonal Anti--Tubulin III antibody produced in mouse has been used in following studies:- Immunocytochemistry.
- Flow cytometry.
- Immunoblotting.
Biochem/physiol Actions
Tubulin β 3 class III (TUBB3) plays a vital role in nervous system development and axon guidance. Mutation of the gene encoding protein leads to the ocular motility disorder, congenital fibrosis of the extraocular muscle type 3 (CFEOM3), and various neurological syndromes. Altered expression of the protein affects microtubule dynamics and microtubule-kinesin interactions. Increased expression of TUBB3 is observed in tumor tissues. Decreased expression of TUBB3 can be considered as an important marker for poor prognosis of cutaneous malignant melanoma. TUBB3 is implicated in the suppression of invasive growth of tumor tissue;therefore, it is considered to be a potential target for development of antitumor drugs.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form ascites fluid antibody product type primary antibodies clone SDL.3D10, monoclonal contains 15 mM sodium azide species reactivity bovine, boar, rat, human packaging antibody small pack of 25 µL enhanced validation knockout application(s) indirect ELISA: suitable","western blot: 1:400 using a rat brain extract isotype IgG2b conjugate unconjugated UniProt accession no. Q13509, shipped in dry ice storage temp. 20°C Gene Information human ... TUBB3(10381)
rat ... Tubb3(246118)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti--Tubulin Isotype III antibody produced in mouse
MDL number: MFCD08705576 NACRES: NA.41
Кат. номер T5076-200UL T5076-25UL General descriptionTubulin β 3 class III (TUBB3) encodes for the microtubule protein tubulin β3, which is majorly expressed in neurons. The gene is located on human chromosome 16q24.3.
Tubulin is the main constituent of microtubules made up of two similar polypeptides α and β, each with 50 kD (approx.) molecular weight. It has several cellular functions like mitosis, meiosis, some forms of organellar movement, intracellular transport, flagellar movement and cytoskeletal functions. Monoclonal anti-β-tubulin isotype III antibody can be used in microarray and western blotting. It can also be used in immunoblotting. Mouse anti-β-tubulin isotype III antibody reacts specifically with an epitope present on the β-tubulin (isotype III) of bovine, rat, mouse, boar and human but not with tubulin present in chicken brain preparation or in a chicken fibroblasts cell line.Immunogenpeptide corresponding to the carboxy-terminal sequence of human β-tubulin isotype III, conjugated to BSA.ApplicationMonoclonal Anti-β-Tubulin Isotype III antibody produced in mouse has been used in immunolabelling and flow cytometry.
Monoclonal anti-β-tubulin isotype III antibody (diluted 1:500) can be used as a primary antibody in immunocytochemical analysis of neurons. It can also be used for the localization of isotype III of β-tubulin by several immunochemical assays like dot blot, ELISA and immunohistochemistry.
Biochem/physiol Actions
Tubulin β 3 class III (TUBB3) regulates neurogenesis and is involved in axon guidance and maintenance. Mutations in this gene is associated with hypoplasia of commissural axon (CA), congenital fibrosis of the extraocular muscles type 3 (CFEOM3) and dysgyria.
Physical form
Solution in 0.01 M phosphate buffered saline containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone SDL.3D10, monoclonal form buffered aqueous solution species reactivity human, bovine, mouse, rat, boar packaging antibody small pack of 25 µL concentration ~2 mg/mL application(s) dot blot: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable","indirect ELISA: suitable","microarray: suitable","western blot: 0.1-0.2 µg/mL using rat brain extract isotype IgG2b conjugate unconjugated UniProt accession no. Q13509, shipped in dry ice storage temp. 20°C Gene Information human ... TUBB3(10381)
mouse ... Tubb3(22152)
rat ... Tubb3(246118)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-Acetylated Tubulin antibody produced in mouse
MDL number: MFCD00164512 NACRES: NA.41
Кат. номер T7451-200UL T7451-25UL T7451-100UL General descriptionMonoclonal Anti-Acetylated Tubulin (mouse IgG2b isotype) is derived from the hybridoma 6-11B-1 produced by the fusion of mouse myeloma cells and splenocytes from a mouse immunized with acetylated tubulin from the outer arm of Strongylocentrotus purpuratus (sea urchin). Tubulin is a heterodimer, which consists of a-tubulin and b-tubulin; both subunits have a molecular weight of 50,000 and share considerable homology.
α-tubulin, also called as tubulin α 4a (TUBA4A), is mapped to human chromosome 2q35. The gene codes for a member of the α -tubulin family containing 448 amino acids. TUBA4A belongs to the subfamily of tubulin, which is the major building block of microtubules. α-subunit of tubulin has molecular weight of 50,000.
Specificity
The antibody has been used to detect acetylated -tubulins from many organisms including protista, plants, invertebrates, and vertebrates. The antibody recognizes an epitope located on the 3 isoform of Chlamydomonas axonemal -tubulin, within four residues of Lys40 when this amino acid is acetylated. A sequence very similar to the one detected by the antibody in Chlamydomonas is found in the majority of -tubulins, but the corresponding region is markedly divergent in some -tubulin isoforms from chicken, Drosophila, and yeast. Occasionally, the epitope recognized by the antibody may be absent or masked, as it is in the rat kangaroo epithelial-like cell line PtK2.Immunogenacetylated tubulin from the outer arm of Strongylocentrotus purpuratus (sea urchin).ApplicationMonoclonal Anti-Acetylated Tubulin antibody produced in mouse has been used in western blot and immunohistochemistry.
Monoclonal Anti-Acetylated Tubulin antibody produced in mouse has also been used in quantitative dot blot, immunofluorescence, Western blot, immunocytochemistry, enzyme linked immunosorbent assay (ELISA), solid phase radioimmunoassay (RIA) and electron microscopy.
Biochem/physiol Actions
Acetylated tubulin is associated with axoneme assembly in a variety of organisms. Acetylated tubulin might play a crucial role in the differentiation of microtubule structure and function. Post translational modification of α-tubulin i.e. the reversible addition of an acetyl group to Lys40, by specific acetylase, results in acetylated tubulin.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 6-11B-1, monoclonal form buffered aqueous solution species reactivity plant, hamster, rat, mouse, human, pig, monkey, frog, invertebrates, bovine, protista, chicken packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) dot blot: suitable","electron microscopy: suitable","immunohistochemistry: suitable","radioimmunoassay: suitable","western blot: 0.03-0.06 µg/mL using total rat brain extract isotype IgG2b conjugate unconjugated Featured Industry Research Pathology UniProt accession no. P68366, shipped in dry ice storage temp. 20°C Gene Information human ... TUBA4A(7277)
mouse ... Tuba1a(22142)
rat ... Tuba1a(64158)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-Actin (plant) antibody produced in mouse
MDL number: MFCD00145889 NACRES: NA.41
Кат. номер A0480-200UL A0480-25UL General descriptionArabidopsis has a complex actin gene family that encodes six protein subclasses. One of the classes is represented by the proteins ACT2 and ACT8, which are similar proteins, but have different flanking sequences, introns and silent nucleotide positions in codons. ACT8 is expressed in root, stems, leaves, flowers, pollen and siliques.
Monoclonal Anti-Actin (plant) antibody recognizes actin in several plant species including Dictyostelium. In Arabidopsis, the antibody recognizes all eight actins isoforms (ACT1, 2, 3, 4, 7, 8, 11 and 12).
Monoclonal Anti-Actin (plant) (mouse IgG2b isotype) is derived from the hybridoma 10-B3 (MabGPa) produced by the fusion of mouse myeloma cells (SP2/0 cells) and splenocytes from BALB/c mice immunized with ACT8 protein. In Arabidopsis, actin is divided into two major phylogenetic classes namely reproductive and vegetative class.ImmunogenACT8 protein.ApplicationMonoclonal Anti-Actin (plant) antibody produced in mouse has been used in:- two-layer phos-tag polyacrylamide gel electrophoresis (PAGE)
- immunohistochemistry and enzyme-linked immunosorbent assay (ELISA).
- immunoblotting
Biochem/physiol Actions
In Arabidopsis ACT7 isovariant is essential for normal phytohormone response to hormones in different organs. Mutation in the actin (ACT)1 gene is associated with the development of dwarfism in plants in addition to delayed flowering, highly reduced organ size and varied branching pattern of the leaf trichomes and inflorescence stem. In plants, there is a developmental switch in the modulation of actin isovariants throughout cell differentiation and maturation phase.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 10-B3 (MAbGPa), monoclonal mol wt antigen ~45 kDa species reactivity plant packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable, indirect ELISA: suitable, western blot: 1-2 µg/mL using corn leaves extracts isotype IgG2b conjugate unconjugated shipped in dry ice storage temp. 20°C Gene Information Arabidopsis thaliana ... ACT8(841347)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-AGO2 antibody produced in rat
NACRES: NA.41
Кат. номер SAB4200085-200UL SAB4200085-25UL General descriptionMonoclonal Anti-AGO2 (rat IgG2a isotype) is derived from the hybridoma 11A9 produced by the fusion of mouse myeloma cells (P3X63Ag8.653) and splenocytes from rat immunized with a peptide corresponding to amino acids 1-15 of human AGO2. Monoclonal Anti-AGO2 recognizes human, monkey, bovine, rat and mouse AGO2. Argonaute 2 (Ago2) is encoded by the gene mapped to human chromosome 8q24.3. The encoded protein belongs to the Ago protein family. AGO2 is mainly localized on the diffuse cytoplasm and stress granules.ApplicationMonoclonal Anti-AGO2 antibody produced in rat has been used in:- immunofluorescent localization
- western blot analysis
- immunoprecipitation.
Biochem/physiol Actions
Argonaute 2 (Ago2) plays a vital role in short interfering RNA-mediated gene silencing. The encoded protein is regulated at both the transcriptional and posttranslational level in human breast cancer cell lines. Ago2 and enhanced micro-RNA activity is involved in the tumorigenic progression of breast cancer cell lines. Overexpression of the gene has been observed in hepatocellular carcinoma (HCC), head and neck squamous cell carcinoma patients.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20°C. For continuous use, the product may be stored at 2-8°C for up to one month. For extended storage, freeze at -20°C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.Other NotesCell lysates should not be boiled before loading onto SDS-PAGE, but only warmed to 60°C for 15 min. In order to obtain the best results using various techniques and preparations, we recommend determining optimal working dilutions by titration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 11A9, monoclonal form buffered aqueous solution mol wt antigen ~85 kDa species reactivity mouse, human, rat, monkey, bovine packaging antibody small pack of 25 µL concentration ~1.5 mg/mL application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 0.5-1.0 µg/mL using HeLa cell extracts isotype IgG2a conjugate unconjugated UniProt accession no. Q9UKV8, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-ARP3 antibody produced in mouse
MDL number: MFCD04118400 NACRES: NA.41
Кат. номер A5979-25UL A5979-200UL A5979-100UL General descriptionMonoclonal Anti-ARP3 (mouse IgG2b isotype) is derived from the hybridoma FMS338 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with recombinant human ARP3. Arp3 is mapped to human chromosome 2q14.1.Immunogenrecombinant human ARP3.ApplicationMonoclonal Anti-ARP3 antibody produced in mouse has been used in:- enzyme linked immunosorbent assay (ELISA)
- immunocytochemistry
- immunoblotting
- immunoprecipitation
- immunofluorescence
- immunohistochemistry
Biochem/physiol Actions
The actin-related protein-2/3 (ARP2/3) is part of Wiskott-Aldrich Syndrome protein (WASP) signaling in mediating polymerization state of actin filaments. It has been found that ARP2/3 complex and its activator spinocerebellar ataxia, autosomal recessive 2 (Scar2) are involved in Golgi polarization in NIH 3T3 cells. However in primary astrocytes, Golgi polarization involves neither actin cytoskeleton or Arp2/3 complex nor any WASP-family of proteins. In a different model, it was found that the ARP2/3 complex was necessary for neutrophil chemotaxis and phagocytosis. By genetic and loss of function studies, it was demonstrated that Scar2 is the major regulator of the ARP2/3 complex rather than the WASP family of proteins, the latter having more restricted roles in specific cellular events.
The ARP2/3 complex consists of seven distinct proteins (Arp2 and Arp3, p41-Arc, p34-Arc, p21-Arc, p20-Arc, and p16-Arc) that modulate polymerization of cellular actin filaments. ARP3 regulates actin nucleation, and is involved in directing the movement of Listeria monocytogenes in infected host cells. Monoclonal Anti-ARP3 antibody binds to human, canine, rat, and mouse ARP3.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone FMS338, monoclonal form buffered aqueous solution mol wt antigen 40-45 kDa species reactivity rat, canine, mouse, human packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","indirect ELISA: suitable","microarray: suitable","western blot: 0.25-0.5 µg/mL using total cell extract of mouse myoblast C2 cells isotype IgG2b conjugate unconjugated UniProt accession no. P61158, shipped in dry ice storage temp. 20°C Gene Information human ... ACTR3(10096)
mouse ... Actr3(74117)
rat ... Actr3(81732)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-BOP1 antibody produced in rat
NACRES: NA.41
Кат. номер SAB4200081-25UL SAB4200081-200UL General descriptionMonoclonal Anti- BOP1 (rat IgG1 isotype) is derived from the hybridoma BOP 6H11 produced by the fusion of mouse myeloma cells (P3X63Ag8.653) and splenocytes from rat immunized with a peptide corresponding to a fragment of human BOP1, coupled to ovalbumin.ApplicationMonoclonal Anti-BOP1 antibody produced in rat has been used in several immunochemical techniques including immunoblotting, immunoprecipitation, and immunocytochemistry.
Biochem/physiol Actions
Ribosome biogenesis protein BOP1 is an essential component of A nucleolar complex, PeBoW that is involved in ribosome biogenesis and cell proliferation. Fluctuations in Bop1 protein level were found to affect the assembly and integrity of the whole PeBoW (Pes1, Bop1, and WDR12) complex. Overexpression of Bop1 mRNA is associated with the development of colorectal cancer.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone BOP 6H11, monoclonal form buffered aqueous solution mol wt antigen ~100 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 0.5-1.0 µg/mL using HeLa cell extracts conjugate unconjugated UniProt accession no. Q14137, shipped in dry ice storage temp. 20°C Gene Information human ... BOP1(23246)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-BRD7 antibody produced in rat
NACRES: NA.41
Кат. номер SAB4200047-25UL SAB4200047-200UL General descriptionMonoclonal Anti-BRD7 (rat IgG2a isotype) is derived from the hybridoma BRM 2D3 produced by the fusion of mouse myeloma cells (P3X63Ag8.653) and splenocytes from rat immunized with a fusion protein expressing a fragment of human BRD7. Bromodomain containing (BRD7) is a novel bromodomain gene.ApplicationMonoclonal Anti-BRD7 antibody produced in rat has been used in several immunochemical techniques including- immunoblotting
- immunoprecipitation
- immunocytochemistry
Biochem/physiol Actions
Bromodomain containing (BRD7) inhibits cell growth and cell cycle progression by transcriptional regulation of some cell cycle-related genes as well as some important molecules involved in ras/mitogen-activated protein kinase(MEK)/extracellular-signal-regulated kinase (ERK) and retinoblastoma tumor suppressor protein (RB)/ E2 factor (E2F) pathways. Its transcriptional down regulation has been shown to be critical to the pathogenesis of nasopharyngeal carcinoma (NPC). Specifically, DNA methylation decreases the expression of BRD7 in NPC cells. Furthermore, DNA methylation of BRD7 promoter is increased in the tumor and in matched blood samples from NPC patients than in blood samples from healthy individuals. Therefore, it has been suggested that DNA methylation of BRD7 promoter might act as a potential diagnostic marker in NPC.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone BRM 2D3, monoclonal form buffered aqueous solution mol wt antigen ~80 kDa species reactivity human, bovine, canine, monkey, rat, mouse packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 0.5-1.0 µg/mL using HeLa cells extract isotype IgG2a conjugate unconjugated UniProt accession no. Q9NPI1, shipped in dry ice storage temp. 20°C Gene Information human ... BRD7(29117)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-C/EBP antibody produced in rat
MDL number: MFCD04118430 NACRES: NA.41
Кат. номер SAB4200196-25UL SAB4200196-200UL General descriptionMonoclonal Anti-C/EBPβ (rat IgG2a isotype) is derived from the hybridoma 7H5 produced by the fusion of mouse myeloma cells (SP2) and splenocytes from rat immunized with a mouse C/EBPβ fusion protein. CCAAT/enhancer binding proteins β (C/EBPβ) belongs to the highly conserved family of C/EBP transcription factors. It possesses a C-terminal basic region-leucine zipper (bZIP) domain, which is essential for DNA binding. C/EBPβ has two central regulatory domains (RDs), RD1 and RD2.Immunogenmouse C/EBPβ fusion proteinApplicationMonoclonal Anti-C/EBPβ antibody produced in rat has been used in immunoblotting and immunocytochemistry.
Biochem/physiol Actions
CCAAT/enhancer binding proteins β (C/EBPβ) exhibits plasticity with respect to various transcriptional activities it takes part in. It regulates IL-6 (interleukin-6) and IL-6-induced expression of the cytokines IL-1, IL-8, tumor necrosis factor-α (TNFα) and granulocyte colony-stimulating factor (G-CSF). C/EBPβ modulates acute phase response proteins such as α1-acid glycoprotein, α2-microglobulin and C-reactive protein. It is implicated in the development of the mammary gland and , in cell proliferation. C/EBPβ regulates survival in liver and in response to injuries and hormones in lungs. It plays a role in human breast tumorigenesis.
Physical form
Solution in 0.01M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 7H5, monoclonal form buffered aqueous solution mol wt ~37 kDa species reactivity mouse packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunocytochemistry: suitable","western blot: 2.0-4.0 µg/mL using L929 or 3T3 cell extracts isotype IgG2a conjugate unconjugated UniProt accession no. P28033, shipped in dry ice storage temp. 20°C Gene Information mouse ... CEBPB(12608)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-Caspase 11 antibody produced in rat
MDL number: MFCD02095975 NACRES: NA.41
Кат. номер C1354-25UL C1354-100UL C1354-.2ML General descriptionCaspases are proteases having similar structure, substrate specificity and can be divided into three subfamilies based upon their amino acid sequence homology.Monoclonal Anti-Caspase 11 (rat IgG2a isotype) is derived from the 17D9 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from rat immunized with a recombinant p30 subunit of mouse caspase 11. Caspase 11 (also known as Ich-3) gene encodes two protein products of 38 and 43 kDa that belong to the Ced3/ICE family of cystein proteases. Caspase 11 is an “upstream” caspase with a long prodomain. Caspase 11 is identified in murine and shares homology with the human caspase 4 and 5.Immunogenrecombinant p30 subunit of mouse caspase 11.ApplicationMonoclonal Anti-Caspase 11 antibody can be used in immunohistochemistry and immunoprecipitation. It is also useful in immunoblotting
Biochem/physiol Actions
Caspases are normally produced in the cell as inactive procaspases. Caspase 11 can induce apoptosis in cultured cells due to overexpression. Monoclonal antibodies reacting specifically with caspase 11 are useful tool for the study of the protease network, involved in development and regulation, governing the life and death of cells and tissues.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% BSA and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 17D9, monoclonal form buffered aqueous solution species reactivity mouse packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 5-10 µg/mL using mouse EL4 cell extracts.","immunohistochemistry (frozen sections): suitable","immunoprecipitation (IP): suitable isotype IgG2a conjugate unconjugated UniProt accession no. P70343, shipped in dry ice storage temp. 20°C Gene Information mouse ... Casp4(12363)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-Chimerin 2 antibody produced in rat
NACRES: NA.41
Кат. номер SAB4200059-200UL SAB4200059-25UL General descriptionMonoclonal Anti-Chimerin β2 (rat IgG2a isotype) is derived from the hybridoma HAR 2E3 produced by the fusion of mouse myeloma cells and splenocytes from rat immunized with a fusion protein of full length human Chimerin β2. Chimerin β2 (CHN2) is a member of the chimerin family and encodes a protein with a phorbol-ester/ diacylglycerol (DAG)-type zinc finger containing C1 domain, a Rho-GTPase activating proteins (GAP) domain and an Src homology 2 (SH2) domain. Chimerin β2 gene is mapped to human chromosome 7p14.3.
Specificity
Monoclonal Anti-Chimerin b2 recognizes human, monkey, bovine, mouse and rat Chimerin b2.Immunogenfusion protein of full length human Chimerin β2ApplicationMonoclonal Anti-Chimerin β2 antibody produced in rat has been used in immunoblotting at a dilution of 1:1000 and immunocytochemistry.
Biochem/physiol Actions
Chimerin β2 protein (CHN2) is a high affinity receptor for the phorbol esters and diacylglycerol (DAG). Binding of DAG induces translocation of the protein from the cytosol to the Golgi apparatus membrane. It has guanosine triphosphatase GTPase-activating protein activity regulated by phospholipid binding. Decreased expression of CHN2 gene is associated with high-grade gliomas and breast. Deregulation in expression of CHN2 gene is associated with lymphomas, glioblastoma and insulin resistance. Mutations in the CHN2 gene have been associated with schizophrenia in men.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at -20 °C. For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze at -20 °C in working aliquots. Repeated freezing and thawing,, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone HAR 2E3, monoclonal form buffered aqueous solution mol wt antigen ~43 kDa species reactivity bovine, human, rat, monkey, mouse packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunocytochemistry: suitable","western blot: 1.0-2.0 µg/mL using Neuro-2a cell extracts isotype IgG2a conjugate unconjugated UniProt accession no. P52757, shipped in dry ice storage temp. 20°C Gene Information human ... CHN2(1124)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-Collagen, Type VII antibody produced in mouse
NACRES: NA.41
Кат. номер SAB4200686-100UL SAB4200686-25UL General descriptionMonoclonal Anti-Collagen Type VII (mouse IgG1 isotype) is derived from the hybridoma LH7.2 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice. Collagen Type VII (known also as Col7), which belongs to the collagen superfamily, is a major extracellular matrix component of the anchoring fibrils in lamina densa. COL7A1 (collagen type VII alpha 1 chain) gene codes for type VII collagen. It is located on human chromosome 3p. It is expressed by keratinocytes and fibroblasts. COL7A1 is the important component the anchoring fibrils.Immunogeninsoluble fractions prepared from neonatal foreskin epidermal cellsApplicationMonoclonal Anti-Collagen, Type VII antibody produced in mouse has been used in:- enzyme-linked immunosorbent assay (ELISA)
- immunoblotting
- immunohistochemistry
- immunofluorescence
Biochem/physiol Actions
Collagen type VII is very essential for adhesive connection between the dermis and the epidermal basement membrane zone (BMZ). Mutations in collagen type VII cause dystrophic forms of epidermolysis bullosa (including recessive dystrophic epidermolysis bullosa (RDEB)), which manifest as skin fragility and malformed enamel.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone LH7.2, monoclonal form buffered aqueous solution species reactivity human packaging antibody small pack of 25 μL concentration ~1 mg/mL application(s) immunoblotting: suitable, immunohistochemistry: 1.5-3 μg/mL using frozen human tonsil sections isotype IgG1 shipped in dry ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-Cytokeratin, pan antibody produced in mouse
NACRES: NA.41
Кат. номер C5992-25UL C5992-100UL C5992-200UL General descriptionMonoclonal Anti-Pan Cytokeratin (mouse IgG1 isotype) is derived from the PCK-26 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a cytokeratin preparation from human epidermis. Cytokeratins are a group of at least 29 different proteins. They are characteristic of epithelial and trichocytic cells. Cytokeratin peptide 1 (68 kDa) is expressed together with cytokeratin 10 in the suprabasal cell layers or the differentiation compartment of the epidermis. Its expression increases with epidermal maturation and is modified post translationally in terminally differentiated keratinocytes of the stratum corneum. Cytokeratin peptide 5 (58 kDa) is the primary type II keratin in stratified epithelia, while cytokeratin type 8 (52 kDa) is a major type II keratin in simple epithelia. Cytokeratin 6 (56 kDa) is a "hyperproliferation" cytokeratin expressed in tissues with natural or pathological high turnover. Monoclonal antibodies to cytokeratins are specific markers of epithelial cell differentiation and have been widely used as tools in tumor identification and classification.
Specificity
The antibody recognizes an epitope located on the Type II cytokeratins 1, 5, 6, and 8. PCK-26 is a broad spectrum antibody which reacts specifically with a variety of normal, reactive, and neoplastic epithelial tissues. The antibody reacts with simple, cornifying, and non-cornifying squamous epithelia and pseudostratified epithelia.Immunogencytokeratin from human epidermis.ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper),
Monoclonal Anti-Cytokeratin, pan antibody produced in mouse has been used in:- immunoblotting
- immunohistochemistry
- Immunocytochemistry
- dot blotting
Biochem/physiol Actions
Cytokeratin facilitates the typing of normal, metaplastic, and neoplastic cells and may aid in the discrimination of carcinomas and non-epithelial tumors such as sarcomas, lymphomas, and neural tumors. It is also useful in detecting micrometastases in lymph nodes and other tissues, and for determining the origin of poorly differentiated tumors.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone PCK-26, monoclonal form buffered aqueous solution species reactivity pig, human, guinea pig, carp, rabbit, rat, goat, snake, feline, hamster, chicken, mouse, lizard, sheep, canine, bovine packaging antibody small pack of 25 μL concentration ~1.5 mg/mL application(s) dot blot: suitable, immunocytochemistry: suitable, immunohistochemistry: 10-20 μg/mL using human placenta or skin, western blot: suitable isotype IgG1 conjugate unconjugated shipped in dry ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Monoclonal Anti-DNA polymerase p125 antibody produced in rat
NACRES: NA.41
Кат. номер SAB4200053-25UL SAB4200053-200UL General descriptionMonoclonal Anti-DNA polymerase d p125 (rat IgG2a isotype) is derived from the hybridoma PDG 5G1 produced by the fusion of mouse myeloma cells (P3X63Ag8.653) and splenocytes from rat immunized with human p125. The catalytic subunit p125 (POLD1), which is encoded by the Pold1 gene, is highly conserved among eukaryotes. Pold1 comprises of two primary functional domains: an exonuclease domain near the N-terminus and the subsequent polymerase domain.Immunogenhuman p125ApplicationMonoclonal Anti-DNA polymerase p125 antibody produced in rat has been used in:- immunoblotting
- immunoprecipitation
- immunocytochemistry
- co-immunoprecipitation
Biochem/physiol Actions
The exonuclease domain of the catalytic subunit p125 (POLD1) has the ability to catalyze 3′−5′ exonucleolytic proofreading and the polymerase domain helps to catalyze DNA synthesis. Mutations in this subunit have been implicated in mammalian embryogenesis and tumorigenesis.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone PDG 5G1, monoclonal form buffered aqueous solution mol wt antigen ~125 kDa species reactivity human, mouse, rat packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 0.5-1.0 µg/mL using Jurkat cells extract conjugate unconjugated UniProt accession no. P28340, shipped in dry ice storage temp. 20°C Gene Information human ... POLD1(5424)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Monoclonal Anti-DNA polymerase p50 antibody produced in rat
NACRES: NA.41
Кат. номер SAB4200054-25UL SAB4200054-200UL General descriptionMonoclonal Anti-DNA polymerase δ p50 (rat IgG2a isotype) is derived from the hybridoma PDK 7B4 produced by the fusion of mouse myeloma cells (P3X63Ag8.653) and splenocytes from rat immunized with human p50. DNA polymerase δ consists of the proliferating cell nuclear antigen (PCNA), the multi-subunit replication factor C, and the 4 subunit DNA polymerase complex: DNA Polymerase δ 1, 2, 3, 4 (POLD1, POLD2, POLD3 and POLD4). The core DNA polymerase δ exists as a heterodimeric enzyme with subunits of 125 and 50 kDa.
The DNA polymerase δ 2 subunit (POLD2) gene, with 11 exons spanning 10kb of genomic DNA, is mapped to human chromosome 7. The gene encoding 50kDa protein is characterized with the G+C-rich 5′-flanking region and it lacks a typical TATA box. The encoded protein is one of the components of human DNA Pol δ complex.Immunogenhuman p50ApplicationMonoclonal Anti-DNA polymerase p50 antibody has been used in- immunoblotting
- immunoprecipitation
- immunocytochemistry
- western blot analysis
Biochem/physiol Actions
DNA polymerase δ 2 subunit (POLD2) gene codes for a protein that participates in DNA replication and repair. In COS-7 cells, regulatory region of the hPOLD2 gene has ability to facilitate the expression of chloramphenicol acetyltransferase reporter gene. Phosphatase and tensin homolog (PTEN) tumor suppressor gene decrease the expression of POLD2 gene associated with ovarian carcinogenesis. This protein might also function as a potential prognostic biomarker in ovarian carcinoma. POLD2 takes part in polymeraseδ (Pol δ) assembly by coordinating simultaneously with all other three subunits of the enzyme.
Physical form
Solution in 0.01M phosphate buffered saline pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone PDK 7B4, monoclonal form buffered aqueous solution mol wt antigen ~50 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: 0.5-1.0 µg/mL using HeLa cell extracts isotype IgG2a conjugate unconjugated UniProt accession no. P49005, shipped in dry ice storage temp. 20°C Gene Information human ... POLD2(5425)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
