Antibodies
- Сортировать:
- Вид таблицей
-
Anti-TCR beta chain (mouse), PerCP-Cy5.5, clone H57-597 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1456 MABF1457 General descriptionThe H57-597 antibody is specific for the beta chain of the mouse T cell Receptor (TCR). This cell surface protein combines with a second protein chain (alpha chain) to form the alpha-beta TCR that is expressed by NK1.1+ thymocytes, NKT cells, and the majority of peripheral T cells. A small number of T cells may express an alternative heteromer of gamma/delta protein chains, known as the g/d TCR. These receptors participate in a complex with CD3, and with the co-receptors CD4 or CD8, to recognize and respond to antigens bound to MHC molecules on antigen-presenting cells. Such interactions promote T cell receptor signaling (T cell activation) and can result in a number of cellular responses including proliferation, differentiation, production of cytokines or activation-induced cell death.The H57-597 antibody is used as a phenotypic marker for T cells expressing the alpha-beta TCR. It is also widely used to cross-link surface TCR and thereby mimic TCR-mediated cell activation or induction of apoptosis. The antibody does not cross-react with cells expressing the g/d TCR.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationAnti-TCR beta chain (mouse), PerCP-Cy5.5, clone H57-597 Antibody is an antibody against TCR beta chain for use in Flow Cytometry.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.125 µg from a representative lot detected TCR beta chain in one million C57Bl/6 splenocytes.
Physical form
Purified by size-exclusion chromatography
Purified Armenian Hamster monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source hamster (Armenian) Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone H57-597, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG conjugate PerCP-Cy5.5 UniProt accession no. P0C6B2,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TCR beta chain (mouse), violetFluor® 450, clone H57-597 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1459 MABF1458 General descriptionThe H57-597 antibody is specific for the beta chain of the mouse T cell Receptor (TCR). This cell surface protein combines with a second protein chain (alpha chain) to form the alpha-beta TCR that is expressed by NK1.1+ thymocytes, NKT cells, and the majority of peripheral T cells. A small number of T cells may express an alternative heteromer of gamma/delta protein chains, known as the g/d TCR. These receptors participate in a complex with CD3, and with the co-receptors CD4 or CD8, to recognize and respond to antigens bound to MHC molecules on antigen-presenting cells. Such interactions promote T cell receptor signaling (T cell activation) and can result in a number of cellular responses including proliferation, differentiation, production of cytokines or activation-induced cell death.The H57-597 antibody is used as a phenotypic marker for T cells expressing the alpha-beta TCR. It is also widely used to cross-link surface TCR and thereby mimic TCR-mediated cell activation or induction of apoptosis. The antibody does not cross-react with cells expressing the g/d TCR.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationResearch Sub Category
Immunoglobulins & Immunology
This armenian hamster monoclonal Anti-TCR beta chain Antibody (mouse), violetFluor® 450, clone H57-597, Cat. No. MABF1458 is validated for use in Flow Cytometry, for the detection of TCR beta chain.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.25 µg from a representative lot detected TCR beta chain in one million C57Bl/6 splenocytes.
Physical form
Purified by size-exclusion chromatography
Purified Armenian Hamster monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.Legal InformationvioletFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source hamster (Armenian) Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone H57-597, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG conjugate violetFluor® 450 UniProt accession no. P0C6B2,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TCR V1.1 Antibody, clone 2.11
eCl@ss: 32160702
Кат. номер MABF930 MABF930-25UG General descriptionT cell receptor (TCR) is a single-pass membrane protein that associates with CD3 to form a CD3/TCR complex. It can be a heterodimer of either alpha and beta chains or gamma and delta chains. CD3/RCR complex plays major role in antigen recognition and activation of T cells. The V gamma 1 gene almost exclusively rearranges to the J gamma 4-C gamma 4 gene. V-gamma 1- J gamma 4-C gamma 4 expressing cells form a major population of gamma/delta T cells in thymus and peripheral lymphoid organs in adult mice. However, during early development they are present in lower numbers. This antibody (clone 2.11) recognizes the V gamma 1.1 chain of the heterodimeric gamma/delta T-cell receptor, but does react with TCR alpha/beta bearing cells.
Specificity
Clone 2.11 detects T-cell receptor gamma chain C region C10.5 in lymphocytes.ImmunogenIrradiated TCR gamma/delta expressing T3 .13.1 hybridoma cells.ApplicationAnti-TCR V 1.1, clone 2.11, Cat. No. MABF930, is an armenian hamster monoclonal antibody that detects T-cell receptor gamma chain C region C10.5. and has been tested for use Flow Cytometry, and Immunoprecipitation.
Flow Cytometry Analysis: A representative lot detected TCR V gamma 1.1 in Flow Cytometry applications (Pereira, P., et. al. (1995). J Exp Med. 182(6):1921-30; Pereira, P., et. al. (2004). J Immunol. 173(5):3261-70).
Flow Cytometry Analysis: A 1:500 dilution from a representative lot detected TCR V gamma 1.1 in Lymphocytes isolated from TcrdH2BeGFP reporter mice (Courtesy of Dr rer. nat. Inga Sandrock, Hannover Medical School, Germany).
Immunoprecipitation Analysis: A representative lot detected TCR V gamma 1.1 in Immunoprecipitation applications (Pereira, P., et. al. (1995). J Exp Med. 182(6):1921-30).
Research Category
Inflammation & Immunology
Quality
Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG.
Target description
19.10 kDa calculated.
Physical form
Format: Purified
Purified armenian hamster monoclonal antibody IgG in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source hamster (Armenian) Quality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone 2.11, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunoprecipitation (IP): suitable isotype IgG UniProt accession no. P01853,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TCR V7 Antibody, clone F2.67
Кат. номер MABF2676-25UL MABF2676-100UL General descriptionT cell receptor gamma, variable 7 (UniProt: A0A0A6YYE8; also known as TCR Vg7) is encoded by the Trgv7 (also known as Tcrg-V7) gene (Gene ID: 21641) in murine species. The T-cell receptor (TCR) is a protein complex found on the surface of T cells that is responsible for recognizing fragments of antigen as peptides bound to major histocompatibility complex (MHC) molecules. The TCR is a heterodimer of a and b chain and over 95% of T cells express these two chains and only about 5% of T cells carry g and d chains, which are the first T lymphocytes of innate immunity to arise in ontogeny. The diversity of TCR arises from genetic recombination of the DNA-encoded segments in individual somatic T cells by somatic V(D)J recombination using RAG1 and RAG2 recombinases. This recombination process is reported to be unique to lymphocytes during the early stages of their development in primary lymphoid organs. The generation of the TCR g chain involves VJ recombination. There are seven Vg gene segments have been described in the TCRg chain loci of mice. TCR Vg7 is localized on the external side of plasma membrane. It is synthesized with a signal peptide (aa 1-17), which is subsequently cleaved off to produce the mature form. In most inbred strains of mice, T cells expressing Vg7- or Vg1- encoded TCRs make up 90% of intestinal intraepithelial lymphocytes. These cells are reported to be essential to limit parasite invasion and their dissemination from the intestinal mucosa. (Ref.: Li, C., et al. (2012). Cell. Immunol. 279(2); 151-159; Dalton, JE., et al. (2006). Gatroenterol.131(3); 818-829; Pereira, ,P., et al. (2000). Eur. J. Immunol. 30(7); 1988-1997).
Specificity
Clone F2.67 is a mouse monoclonal antibody generated in TCR delta knockout mice. It detects murine T cell receptor g, variable 7.ImmunogenMouse hybridoma expressing anti V 7V 5 TCR.ApplicationQuality Control Testing
Evaluated by Flow Cytometry in Balb/c mouse thymocytes.
Flow Cytometry Analysis: 1.0 µg of this antibody detected T-cell Vg 7 in one million Balb/c mouse thymocytes.
Tested Applications
Flow Cytometry Analysis: A representative lot detected TCR Vg7 in Flow Cytometry applications (Pereira, P., et al. (2000). Eur J Immunol.;30(7):1988-97; Dalton, J.E., et al. (2006). Gastroenterology.;131(3):818-29; Newton, D.J., et al. (2006). Infect Immun.;74(2):1097-105; Hamada, S. et al. (2008). Immunology.;125(2):170-7; Li, C., et al. (2012). Cell Immunol.;279(2):151-9; Walker, C.R., et al. (2013). PLoS One.;8(12):e84553).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-TCR Vg7, clone F2.67, Cat. No. MABF2676, is a mouse monoclonal antibody that detects T cell receptor g, variable 7 and is tested for use in Flow Cytometry.
Physical form
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone F2.67, monoclonal mol wt calculated mol wt 13.53 kDa purified by using protein G species reactivity mouse packaging antibody small pack of 100 µL application(s) flow cytometry: suitable isotype IgG2a epitope sequence Unknown conjugate unconjugated UniProt accession no. A0A0A6YYE8, shipped in 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Tentonin 3/TMEM150c
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN2266 ABN2266-25UL General descriptionTransmembrane protein 150C (UniProt: Q8C8S3; also known as Tentonin, TTN3) is encoded by the Tmem150c gene (Gene ID: 231503) in murine species. TTN3 is a multi-pass membrane protein of the DRAM/TMEM150 family. Two isoforms of TTN3 have been described that are produced by alternative splicing. It belongs to a new class of mechanotransduction channel that is expressed in muscle spindle afferents and contribute to proprioception (touch sensation). It is activated by mechanical stimuli with distinctly slow inactivation kinetics. Mice with deficiency in TTN3 display loss of coordinated movements and abnormal gait. It is reported to mediate slow adapting currents in DRG neurons.
Specificity
This rabbit polyclonal antibody detects Transmembrane protein 150C in mouse and rat cells. it targets an epitope within 38 amino acids from the C-terminal region.ImmunogenA linear peptide corresponding to 38 amino acids from the C-terminal region of murine Transmembrane protein 150C.
Epitope: C-terminusApplicationAnti-Tentonin 3/TMEM150c, Cat. No. ABN2266, is a highly specific rabbit polyclonal antibody that targets Transmembrane protein 150C and has been tested in , Immunocytochemistry, Immunofluorescence, Immunohistochemistry, and Western Blotting.
Research Category
Neuroscience
Immunohistochemistry Analysis: A representative lot detected Tentonin 3/TMEM150c in muscle spindle from mouse (Hong, G.S., et. al. (2016). Neuron. 91(1):107-18).
Immunocytochemistry Analysis: A representative lot detected Tentonin 3/TMEM150c in HEK293T cells transfected with TTN3. (Hong, G.S., et. al. (2016). Neuron. 91(1):107-18).
Western Blotting Analysis: A representative lot detected Tentonin 3/TMEM150c in F11 rat DRG cells (untransfected and TTN3 transfected cells) (Hong, G.S., et. al. (2016). Neuron. 91(1):107-18).
Quality
Evaluated by Western Blotting in F11 cell lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected Tentonin 3/TMEM150c in 10 µg of F11 cell lysate.
Target description
~25 kDa observed; 27.76 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity rat, mouse packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_878261, UniProt accession no. Q8C8S3, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-TER-119 (mouse), APC, clone TER-119 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1431 MABF1430 General descriptionThe TER-119 antibody is named for the antigen to which it binds, a 52 kDa surface protein that is associated with glycophorin-A. TER-119 is considered to be a lineage marker for later stages of erythroid cell development, as its expression begins at the pro-erythroblast stage. TER-119 antigen is not expressed at either BFU-E or CFU-E stages, i.e. prior to the pro-erythroblast stage.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationResearch Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-TER-119 Antibody (mouse), APC, clone TER-119 Antibody, Cat. No. MABF1430 is validated for use in Flow Cytometry, for the detection of TER-119.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.5 µg from a representative lot detected TER-119 in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone TER-119, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable conjugate Allophycocyanin conjugate UniProt accession no. Q9ES52,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TER-119 (mouse), redFluor® 710, clone TER-119 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1442 MABF1441 General descriptionThe TER-119 antibody is named for the antigen to which it binds, a 52 kDa surface protein that is associated with glycophorin-A. TER-119 is considered to be a lineage marker for later stages of erythroid cell development, as its expression begins at the pro-erythroblast stage. TER-119 antigen is not expressed at either BFU-E or CFU-E stages, i.e. prior to the pro-erythroblast stage.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationResearch Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-TER-119 Antibody (mouse), redFluor® 710, clone TER-119 Antibody, Cat. No. MABF1442 is validated for use in Flow Cytometry, for the detection of TER-119.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 0.125 µg from a representative lot detected TER-119 in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.Legal InformationredFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone TER-119, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2b conjugate redFluor® 710 UniProt accession no. Q9ES52,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TER-119 (mouse), violetFluor® 450, clone TER-119 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1439 MABF1440 General descriptionThe TER-119 antibody is named for the antigen to which it binds, a 52 kDa surface protein that is associated with glycophorin-A. TER-119 is considered to be a lineage marker for later stages of erythroid cell development, as its expression begins at the pro-erythroblast stage. TER-119 antigen is not expressed at either BFU-E or CFU-E stages, i.e. prior to the pro-erythroblast stage.ImmunogenImmunogen information for this antibody is proprietary information.ApplicationResearch Sub Category
Immunoglobulins & Immunology
This rat monoclonal Anti-TER-119 Antibody (mouse), violetFluor® 450, clone TER-119 Antibody, Cat. No. MABF1440 is validated for use in Flow Cytometry, for the detection of TER-119.
Research Category
Inflammation & Immunology
Quality
This monoclonal antibody was purified from tissue culture supernatant via affinity chromatography. The purified antibody was conjugated under optimal conditions, with unreacted dye removed from the preparation.
Flow Cytometry Analysis: 1 µg from a representative lot detected TER-119 in one million C57Bl/6 bone marrow cells.
Physical form
Purified Rat monoclonal containing 10 mM NaH2PO4, 150 mM NaCl, 0.09% NaN3, 0.1% gelatin, pH7.2.
Purified by size-exclusion chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Note: It is recommended to store the product undiluted at 2-8°C and protected from prolonged exposure to light. Do not freeze.Other NotesConcentration: Please refer to lot specific datasheet.Legal InformationvioletFluor is a registered trademark of Tonbo Biotechnologies
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone TER-119, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2b conjugate violetFluor® 450 UniProt accession no. Q9ES52,
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TES antibody ,Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200020-25UL SAB4200020-200UL General descriptionMonoclonal Anti-TES (mouse IgG3 isotype) is derived from the hybridoma TES75 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide. Testin LIM domain protein (TES) comprises cysteine-rich zinc-binding motifs called LIM domains and is a component of focal adhesions. TES gene is mapped to a common fragile site on chromosome 7q31.2 is designated as FRA7G.
Specificity
Monoclonal Anti-TES recognizes human, monkey, bovine, and mouse TESApplicationAnti-TES antibody, mouse monoclonal may be used in immunoblotting.
Biochem/physiol Actions
Testin LIM domain protein (TES), a putative tumor-suppressor gene, is essential for motility and is key for the tumor cell anchorage and metastasis. TES mRNA expression is found in several cancer-derived cell lines, particularly hematopoietic, breast and ovarian cancer cell lines as well as in primary tumors. This was correlated with methylation of TES CpG island. Furthermore, TES gene knockout revealed its role as a tumor suppressor gene as well as in actin stress fibre organization.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze at –20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone TES75, monoclonal form buffered aqueous solution mol wt antigen ~48 kDa species reactivity mouse, human, bovine, monkey packaging antibody small pack of 25 µL concentration ~1.5 mg/mL application(s) western blot: 0.5-1.0 µg/mL using whole extract of mouse thymus isotype IgG3 conjugate unconjugated UniProt accession no. Q9UGI8, shipped in dry ice storage temp. 20°C Gene Information human ... TES(26136)
mouse ... Tes(21753)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Tetranectin/CLEC3B Antibody, clone mAb10
Кат. номер MABT1444-25UG MABT1444-100UG General descriptionTetranectin (UniProt: P05452; also known as TN, C-type lectin domain family 3 member B, Plasminogen kringle 4-binding protein) is encoded by the CLEC3B (also known as TNA) gene (Gene ID: 7123) in human. Tetranectin is a tetrameric plasminogen-binding protein that is synthesized with a signal peptide (aa 1-21), which is subsequently removed in the mature form that is composed of three identical, noncovalently linked subunits each of 181 amino acids. The polypeptide consists of a short a-helical segment (aa 47-72) at the amino terminus that is involved in trimerization, followed by a C-type lectin domain (aa 77-198). It is present in both serum and the extracellular matrix and is expressed most abundantly in the lung. The blood concentrations of tetranectin in healthy adults are about 10-12 mg/mL. However, in septic subjects its levels are significantly reduced and supplementation with exogenous tetranectin confers dose-dependent protection against lethal endotoxemia and sepsis. Its levels are shown to be significantly reduced in patients with cardiac failure. Hence, it is also used as a biomarker for risk of heart failure. (Ref.: Chen, W., et al. (2020). Sci. Transl. Med. 12(539); eaaz3833; McDonald, K., et al. (2020). Sci. Rep. 10; 7507).
Specificity
Clone mAb10 is a mouse monoclonal antibody that detects Tetranectin. It targets an epitope within 24 amino acids from the C-terminal half.ImmunogenPurified human Tetranectin.ApplicationAnti-Tetranectin/CLEC3B, clone mAb10, Cat. No. MABT1444, is a mouse monoclonal antibody that detects Tetranectin and is tested for use in Dot Blot, ELISA, and Western Blotting.
Quality Conrol Testing
Evaluated by Western Blotting in Human lung tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Tetranectin/CLEC3B in Human lung tissue lysate.
Tested Applications
Western Blotting Analysis: A representative lot detected Tetranectin/CLEC3B in Western Blotting applications (Chen, W., et al. (2020). Sci Transl Med. 12(539):eaaz3833).
Dot Blot: A representative lot detected Tetranectin/CLEC3B in Dot Blot applications (Chen, W., et al. (2020). Sci Transl Med. 12(539):eaaz3833).
ELISA Analysis: A representative lot detected Tetranectin/CLEC3B in ELISA applications (Chen, W., et al. (2020). Sci Transl Med. 12(539):eaaz3833).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone mAb10, monoclonal mol wt calculated mol wt 22.54 kDa","observed mol wt ~25 kDa purified by using protein G species reactivity human packaging antibody small pack of 100 µg application(s) ELISA: suitable","dot blot: suitable","western blot: suitable isotype IgG2b epitope sequence C-terminal half conjugate unconjugated Protein ID accession no. NP_003269, UniProt accession no. P05452, shipped in 2-8°C Gene Information human ... CLEC3B(7123)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Tex19.1 Antibody, clone 7TEX-1F11
eCl@ss: 32160702
Кат. номер MABC1596-25UG MABC1596-100UG General descriptionTestis-expressed protein 19.1 (UniProt: Q99MV2; also known as mTex19.1, Testis-expressed protein 19A) is encoded by the Tex19.1 (also known as Tex19, Tex19a) gene (Gene ID: 73679) in murine species. Tex19.1 resides in the germline to repress transposable genetic elements and maintain genomic stability. It is expressed in testis, placenta, ovary, and in pluripotent stem cells. In testis its expression is highest in mitotic spermatogonia and decreases as spermatocytes progress through meiosis. Tex19.1 expression is reported to be down-regulated by Deleted in azoospermia-like (DAZL) protein, which binds to 3UTR of Tex19.1 mRNAs and repress its translation. Tex19.1 is required during spermatogenesis and placenta development where it participates in the repression of retrotransposable elements and prevents their mobilization. Tex19.1, along with its paralog, Tex19.2, is shown to collaborate with the Piwi-interacting RNA (piRNA) pathway, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins. Embryos with mutations in Tex19.1 gene exhibit intra-uterine growth retardation and have small placentas due to a reduction in the number of spongiotrophoblast, glycogen trophoblast and sinusoidal trophoblast giant cells. Loss of Tex19.1 is shown to cause growth defect and early post-natal lethality. Male animals with deficiency of both Tex19.1 and Tex19.2 display impaired spermatogenesis, small testes, and are infertility.
Specificity
Clone 7TEX-1F11 detects murine Testis-expressed protein 19.1 (Tex 19).ImmunogenHis-tagged full-length recombinant mouse Testis-expressed protein 19.1 (Tex 19).ApplicationImmunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected Tex19.1 in embryonic mouse brain and embryonic mouse gut tissue sections.
Immunocytochemistry Analysis: A representative lot detected Tex19.1 in Immunocytochemistry applications (Tarabay, Y., et. al. (2013). Hum Reprod. 28(8):2201-14).
ELISA Analysis: A representative lot detected Tex19.1 in ELISA applications (Tarabay, Y., et. al. (2013). Hum Reprod. 28(8):2201-14).
Immunoprecipitation Analysis: A representative lot immunoprecipitated Tex19.1 in Immunoprecipitation applications (Tarabay, Y., et. al. (2017). J Cell Sci. 130(8):1463-1474).
Western Blotting Analysis: A representative lot detected Tex19.1 in Western Blotting applications (Tarabay, Y., et. al. (2013). Hum Reprod. 28(8):2201-14;Tarabay, Y., et. al. (2017). J Cell Sci. 130(8):1463-1474).
Anti-Tex19.1, clone 7TEX-1F11, Cat. No. MABC1596, is a mouse monoclonal antibody that detects Testis-expressed protein 19.1 and has been tested for use in ELISA, Immunocytochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Research Category
Signaling
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse testis tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution of this antibody detected Tex19.1 in mouse testis tissue sections.
Target description
40.40 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 7TEX-1F11, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2b NCBI accession no. NP_082878, UniProt accession no. Q99MV2, Узнать цену -
Anti-TFE3 antibody produced in rabbit
MDL number: MFCD01865065 Human Protein Atlas Number: HPA023881 Human Protein Atlas characterization data
Кат. номер HPA023881-100UL HPA023881-25UL General descriptionTranscription factor binding to IGHM enhancer 3 or transcription factor E3 (TFE3) gene is mapped to human chromosome Xp11.23. TFE3 belongs to helix-loop-helix leucine zipper family of transcription factors.ImmunogenTranscription factor binding to ighm enhancer 3 recombinant protein epitope signature tag (PrEST).
Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAASApplicationAnti-TFE3(Transcription factor binding to IGHM enhancer 3) antibody produced in rabbit has been used:- in immunofluorescence
- in immunocytochemistry studies
- in immunostaining
Biochem/physiol Actions
Transcription factor binding to IGHM enhancer 3 (TFE3) interacts with other transcription factors and plays a key role in cell growth and proliferation. It promotes renal adenocarcinoma progression. TFE3 gene locus is also involved in translocations events resulting in a TFE3 fusion protein, which is a potential marker for screening their prevalence in renal cell carcinomas. It interacts and regulates expression of G-protein Gα16 and favors regulation of claudin 14.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74277,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, human, mouse packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000","western blot: 0.04-0.4 µg/mL conjugate unconjugated Featured Industry Research Pathology UniProt accession no. P19532, shipped in wet ice storage temp. 20°C Gene Information human ... TFE3(7030)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-TFE3 antibody, Mouse monoclonal
Кат. номер SAB4200824-100UL SAB4200824-25UL General descriptionTranscription factor E3 (TFE3), also known as Class E basic helix-loop-helix protein 33 (bHLHe33), is a transcriptional activator that mediates the enhancer-promoter interactions. TFE3 belongs to the MiT family of helix-loop-helix leucine zipper transcription factors, it is ubiquitously expressed and can directly associate with DNA as either homodimer or heterodimer which are formed with two other MiT family members, TFEB or TFEC.
TFE3 serve an important role in cell growth, cell proliferation, cellular adaptation to starvation and cellular response to ER stress. Under nutrient-rich conditions, TFE3 is located in the cytoplasm, and under starvation conditions or treatment with ER stressors, TFE3 rapidly translocates to the nuclear. In the nuclear localization, TFE3 mediates cellular adaptation to stress by simultaneously promoting lysosomal biogenesis, autophagy induction, as well as expression of critical mitochondrial and metabolic regulators. It been shown that TFE3 also participate in the transcriptional regulation of the innate immune response.
Pathogen infections promote TFE3 nuclear translocation, thus inducing In vivo expression of several cytokines and chemokines.ApplicationAnti-TFE3 antibody specifically recognizes TFE3 from human, mouse, rat, bovine and canine origin. The antibody may be used in various immunochemical techniques including Immunoblotting (~60 kDa). Detection of the TFE3 band by Immunoblotting is specifically inhibited by the immunizing peptide.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.Other NotesUnless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Disclaimer
This product is for R&D use only, not for drug, household, or other uses.Параметрыbiological source mouse antibody form purified from hybridoma cell culture clone TFE3-37, monoclonal form buffered aqueous solution mol wt 60 kDa species reactivity mouse, canine, human, rat, bovine packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 1.5-3 µg/mL using human A549 cells extract isotype IgG1 UniProt accession no. P19532, shipped in dry ice storage temp. 20°C Gene Information human ... TFE3(7030)
Safety InformationWGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Thioredoxin antibody produced in rabbit
NACRES: NA.46
Кат. номер T0803-.2ML T0803-25UL T0803-.5ML General descriptionThe thioredoxin system consists of thioredoxin, thioredoxin-reductase and NADPH. Thioredoxin from E. coli consists of a single polypeptide chain of 108 amino acids with a molecular weight of 11,700. The protein contains no prosthetic group or bound metals.
Specificity
Specific for natural E. coli and recombinant thioredoxin. It may be used to identify and purify the expression of thioredoxin fusion proteins.Immunogenrecombinant E. coli thioredoxin.ApplicationAnti-Thioredoxin antibody produced in rabbit has been used in:- immunohistochemistry
- immunoblotting
- dot blot immunoassay
- ouchterlony double diffusion
- immunodetection
- western blotting
Immunofluorescence was carried out on the cerivcal cancer cell lines SiHa, CaSki, and HeLa using an antibody against the redox proteinThioredoxin.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Biochem/physiol Actions
Thioredoxin is a small electron transport protein that serves as the hydrogen donor in the enzymatic reduction of ribonucleotides to deoxyribonucleotides. The thioredoxin system is involved in other reductive processes such as the enzymatic reduction of methionine sulfoxide and sulfate. The oxidation-reduction function of thioredoxin is linked to a single intra-molecular disulfide bridge, forming a 14 member ring. The system is particularly useful for high level production of soluble fusion proteins in the E. coli cytoplasm. In many cases, these fusion proteins fold correctly and thus display full biological activity.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution packaging antibody small pack of 25 µL application(s) dot blot: 1:5,000 using purified recombinant thioredoxin, western blot: 1:5,000 using E. coli extract conjugate unconjugated shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Thy-1.1 Antibody, clone OX-7
eCl@ss: 32160702
Кат. номер MAB1406 MAB1406-25UG MAB1406-100UG
Specificity
Directed against the Thy 1.1 antigenic determinant which is a monomorphic determinant within rat strains but polymorphic in the mouse (positive to AKR strain, negative to CVA and BALB/c). Thy-1 antigen is present on a variety of cell types including thymocytes, neuronal cells, T-lymphocytes (mouse), stem cells and immature B cells (rat) and connective tissue (Campbell, 1981). Thy-1 is a glycoprotein, 112 amino acids, which is homologous to immunoglobulin domains (Williams & Gagnon, 1982). MAB1406 can be coupled to sepharose 4-B and used to purify mouse Thy-1.1 and rat Thy-1 antigens (Campbell, 1981; Williams & Gagnon, 1982). MAB1406 can also be used to study the killing of Thy-1 tumor cells with antibody-toxin conjugates (Neville, 1982).ImmunogenRat Thy-1ApplicationAnti-Thy-1.1 Antibody, clone OX-7 detects level of Thy-1.1 & has been published & validated for use in FC, IC, IH.
Flow Cytometry: 1:10-1:100. Use 10 µl per 10E6 thymocytes.
Immunohistochemistry on frozen sections.
Immunocytochemistry
Optimal working dilutions must be determined by end user.
Research Sub Category
Immunoglobulins & Immunology
Research Category
Inflammation & Immunology
Quality
Tested
Physical form
Format: Purified
Protein A Purified mouse immunoglobulin in 20 mM sodium phosphate, 250 mM NaCl, pH. 7.6, with 0.1% sodium azide as a preservative.
Protein A purified
Storage and Stability
Maintain for 1 year at 2–8°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
Thymocytes, T-lymphocytesOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone OX-7, monoclonal species reactivity rat packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable isotype IgG1 NCBI accession no. NM_006288.2, UniProt accession no. P04216, shipped in ambient storage temp. 2-8°C Gene Information human ... THY1(7070)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Thymine Dimer antibody, Mouse monoclonal
MDL number: MFCD01865339
Кат. номер T1192-.1ML T1192-25UL General descriptionUV light induces the formation of thymine dimers that subsequently leads to DNA damage in cells. Monoclonal antibodies that bind to thymine dimers enable the study of cell death and UV-induced DNA damage during photocarcinogenesis . Monoclonal Anti-Thymine Dimer binds to the (5-6) cyclobutane type of homothymine or thyminecytosine heterodimers in single-stranded DNA. The antibody has a decreased affinity for the dimer in short oligonucleotides (an oligonucleotide of atleast 10-20 thymine residues is required for the labeling of the probes). The product facilitates the use of a sensitive and non-radioactive technique for the analysis of thymine dimerization.Immunogentetra nucleotide containing cyclobutane thymine dimer (GTTG) conjugated to chicken gamma globulin.ApplicationMay be used in Southern blotting at 0.5-1μg/mL using UV induced thymine dimers of λ phage DNA fragments.
Monoclonal Anti-Thymine Dimer antibody is suitable for use in dot blot (0.5-1 mg/mL), immunocytochemistry (1:100) and capture ELISA.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.Other NotesDistributed under license.
Patents WO87/01134, EP 0233 177 B1
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone H3, monoclonal form buffered aqueous solution species reactivity chicken, wide range packaging antibody small pack of 25 μL concentration ~2 mg/mL application(s) capture ELISA: suitable, dot blot: 0.5-1 μg/mL, immunocytochemistry: suitable isotype IgG1 conjugate unconjugated shipped in dry ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TIGIT Antibody, clone 1G9
Кат. номер MABF2657-25UL MABF2657-100UL General descriptionT-cell immunoreceptor with Ig and ITIM domains (UniProt: P86176; also known as V-set and immunoglobulin domain-containing protein 9, TIGIT) is encoded by the Tigit (also known as Vstm3) gene (Gene ID: 100043314) in murine species. TIGIT is a single-pass type I, homodimeric, membrane protein that is synthesized with a signal peptide (aa 1-28), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 29-148), a transmembrane domain (aa 149-169), and a cytoplasmic domain (aa 170-249). The cytoplasmic domain contains an immunoreceptor tyrosine-based inhibitor motif (ITIM; aa 234-239), which is involved in the modulation of its cellular responses. It serves as a coinhibitory receptors with CD226 and is expressed on NK cells, activated T cells, memory T cells, and a subset of regulatory T cells and blocks immune responses by affecting T cells and APCs. It is shown to bind to poliovirus receptor (PVR) with high affinity to form a heterotetrameric assembly of two TIGIT and two PVR molecules. This causes increased secretion of IL-10 and decreased secretion of IL-12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells. TIGIT also serves as a functional ligand and induces dendritic cells to acquire a tolerogenic phenotype via ligation of PVR. TIGIT -/- mice, when challenged, develop severe experimental autoimmune encephalomyelitis compared to wild-type mice. Loss of TIGIT also in mice also results in hyperproliferative T cell responses and increased susceptibility to autoimmunity. (Ref.: Dixon, KO., et al. (2018). J. Immunol. 200(8); 3000-3007; Joller, N., et al. (2011). J. Immunol. 186(3); 1338-1342).
Specificity
Clone 1G9 is a mouse monoclonal antibody that detects murine T-cell immunoreceptor with Ig and ITIM domains (TIGIT).ImmunogenTIGIT knockout mice immunized with recombinant mouse TIGIT tetramers.ApplicationQuality Control Testing
Evaluated by Western Blotting in RAW264.7 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected T-cell immunoreceptor with Ig and ITIM domains (TIGIT) s in RAW264.7 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected TIGIT in mouse thymus tissue lysate.
ELISA Analysis: A representative lot detected TIGIT in ELISA applications (Joller, N., et al. (2011). J Immunol. 186(3):1388-42).
Flow Cytometry Analysis: A representative lot detected TIGIT in Flow Cytometry applications (Joller, N., et al. (2011). J Immunol. 186(3):1388-42).
Inhibition Assay: A representative lot of this antibody fully blocked CD155 binding to TIGIT. (Dixon, K.O., et al. (2018). J Immunol. 200(8):3000-3007).
Flow Cytometry Analysis: 1 µg from a representative lot detected TIGIT in one million Raw264.7 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-TIGIT, clone 1G9, Cat. No. MABF2657, is a mouse monoclonal antibody that detects of T-cell immunoreceptor with Ig and ITIM domains (TIGIT) and is tested in ELISA, Flow Cytometry, Inhibition Assay, and Western Blotting.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Storage and Stability
Store at -10°C to -25°C. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 1G9, monoclonal mol wt calculated mol wt 26.96 kDa","observed mol wt ~31 kDa purified by using protein G species reactivity mouse packaging antibody small pack of 100 µL application(s) ELISA: suitable","flow cytometry: suitable","western blot: suitable isotype IgG1 epitope sequence Unknown conjugate unconjugated UniProt accession no. P86176, shipped in dry ice Gene Information mouse ... Tigit(100043314)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Timeless (C-terminal) antibody produced in rabbit
NACRES: NA.77
Кат. номер T6454-25UL T6454-200UL General descriptionThe gene TIMELESS is located on the human chromosome at 12q13.3. The encoded protein is a component of the replisome complex.
Specificity
Anti-Timeless (C-terminal) recognizes human Timeless (also known as hTIM, TIM, TIM1, Timelesss1).ApplicationAnti-Timeless (C-terminal) antibody produced in rabbit may be used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
Timeless (Tim) forms a complex with Tim interacting protein (Tipin), found by two-hybrid screening. It associates with components of the replication fork complex through direct binding with the (RPA) and are important for efficient DNA synthesis. Timeless plays a role in replication checkpoint responses to genotoxic stress. It also plays an important role in the maintenance of genome stability during unperturbed DNA replication. Overexpression of the TIMELESS gene is associated with cervical cancer. Annihilation of this gene induces apoptosis and cell senescence.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~160 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoprecipitation (IP): 5-10 µg using HEK-293T cells over expressing human Timeless","indirect immunofluorescence: 2.5-5 µg/mL using paraformaldehyde fixed HEK-293T cells over expressing human Timeless","western blot: 0.5-1 µg/mL using lysates of HEK-293T cells over expressing human Timeless conjugate unconjugated UniProt accession no. Q9UNS1, shipped in dry ice storage temp. 20°C Gene Information human ... TIMELESS(8914)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TIMP-4 Antibody, clone 9:4-7
eCl@ss: 32160702
Кат. номер MABC1142-25UL MABC1142-100UL General descriptionTissue inhibitor of metalloproteinases 4 (UniProt: Q99727; also known as Metalloproteinase inhibitor 4, TIMP-4) is encoded by the TIMP4 gene (Gene ID: 7079) in human. The tissue inhibitors of metalloproteinases (TIMPs) represent a family of ubiquitous proteins which are natural inhibitors of the matrix metalloproteinases (MMPs). There are four known members of the TIMP family that are designated as TIMP-1, 2, 3, and 4. TIMP-4 is synthesized with a signal peptide (aa 1-29), which is cleaved off in the mature form. It has two MMP-binding regions (aa 30-33 and 99-100). TIMP-4 expressed is observed in heart, brain, pancreas, kidney, colon, testes, and adipose tissue. However, elevated levels of TIMP-4 have been reported in various cancers tissues, including breast, ovary, prostate, colon and kidney and are associated with poor survival prognosis. Hence, it can serve as a useful marker for disease progression. TIMP-4 is shown to complex MMPs and irreversibly inactivates them by binding to their catalytic zinc cofactor. This clone (9:4 7) is specific for human TIMP-4 and does not exhibit any cross-reactivity to other TIMPs. (Ref.: Gomez, DE., et al. (1997). Eur. J. Cell. Biol. 74(2); 111-122; Donover, PS et AL (2010). J. Cell. Biochem. 110(5); 1255-1261).
Specificity
Clone 9:4-7 specifically detects human TIMP-4.ImmunogenGST-tagged full-length recombinant human TIMP-4.ApplicationAnti-TIMP-4, clone 9:4-7, Cat. No. MABC1142, is a mouse monoclonal antibody that detects Tissue Inhibitor of Matrix Metalloproteinase 4 and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution from a representative lot detected TIMP-4 in human kidney tissue sections.
Immunohistochemistry (Paraffin) Analysis: A representative lot detected TIMP-4 in Immunohistochemistry applications (Donover, P.S., et. al. (2010). J Cell Biochem. 110(5):1255-61).
ELISA Analysis: A representative lot detected TIMP-4 in ELISA applications (Donover, P.S., et. al. (2010). J Cell Biochem. 110(5):1255-61).
Western Blotting Analysis: A representative lot detected TIMP-4 in Western Blotting applications (Donover, P.S., et. al. (2010). J Cell Biochem. 110(5):1255-61).
Research Category
Apoptosis & Cancer
Quality
Evaluated by Immunohistochemistry (Paraffin) in human breast cancer tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected TIMP-4 in human breast cancer tissue sections.
Target description
25.50 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 4-7, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2b NCBI accession no. NP_003247.1, UniProt accession no. Q99727,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TIN2 antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200108-25UL SAB4200108-200UL General descriptionMonoclonal Anti-TIN2 (mouse IgG1 isotype) is derived from the hybridoma TIN-30 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide corresponding to a fragment of human TIN-2, conjugated to keyhole limpet hemocyanin (KLH). The six shelterin subunits are: TRF1, TRF2, and POT1 which directly recognize the TTAGGG repeats, and TIN2, Rap1 and TPP1. TIN2 (TRF-1 interacting nuclear factor 2) is recruited to the telomere through the TRF homology (TRFH) domain of TRF1 and tethers TPP1/POT1 to TRF1 and TRF2.ApplicationMonoclonal Anti-TIN2 antibody produced in mouse has been used in immunoblotting.
Biochem/physiol Actions
TIN2 (TRF-1 interacting nuclear factor 2) also connects TRF1 to TRF2 and this link contributes to the stabilization of TRF2 on telomeres. In addition, TIN2 has also been found to tether the telomeres to the nuclear matrix. Interestingly, this protein has also been found to be mutated in Dyskeratosis Congenita, a multi-system disorder which in its classical form is characterized by abnormalities of the skin, nails, and mucous membranes.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone TIN30, monoclonal form buffered aqueous solution mol wt antigen ~40 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) western blot: 0.5-1.0 µg/mL using HeLa cell extract isotype IgG1 conjugate unconjugated UniProt accession no. Q9BSI4, shipped in dry ice storage temp. 20°C Gene Information human ... TINF2(26277)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TKS5 Antibody, clone 13H6.3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT336 MABT336-25UG General descriptionSH3 and PX domain-containing protein 2A (UniProt: Q5TCZ1; also known as Adapter protein TKS5, Five SH3 domain-containing protein, SH3 multiple domains protein 1, Tyrosine kinase substrate with five SH3 domains) is encoded by the SH3PXD2A (also known as FISH, KIAA0418, SH3MD1, TKS5) gene (Gene ID: 9644) in human. Adapter protein TKS5 is a scaffolding protein that is required for podosome formation, degradation of the extracellular matrix, and for invasion in some cancer cells. Three isoforms of TKS5 have been described that are produced by alternative splicing. TKS5 is a cytoplasmic protein in normal cells, but it localizes to podosomes in SRC-transformed cells. It is found in several cancer cell lines, particularly invasive breast carcinomas and melanomas. TKS5 contains one PX (phx homology) domain and five SH3 domains. The PX domain is required for podosome localization because of its ability to bind phosphoinosiltols, such as PtdIns3P and PtdIns(3,4)P2 and to lesser extent PtdIns5P and PtdIns(3,5)P2. Its binding with ADAM12, ADAM15 and ADAM19 is mediated by the fifth SH3 domain. The intramolecular interaction of the PX domain with the third SH3 domain maintains the protein in the cytoplasm and phosphorylation disrupts this interaction, resulting in the redistribution of the protein from cytoplasm to the perimembrane region.
Specificity
Clone 13H6.3 detects SH3 and PX domain-containing protein 2A (adapter protein TKS5) in human cells. It targets and epitope with in 60 amino acids crom the C-terminal half.ImmunogenGST/His-tagged recombinant fragment corresponding to 60 amino acids from the C-terminal half of human SH3 and PX domain-containing protein 2A (Adapter protein TKS5).ApplicationResearch Category
Cell Structure
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected TKS5 in human breast cancer tissue.
Anti-TKS5, clone 13H6.3, Cat. No. MABT336, ia a mouse monoclonal antibody that detects TKS5 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in SCC61 and SK-MEL28 cell lysates.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected TKS5 in 10 µg of SCC61 and SK-MEL28 cell lysates.
Target description
~160 kDa observed; 125.29 kda calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 13H6.3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_055446, UniProt accession no. Q5TCZ1, shipped in ambient Gene Information human ... SH3PXD2A(9644)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TKS5 Antibody, clone 9H2.1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT337 MABT337-25UG General descriptionSH3 and PX domain-containing protein 2A (UniProt: Q5TCZ1; also known as Adapter protein TKS5, Five SH3 domain-containing protein, SH3 multiple domains protein 1, Tyrosine kinase substrate with five SH3 domains) is encoded by the SH3PXD2A (also known as FISH, KIAA0418, SH3MD1, TKS5) gene (Gene ID: 9644) in human. Adapter protein TKS5 is a scaffolding protein that is required for podosome formation, degradation of the extracellular matrix, and for invasion in some cancer cells. Three isoforms of TKS5 have been described that are produced by alternative splicing. TKS5 is a cytoplasmic protein in normal cells, but it localizes to podosomes in SRC-transformed cells. It is found in several cancer cell lines, particularly invasive breast carcinomas and melanomas. TKS5 contains one PX (phx homology) domain and five SH3 domains. The PX domain is required for podosome localization because of its ability to bind phosphoinosiltols, such as PtdIns3P and PtdIns(3,4)P2 and to lesser extent PtdIns5P and PtdIns(3,5)P2. Its binding with ADAM12, ADAM15 and ADAM19 is mediated by the fifth SH3 domain. The intramolecular interaction of the PX domain with the third SH3 domain maintains the protein in the cytoplasm and phosphorylation disrupts this interaction, resulting in the redistribution of the protein from cytoplasm to the perimembrane region.
Specificity
Clone 9H2.1 detects SH3 and PX domain-containing protein 2A (adapter protein TKS5) in human cells. It targets and epitope with in 91 amino acids crom the C-terminal half.ImmunogenGST/His-tagged recombinant fragment corresponding to 91 amino acids from the C-terminal half of human SH3 and PX domain-containing protein 2A (Adapter protein TKS5).ApplicationThis mouse monoclonal Anti-TKS5, clone 9H2.1, Cat. No. MABT337, is a mouse monoclonal antibody that detects SH3 and PX domain-containing protein 2A (TKS5) and has been tested for use in Western Blotting.
Research Category
Cell Structure
Quality
Evaluated by Western Blotting in SCC61, SK-MEL28, and T47D cell lysates.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected TKS5 in 10 µg of SCC61, SK-MEL28, and T47D cell lysates.
Target description
~125 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 9H2.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_055446, UniProt accession no. Q5TCZ1, shipped in ambient Gene Information human ... SH3PXD2A(9644)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TMC1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN1649 ABN1649-25UL General descriptionTransmembrane channel-like protein 1 (UniProt: Q8R4P5; also known as Beethoven protein, Deafness protein, Transmembrane cochlear-expressed protein 1, TMC1) is encoded by the Tmc1 (also known as Bth, dn) gene (Gene ID: 13409) in murine species. TMC1 is a multi-pass membrane protein that forms ion channel required for the normal function of cochlear hair cells. It is detected in cochlear inner and outer hair cells and in neurosensory epithelia of the vestibular end organs. Its expression is also reported in cortex, cerebellum, eye, colon, ovary, and testis. It is expressed at low levels in temporal bone from embryonic day 14 to day 1 after birth in mice and increases significantly (8 to 16 fold) at day 5, 10 and 20 and then continues to be expressed up to day 90. Two isoforms of TMC1 have been reported in mice that are produced by alternative splicing. Mutations in Tmc1 gene can cause hearing loss in humans and mice. Heterozygotes show progressive hair-cell degeneration from day 20 onwards in mice, leading to severe depletion of inner hair cells and scattered loss of outer hair cells, and progressive loss of the Preyer reflex from around day 30. Homozygotes show almost complete degeneration of inner hair cells, and little or no Preyer reflex at any age.
Specificity
This rabbit polyclonal antibody detects Transmembrane channel-like protein 1 in murine retina. It targets an epitope within 20 amino acids from the N-terminal region.ImmunogenEpitope: cytoplasmic domain
KLH-conjugated linear peptide corresponding to 20 amino acids from the N-terminal cytoplasmic domain of murine Transmembrane channel-like protein 1.ApplicationImmunocytochemistry Analysis: A 1:100 dilution from a representative lot detected TMC1 in COS-7 cells.
Immunofluorescence Analysis: A representative lot detected TMC1 in P9 mouse outer hair cells (OHCs) (Kurima, K., et. al. (2015). Cell Rep. 12(10):1606-17).
Western Blotting Analysis: A representative lot detected TMC1 in COS-7 cells (Labay, V., et. al. (2010). Biochemistry. 49(39):8592-8).
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected TMC1 in HEK293 cells transiently transfected with Fugene and TMCx-cherry cDNAs (Courtesy of Dr. Angela Ballesteros).
Immunofluorescence Analysis: A representative lot detected TMC1 in COS-7 transfected cells expressing TMC1-GFP (Courtesy of Dr. Angela Ballesteros).
Anti-TMC1, Cat. No. ABN1649, is a highly specific rabbit polyclonal antibody that targets Transmembrane channel-like protein 1 and has been tested for use in Immunocytochemistry, Immunofluorescence, and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in mouse retinal tissue lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected TMC1 in 10 µg of mouse retinal tissue lysate.
Target description
~90 kDa observed; 87.26 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity monkey, mouse packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_083229, UniProt accession no. Q8R4P5,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TMEM100
eCl@ss: 32160702
Кат. номер ABN1721 ABN1721-25UG General descriptionTransmembrane protein 100 (UniProt: Q9CQG9; also known as TMEM100) is encoded by the Tmem100 gene (Gene ID: 67888) in murine species. TMEM100 is a multi-pass membrane protein that is shown to be involved in renal development, vasculogenesis and lung cancer invasiveness. It plays a role during embryonic arterial endothelium differentiation and vascular morphogenesis through the ACVRL1 receptor-dependent signaling pathway upon stimulation by bone morphogenetic proteins, such as GDF2/BMP9 and BMP10. TMEM100 is also involved in the regulation of nociception by forming a complex with TRPA1 and TRPV1 and act as a modulator of their interaction in dorsal root ganglia (DRG) neurons. It is reported to weaken TRPA1 and TRPV1 interaction, thereby releasing the inhibition of TRPA1 by TRPV1 and increasing the single-channel open probability of the TRPA1-TRPV1 complex. TMEM100-deficient mice show a reduction in inflammatory mechanical hyperalgesia and TRPA1- but not TRPV1-mediated pain. A mutation involving aa 117-119 KRR to QQQ is shown to abolish TMEM100 interaction with TRPA1, but increases interaction with TRPV1. Mutations is Tmem100 gene can lead to embryonic lethality due to impaired differentiation of arterial endothelium and defects of vascular morphogenesis. (Ref.: Weng, H-J., et al. (2015). Neuron 85(4), 833-846).
Specificity
This rabbit polyclonal antibody detects transmembrane protein 100 (TMEM100) in murine cells. It targets an epitope with the 19 amino acids from the N-terminal end.ImmunogenKLH-conjugated linear peptide corresponding to 19 amino acids from the N-terminus region of murine Transmembrane protein 100 (TMEM100).ApplicationImmunohistochemistry Analysis: A 1:50-250 dilution from a representative lot detected TMEM100 in mouse colon, rat peripheral nerve, and human cerebral cortex tissues.
Immunofluorescence Analysis: A representative lot detected TMEM100 in DRGs (Weng, H.J., et. al. (2015). Neuron. 85(4):833-46).
Western Blotting Analysis: A representative lot detected TMEM100 in DRG from cervical to lumbar levels (Weng, H.J., et. al. (2015). Neuron. 85(4):833-46).
Immunoprecipitation Analysis: representative lot detected TMEM100 in whole-cell DRG or CHO cells lysates (Weng, H.J., et. al. (2015). Neuron. 85(4):833-46).
Western Blotting Analysis: A 1:5,000 dilution from a representative lot detected TMEM100 in Dorsal root ganglion (DRG) of WT & TMEM100 CKO mice (Courtesy of Drs. Hao-Jui Weng and Xinzhong Dong at Johns Hopkins University).
Immunofluorescence Analysis: A 1:200 dilution from a representative lot detected TMEM100 in Dorsal root ganglion (DRG) sections from Avil-Cre;Tmem100+/+ (Wild Type mice) and Avil-Cre;Tmem100fl/fl (Tmem100 CKO) mice (Courtesy of Drs. Hao-Jui Weng and Xinzhong Dong at Johns Hopkins University).
Anti-TMEM100, Cat. No. ABN1721, is a highly specific rabbit polyclonal antibody that targets Transmembrane protein 100 and has been tested in Immunofluorescence, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in mouse lung tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected TMEM100 in 10 µg of mouse lung tissue lysate.
Target description
~17 kDa observed; 14.50 kDa calculated. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_080709, UniProt accession no. Q9CQG9,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TMEM16B Antibody, clone 13B8
eCl@ss: 32160702
Кат. номер MABN2433 MABN2433-25UG General descriptionAnoctamin-2 (UniProt: Q8CFW1; also known as Transmembrane protein 16B, TMEM16B) is encoded by the Ano2 (also known as Tmem16b) gene (Gene ID: 243634) in murine species. TMEM16B is a multi-pass membrane protein that serves as a calcium-activated chloride channel (CaCC) that plays a role in olfactory signal transduction and also mediates light perception amplification in retina. Its channel activity is shown to be repressed by chloride channel inhibitors, such as niflumic acid and flufenaic acid. TMEM16 B is expressed in retina, especially in the photoreceptor synaptic terminals, and in olfactory epithelium, particularly in sensory neurons (OSNs) and cilia. It is also shown to be expressed in retinal pigment epithelium (RPE), olfactory bulb, and cortex. It is detected in the mantle layer of the neural tube and in the dorsal root ganglia at E14.5. TMEM16B is also involved in a calcium-dependent mode of ionic plasticity that reduces the efficacy of GABAergic synapses. It is reported to attenuate GABAergic transmission by increasing the postsynaptic chloride concentration, hence reducing the driving force for chloride influx.
Specificity
Clone 13B8 detects Transmembrane protein 16B (TMEM16B) in murine neural tissue.ImmunogenGST-tagged recombinant fragment corresponding to the first 74 amino acids of murine Transmembrane protein 16B.ApplicationAnti-TMEM16B, clone 13B8, Cat. No. MABN2433, is a highly specific mouse monoclonal antibody that targets Transmembrane protein 16B (Anoctamin-2) and has been tested in Immunofluorescence and Western Blotting.
Western Blotting Analysis: A representative lot detected TMEM16B in mouse retina tissue (Courtesy of Dr. Robert Molday, Ph.D., University of British Columbia, Canada).
Immunofluorescence Analysis: A representative lot detected TMEM16B in mouse retina tissue (Courtesy of Dr. Robert Molday, Ph.D., University of British Columbia, Canada).
Quality
Evaluated by Immunohistochemistry in mouse retinal tissue.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected TMEM16B in mouse retinal tissue.
Target description
130 kDa observed; 114.13 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 13B8, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_705817.2, UniProt accession no. Q8CFW1, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TMEM199 antibody produced in rabbit
Human Protein Atlas Number: HPA027051 Human Protein Atlas characterization data
Кат. номер HPA027051-100UL HPA027051-25UL General descriptionTransmembrane protein 199 (TMEM199) might be a human homolog of yeast V-ATPase assembly factor Vph2p. The gene encoding it has six exons. The 208 amino acid protein has a Vma12 domain at the carboxyl terminus. TMEM199 is expressed in the endoplasmic reticulum. The gene encoding this protein is localized on human chromosome 17q11.2.Immunogentransmembrane protein 199 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry and Western blotting against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Transmembrane protein 199 (TMEM199) may be involved in Golgi homeostasis and its deficiency is linked to abnormal glycosylation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72929,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence AGERLVRALGPGGELEPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLIRDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVRSL conjugate unconjugated UniProt accession no. Q8N511, shipped in wet ice storage temp. 20°C Gene Information human ... TMEM199(147007)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-TMP21 (N-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер T3702-25UL T3702-200UL General descriptionTransmembrane protein, 21KD (TMP21) gene is mapped on the human chromosome at 14q24.3. TMP21 belongs to the p24 family and is a type I transmembrane protein. It is located in the endoplasmic reticulum (ER) and the Golgi apparatus.
Specificity
Anti-TMP21 (N-terminal) specifically recognizes human TMP21.ApplicationAnti-TMP21 (N-terminal) antibody produced in rabbit may be used in immunoblotting.
Biochem/physiol Actions
Transmembrane protein, 21KD (TMP21) has been recently linked to the metabolism of Alzheimer′s disease amyloid β (Ab) peptide. It is a member of the heteromeric secretase complex that distinctively regulates γ-secretase cleavage without affecting its ε-secretase cleavage. TMP21 is destabilized from the complex in the absence of the presenilins PS1, PS2, and pen-2. It might modulate intramembrane proteolysis controlling g-secretase activity and thus preventing the over-production of Ab peptide. Overexpression of TMP21 gene does not alter γ -secretase activity, but suppression of TMP21 gene increases Aβ40 and Aβ42 peptides. TMP21 appears to be independent of its role in protein transport from the endoplasmic reticulum (ER) to the Golgi and are involved in vesicular trafficking.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~21 kDa species reactivity human, rat (predicted), mouse (predicted) packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) western blot: 1-2 µg/mL using HepG2 cell lysate conjugate unconjugated UniProt accession no. P49755, shipped in dry ice storage temp. 20°C Gene Information human ... TMED10(10972)
mouse ... Tmed10(68581)
rat ... Tmed10(84599)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TMPRSS2 Antibody, clone P5H9-A3
eCl@ss: 32160702
Кат. номер MABF2158-25UG MABF2158-100UG General descriptionTransmembrane protease serine 2 (UniProt: O15393; also known as Serine protease 10, TMPRSS2) is encoded by the TMPRSS2 (also known as PRSS10) gene (Gene ID: 7113) in human. TMPRSS2 is a single-pass type II membrane protein of the peptidase S1 family that is shown to proteolytically cleave and activate the viral spike glycoproteins, which facilitate virus-cell membrane fusions. It is shown to facilitate human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2 that promotes viral uptake and cleavage of coronavirus spike glycoprotein, which activates the glycoprotein for cathepsin L-independent host cell entry. TMPRSS2 is highly expressed in the prostate tissue and lower expression levels are observed in the epithelia of the colon, stomach, epididymis and breast tissue. Some expression has also been reported in pancreatic acini, hepatic bile ducts, testicular Leydig cells and the kidney. Its expression levels are significantly elevated in both neoplastic prostate and in the epithelium of prostatic hyperplasia. TMPRSS2 has a cytoplasmic domain (aa 1-84), a transmembrane domain (aa 85-105), and an extracellular domain (aa 106-492). Its peptidase S1 domain is localized to amino acids 256-489. It is reported to be proteolytically processed by an autocatalytic mechanism generating the transmembrane protease serine 2 non-catalytic chain (1-255) and the transmembrane protease serine 2 catalytic chain (256-492). Two isoforms of TMPRSS2 have been described that are produced by alternative splicing.
Specificity
Clone P5H9-A3 specifically detects human Transmembrane protease serine 2. It targets an epitope with in the extracellular serine protease domain.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids from the extracellular domain of human transmembrane protease serine 2.ApplicationImmunohistochemistry (Paraffin) Analysis: 1:50 dilution from a representative lot detected TMPRSS2 in human kidney tissue sections.
Enzyme Immunoassay (ELISA) Analysis: A representative lot detected TMPRSS2 in ELISA applications (Lucas, J.M., et. al. (2008). J Pathol. 215(2):118-25).
Western Blotting Analysis: A representative lot detected TMPRSS2 in Western Blotting applications (Lucas, J.M., et. al. (2008). J Pathol. 215(2):118-25).
Immunohistochemistry (Paraffin) Analysis: A representative lot detected TMPRSS2 in Immunohistochemistry applications (Lucas, J.M., et. al. (2008). J Pathol. 215(2):118-25; Bertram, S., et. al. (2012). PLoS One. 7(4):e35876).
Anti-TMPRSS2, clone P5H9-A3, Cat. No. MABF2158, is a mouse monoclonal antibody that detects Transmembrane protease serine 2 and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry (Paraffin) in human prostate tissue sections.
Immunohistochemistry (Paraffin) Analysis: 1:250 dilution of this antibody detected TMPRSS2 in human prostate tissue sections.
Target description
53.86 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone P5H9-A3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 UniProt accession no. O15393, Gene Information human ... TMPRSS2(7113) Узнать цену -
Anti-TNPO2 (C-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200031-25UL SAB4200031-200UL General descriptionTransportin 2 (TNPO2 or TRN2) is a member of the karyopherin family of transport receptors. This protein exists in two isoforms TRN2a and TRN2b. The TNPO2 gene is located on human chromosome 19p13.2.
Specificity
Anti-TNPO2 (C-terminal) recognizes human TNPO2 isoform b.ApplicationAnti-TNPO2 (C-terminal) antibody produced in rabbit may be used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
Transportin 2 (TNPO2) is involved in a novel nuclear protein import and export pathway. This protein specifically binds to M9-containing proteins such as heterogeneous nuclear ribonucleoprotein A1 (hnRNPA1) as well as the nucleocytoplasmic shuttling sequence (HNS) region of HuR, but not to the classical nuclear localization signal (NLS)-containing proteins. TNPO2 protein interacts with a similar set of RNA-binding proteins in an RAs-related nuclear protein (Ran)- guanosine triphosphate (GTP) sensitive manner.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~95 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoprecipitation (IP): 5-10 µg using lysates of HEK-293T cells over expressing human TNPO2","indirect immunofluorescence: 2-5 µg/mL using paraformaldehyde fixed HEK-293T cells over expressing human TNPO2","western blot: 1-2 µg/mL using lysates of HEK-293T cells over expressing human TNPO2 conjugate unconjugated UniProt accession no. O14787, shipped in dry ice storage temp. 20°C Gene Information human ... TNPO2(30000)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TNRC6ABC Antibody, clone 7A9
eCl@ss: 32160702
Кат. номер MABE1919-100UG MABE1919-25UG General descriptionTrinucleotide repeat-containing gene 6A, 6B, and 6C proteins (UniProt: Q8NDV7; Q9UPQ9; Q9HCJ0) are encoded by the TNRC6A, TNRC6B, and TNRC6C genes (Gene ID: 27327, 23112, and 57690), respectively in human. TNRC6 proteins are ubiquitously distributed and play a role in RNA-mediated gene silencing by both micro-RNAs (miRNAs) and short interfering RNAs (siRNAs). TNRC6 proteins are required for miRNA-dependent repression of translation and for siRNA-dependent endonucleolytic cleavage of complementary mRNAs by argonaute family proteins. They also serve as a scaffolding proteins and associate with argonaute proteins bound to partially complementary mRNAs. They can simultaneously recruit CCR4-NOT and PAN deadenylase complexes. TNRC6 proteins are predominantly found in the cytoplasm under steady state conditions, however, they are also found in the nucleus and their nuclear import is mediated via the importin pathways. TNRC6A is shown to posses both nuclear localization (NLS) as well a nuclear export signal (NES). In case of mutated NES, TNRC6A is shown to be retained in the nucleus. TNRC6 proteins contain RRM domains (aa 1781-1853; 1648-1720; and 1563-1632 for TNRC6A, 6B, and 6C, respectively). Clone 7A9 recognizes all three TNRC6 proteins. (Ref.: Schraivogel, D., et al. (2015). Nucleic Acids Res. 43(15); 7447-7461).
Specificity
Clone 7A9 is a rat monoclonal antibody that detects human Trinucleotide repeat-containing gene 6A, 6B, and 6C proteins. It target epitopes with in RRM domains.ImmunogenRecombinant RRM domain regions from human TNRC6A, TNRC6B, and TNRC6C.ApplicationImmunofluorescence Analysis: A representative lot detected TNRC6ABC in Immunofluorescence applications (Schraivogel, D., et. al. (2015). Nucleic Acids Res. 43(15):7447-61).
Immunoprecipitation Analysis: A representative lot immunoprecipitated TNRC6ABC in Immunoprecipitation applications (Quevillon Huberdeau, M., et. al. (2017). EMBO J. 36(14):2088-2106).
Research Category
Epigenetics & Nuclear Function
Anti-TNRC6ABC, clone 7A9, Cat. No. MABE1919, is a highly specific rat monoclonal antibody that targets TNRC6 and has been tested for use in Immunofluorescence, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in Induced Stably transfected HEK293 cell lysates.
Western Blotting Analysis: 4 µg/mL of this antibody detected TNRC6 in lysate from stably induced HEK 293 cells transfected with TNRC6A, but not in uninduced HEK 293 cells.
Target description
~175-210 kDa observed; 210.30,194.00, 175.96 kDa for TNRC6A, 6B, and 6C, respectively. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 7A9, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_001020014,","NP_001136112,","NP_001317449, UniProt accession no. Q8NDV7,","Q9HCJ0,","Q9UPQ9,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TOX4 antibody produced in rabbit
Human Protein Atlas Number: HPA017880 Human Protein Atlas characterization data
Кат. номер HPA017880-100UL HPA017880-25UL General descriptionTOX high mobility group box family member 4 (TOX4) belongs to the HMG-box protein family and is expressed in the nucleus. It possesses lysine-based NLS (nuclear localization signal) and DNA-binding HMG box motif.ImmunogenTOX high mobility group box family member 4 recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Anti-TOX4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,. Anti-TOX4 antibody produced in rabbit has been used for epifluorescence microscopy.
Biochem/physiol Actions
TOX high mobility group box family member 4 (TOX4) recognizes DNA adducts which are produced by platinum anticancer drugs and is suggested to be involved in cellular mechanisms against DNA damage. The carboxyl-terminal of TOX4 interacts with the amino-terminal region of protein phosphatase-1 nuclear targeting subunit (PNUTS) and this complex may play a role in the transcriptional regulation of genes. TOX4 also interacts with lens epithelium derived growth factor (LEDGF).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70391,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS conjugate unconjugated UniProt accession no. O94842, shipped in wet ice storage temp. 20°C Gene Information human ... TOX4(9878)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TP53BP1 antibody produced in rabbit
MDL number: MFCD04975126 Human Protein Atlas Number: HPA008788 Human Protein Atlas characterization data
Кат. номер HPA008788-100UL HPA008788-25UL General descriptionTP53BP1 (tumor protein p53 binding protein 1) was initially recognized as a p53-binding protein, which increases the transcriptional activity of p53. It is also a tumor suppressor protein. This protein contains two BRCA1 domains in its C-terminal, called BRCA1 C-terminal (BRCT) domains. This protein is localized to the nucleus.ImmunogenTumor suppressor p53-binding protein 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
TP53BP1 (tumor protein p53 binding protein 1) plays an essential role in DNA damage repair and cell cycle control, where it interacts with damage sensors and signal transducers. It is involved in DSB (double strand break) repairs, and mediates microhomology-mediated end-joining (MMEJ) in G1-phase cells. In breast cancer, this protein acts as a tumor suppressor, and as a marker for the prognosis of breast cancer. It also inhibits angiogenesis in the same. Three variants of this gene are linked with reduced risk of basal cell carcinoma (BCC).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70850,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","western blot: 0.04-0.4 µg/mL immunogen sequence AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL conjugate unconjugated Featured Industry Research Pathology UniProt accession no. Q12888, shipped in wet ice storage temp. 20°C Gene Information human ... TP53BP1(7158)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TRAF6 antibody produced in rabbit
MDL number: MFCD04040629 Human Protein Atlas Number: HPA020599 Human Protein Atlas characterization data
Кат. номер HPA020599-100UL HPA020599-25UL ImmunogenTNF receptor-associated factor 6 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75167,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200-1:500 immunogen sequence ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV conjugate unconjugated UniProt accession no. Q9Y4K3, shipped in wet ice storage temp. 20°C Gene Information human ... TRAF6(7189)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Transcription Initiation Factor IIA subunit 1
eCl@ss: 32160702
Кат. номер ABE1797-25UG ABE1797 General descriptionTranscription initiation factor IIA subunit 1 (UniProt: P52655; also known as General transcription factor IIA subunit 1, TFIIAL, Transcription initiation factor TFIIA 42 kDa subunit, TFIIA-42) is encoded by the GTF2A1 (also known as TF2A1) gene (Gene ID: 2957) in human. TFIIA is one of the several components of the transcription machinery of RNA polymerase II that plays an important role in transcriptional activation. TFIIA in a complex with TATA-box-binding protein (TBP) mediates transcriptional activity. After initiation, some components of the pre-initiation complex, including TFIIA, remain attached and re-initiate a subsequent round of transcription. Binding of TFIIA to TBP helps to stabilize TBP binding to the TATA element. TFIIA is a heterodimer of the large unprocessed subunit 1 and a small subunit gamma. It was originally believed to be a heterotrimer of an alpha (p35), a beta (p19) and a gamma subunit (p12).
Specificity
This rabbit polyclonal antibody detects Transcription initiation factor IIA subunit 1 in human cells. It targets an epitope within 15 amino acids from the C-terminal region.ImmunogenEpitope: C-terminus
KLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal region of human Transcription initiation factor IIA subunit 1.ApplicationAnti-Transcription Initiation Factor IIA subunit 1, Cat. No. ABE1797, is a highly specific rabbit polyclonal antibody that targets Transcription initiation factor IIA subunit 1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Western Blotting Analysis: 0.2 µg/mL from a representative lot detected Transcription initiation factor IIA subunit 1 in 10 µg of RAW264.7 cell lysate.
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Transcription initiation factor IIA subunit 1 in human brain and human testis tissue.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 0.2 µg/mL of this antibody detected Transcription initiation factor IIA subunit 1 in 10 µg of HeLa cell lysate.
Target description
~55 kDa observed; 41.51 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_056943, UniProt accession no. P52655, shipped in ambient Gene Information human ... GTF2A1(2957)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Transferrin antibody produced in goat
MDL number: MFCD00162555 NACRES: NA.41
Кат. номер T2027-25UL T2027-2ML General descriptionTransferrin is a bilobed glycoprotein. The polypeptide chain of transferrin is composed of two homologous lobes i.e N- and C- lobes. Each lobe is made of two domains N1, N2 and C1, C2 which are linked by a hinge. It has two specific sites for binding of Fe3+.ApplicationAnti-Transferrin antibody has been used:- in quantitative precipitin assay
- in enzyme linked immunosorbent assay (ELISA)
- in western blotting
- in immunoblotting
Anti-Transferrin antibody produced in goat was used in western blotting analysis of HEK293 cell extracts.
Biochem/physiol Actions
Transferrin is the major iron transporter protein that binds Fe(+3). The transferring-iron import system consists of a TonB dependent transporter (TbpA), and a lipoprotein co-receptor (TbpB) and both proteins work together in the transport of iron across the membrane.
Transferrin plays a major role in providing iron as a source for haemoglobin synthesis. It binds to the transferrin receptor 1(TfR1).
Preparation Note
treated to remove lipoproteins
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source goat antibody form whole antiserum antibody product type primary antibodies clone polyclonal contains 15 mM sodium azide species reactivity human packaging antibody small pack of 25 µL application(s) indirect ELISA: 1:50,000","quantitative precipitin assay: 3.2-4.8 mg/mL conjugate unconjugated UniProt accession no. P02787, shipped in dry ice storage temp. 20°C Gene Information human ... TF(7018)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Transglutaminase-2 (C-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200073-25UL SAB4200073-200UL General descriptionTranglutaminase-2 (also known as TGM2, TG2), is a widely expressed, multifunctional protein.ApplicationAnti-Transglutaminase-2 (C-terminal) antibody produced in rabbit has been used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
- immunohistochemistry
Biochem/physiol Actions
Tranglutaminase-2 possesses enzymatic and GTPase activities, involved in multiple cell functions, including cell adhesion and cell signaling. TGM2 functions as a Ca2+-dependent enzyme capable of crosslinking both cytosolic and extracellular matrix proteins by catalyzing the formation of isopeptide bonds between lysine and glutamine residues. TGM2 is involved in the regulation of cell-matrix adhesion, cytoskeletal structure, cell migration and apoptosis. It is activated in response to tissue injury and plays an important role in wound healing and immune response. TGM2 is a major autoantigen in celiac disease and altered TGM2 expression or activity may be associated with Alzheimers disease, arteriosclerosis, type-2 diabetes and cancer metastasis in numerous forms of cancer.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~78 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1.5 mg/mL application(s) immunohistochemistry: 5-10 µg/mL using formalin-fixed and paraffin embedded human placenta","immunoprecipitation (IP): 15-30 µg using human placenta extracts","indirect immunofluorescence: 2-4 µg/mL using U87 cells","western blot: 1-2 µg/mL using U87 cell extracts conjugate unconjugated UniProt accession no. Q07283, shipped in dry ice storage temp. 20°C Gene Information human ... TCHH(7052)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Transglutaminase-2 Antibody, FN binding domain Antibody, clone 4G3
eCl@ss: 32160702
Кат. номер MAB3839-I-25UG MAB3839-I-100UG General descriptionProtein-glutamine gamma-glutamyltransferase 2 (UniProt: P21980; also known as EC: 2.3.2.13, Tissue transglutaminase, Transglutaminase C, TG(C), TGC, TGase C, Transglutaminase H, TGase H, Transglutaminase-2, TGase-2, TG2) is encoded by D13the TGM2 gene (Gene ID: 7052) in human. TG2 is a multi-domain, multi-functional enzyme that is shown to post-translationally modify proteins by catalyzing the formation of intermolecular isopeptide bonds between glutamine and lysine side-chains. It catalyes the calcium-dependent covalent modification of protein-bound glutamine side chains through transamidation or deamidation reactions. Recycling endosomes is reported to be essential for externalization of TG2, which does not follow the classical ER/Golgi-dependent secretion pathway, but is targeted to perinuclear recycling endosomes, and is delivered inside these vesicles prior to externalization. Inactivation of recycling endosomes or blocking endosome fusion with the plasma membrane is shown to block TG2 secretion. TG2 plays a critical role in extracellular matrix formation and integrin mediated signaling. It is also reported to be involved in cell signaling involving 7-transmembrane receptors. It also participates in the pathogenesis of neurodegenerative diseases and certain cancers. (Ref.: Zemskov, EA., et al (2011). PLoS ONE 6(4): e19414; Siegal, M., and Khosla, C. (2007). Pharmacol. Ther. 115(2); 232-245.
Specificity
Clone 4G3 specifically detects human Transglutaminase-2.ImmunogenA full-length purified tissue transglutaminase (TG-2) from human erythrocytes.ApplicationWestern Blotting Analysis: 4 µg/mL from a representative lot detected Transglutaminase-2, FN binding domain in HUVEC lysate.
Western Blotting Analysis: A representative lot detected Transglutaminase-2, FN binding domain in Western Blotting applications (Janiak, A., et. al. (2006). Mol Biol Cell. 17(4):1606-19).
Radioimmunoassay Analysis: A representative lot detected Transglutaminase-2, FN binding domain in Radioimmunoassay applications (Akimov, S.S., et. al. (2001). Blood. 98(5):1567-76).
Flow Cytometry Analysis: A representative lot detected Transglutaminase-2, FN binding domain in Flow Cytometry applications (Zemskov, E.A., et. al. (2011). PLos One. 6(4):e19414).
Immunoprecipitation Analysis: A representative lot immunoprecipitated Transglutaminase-2, FN binding domain in Immunoprecipitation applications (Zemskov, E.A., et. al. (2011). PLos One. 6(4):e19414; Janiak, A., et. al. (2006). Mol Biol Cell. 17(4):1606-19).
Immunofluorescence Analysis: A representative lot detected Transglutaminase-2, FN binding domain in Immunofluorescence applications (Janiak, A., et. al. (2006). Mol Biol Cell. 17(4):1606-19; Akimov, S.S., et. al. (2001). Blood. 98(5):1567-76; Zemskov, E.A., et. al. (2011). PLos One. 6(4):e19414).
Anti-Transglutaminase-2, FN binding domain, clone 4G3, Cat. No. MAB3839-I, is a mouse monoclonal antibody that detects Protein-glutamine gamma-glutamyltransferase 2 and has been tested for use in Flow Cytometry, Immunofluorescence, Immunoprecipitation, and Western Blotting.
Research Category
Signaling
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Transglutaminase-2, FN binding domain in A431 cell lysate.
Target description
~80 kDa observed; 77.33 kDa calculated. Uncharacterized bands may be observed in some lysate(s).LinkageReplaces: MAB3839
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 4G3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001310245, UniProt accession no. P21980, Gene Information human ... TGM2(7052) Узнать цену -
Anti-TREM-2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN1471 ABN1471-25UG General descriptionTriggering receptor expressed on myeloid cells 2 (UniProt: Q9NZC2; also known as TREM-2, Triggering receptor expressed on monocytes 2) is encoded by the TREM2 gene (Gene ID: 54209) in human. TREM2 is an Ig-like V-type receptor expressed by populations of myeloid cells in various region of the central nervous system. Its expression is also reported on macrophages and dendritic cells, but not on granulocytes or monocytes. TREM2 is highly expressed in microglia, where it, along with its adaptor protein DAP12, regulates inflammatory cytokine release and phagocytosis of apoptotic neurons. TREM-2 plays a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. It forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. Apolipoprotein E (ApoE) is reported to function as a high-affinity ligand for TREM-2. ApoE binding is shown to enhance the phagocytosis of apoptotic N2a cells by primary microglia cells. Greatly reduced ApoE binding is seen with Alzheimer s disease-associated TREM2 R47H mutant. TREM2 is produced with a signal peptide sequence (a.a. 1-18), the removal of which yields the mature single-transmembrane (a.a. 175-195) protein with a large extracellular region (a.a. 19-174) that contains the V-type Ig-like domain (a.a. 29-112) and a cytoplasmic tail (a.a. 196-230). The short cytoplasmic tail contains no signaling motifs and relies on its association with the immunoreceptor tyrosine-based activation motif- (ITAM-) containing TYROBP for signal transduction.
Specificity
This polyclonal antibody antibody detects Triggering receptor expressed on myeloid cells 2 in several regions of human brain. It targets an epitope within 13 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 13 amino acids from the C-terminal region of human TREM-2.ApplicationImmunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected TREM-2 in human cerebellum, human bone marrow, human colon, and human kidney tissue.
Anti-TREM-2, Cat. No. ABN1471, is a highly specific rabbit polyclonal antibody that targets Triggering receptor expressed on myeloid cells 2 and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in human cerebellum tissue lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected TREM-2 in 10 µg of human cerebellum tissue lysate.
Target description
~27 kDa observed; 25.45 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_061838, UniProt accession no. Q9NZC2, shipped in wet ice Gene Information human ... TREM2(54209)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TRF1 Antibody, clone BED5 57-6
eCl@ss: 32160702
SpecificityКат. номер 4-638 4-638-25UG 4-638-100UG
Detects TRF1ImmunogenHuman TRF1 proteinApplicationThis Anti-TRF1 Antibody, clone BED5 57-6 is validated for use in WB, IF for the detection of TRF1.
Quality
Routinely evaluated by Western Blot on HeLa cell lysate.
Target description
~60 kDa
Physical form
Affinity purified immunoglobulin in PBS with 0.05% NaN3
Format: PurifiedOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 100 biological source mouse antibody form affinity purified immunoglobulin antibody product type primary antibodies clone BED5 57-6, monoclonal species reactivity monkey, rat, human, mouse, hamster packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) immunofluorescence: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_059523, UniProt accession no. P54274, shipped in ambient Узнать цену -
Anti-TRF2 Antibody, clone T2JKM3
eCl@ss: 32160702
Кат. номер MABE1135-25UG MABE1135-100UG General descriptionTelomeric repeat-binding factor 2 (UniProt: Q15554; also known as TTAGGG repeat-binding factor 2, Telomeric DNA-binding protein, TERF2) is encoded by the TERF2 (also known as TRBF2, TRF2) gene (Gene ID: 7014) in human. TERF2 is homodimeric protein that is ubiquitous in its expression. Higher expression levels are reported in spleen, thymus, prostate, uterus, testis, peripheral blood leukocytes, colon, and small intestine. Two soforms of TERF2 are reported that are produced by alternative splicing.TERF2 binds to telomeric double-stranded 5-TTAGGG-3 repeat and plays a central role in telomere maintenance and protection against end-to-end fusion of chromosomes. It is also required to recruit a number of factors and enzymes required for telomere protection, including the sheltering complex, TERF2IP/RAP1 and DCLRE1B/Apollo. TEFR2 colocalizes with telomeric DNA in interphase cells and is located at chromosome ends during metaphase. It is phosphorylated upon DNA damage and the phosphorylated TERF2 is not bound to telomeric DNA, and rapidly localizes to damage sites. Inhibition of TRF2 causes apoptosis in several mammalian cell types and its over-expression is observed in a variety of human cancers.
Specificity
Clone T2JKM3 detects Telomeric repeat-binding factor 2 in human cells.ImmunogenTagged full length recombinant human Telomeric repeat-binding factor 2.ApplicationResearch Category
Epigenetics & Nuclear Function
Immunocytochemistry Analysis: A representative lot detected TRF2 in IMR90 primary human fibroblasts.
Western Blotting Analysis: A 1:200 dilution from a representative lot detected TRF2 in HT1080 cell lysate.
Anti-TRF2, clone T2JKM3, Cat. No. MABE1135, is a highly specific mouse monoclonal antibody that targets Telomeric repeat-binding factor 2 (TRF2) and has been tested for use in Immunocytochemistry and Western Blotting.
Quality
Evaluated by Western Blotting in HT1080 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected TRF2 in HT1080 cell lysate.
Target description
~60 kDa observed; 59.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone T2JKM3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_005643, UniProt accession no. Q15554, Gene Information human ... TERF2(7014)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TRIM55 antibody produced in rabbit
Human Protein Atlas Number: HPA053691 Human Protein Atlas characterization data
Кат. номер HPA053691-100UL HPA053691-25UL Immunogentripartite motif containing 55ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76267,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK conjugate unconjugated UniProt accession no. Q9BYV6, shipped in wet ice storage temp. 20°C Gene Information human ... TRIM55(84675)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TRIO
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN1452 ABN1452-25UG General descriptionTriple functional domain protein (UniProt: O75962; also known as EC: 2.7.11.1, PTPRF-interacting protein, TRIO) is encoded by the TRIO gene (Gene ID: 7204) in human. TRIO is a complex protein that is widely expressed in human tissue, with highest levels reported in heart, skeletal muscle, and brain. Five isoforms of TRIO have been reported that are produced by alternative splicing. It contains three catalytic domains, two tandem Dbl Homology (DH) and pleckstrin homology (PH) domains, and a serine/Threonine kinase domain. The DH-PH module is involved in guanine nucleotide exchange and the activation of the small GTPases of the Rho family. The DH1-PH1 domain (GEF1) is reported to activate the Rho G and Rac1, whereas DH2-PH2 (GEF2) is involved in the activation of RhoA. TRIO is involved in coordinating actin remodeling, which is necessary for cell migration and growth. In developing hippocampal neurons it limits dendrite formation, without affecting the establishment of axon polarity. After dendrites are formed, it is reported to be involved in the control of synaptic function by regulating the endocytosis of AMPA-selective glutamate receptors at CA1 excitatory synapses. Mutations in TRIO gene have been linked to mental retardation and microcephaly. (Ref.: Debant, A. et al. (1996). Proc. Natl. Acad. Sci, USA. 93(11); 5466-71; Bellanger, JM. Et al. (2000). Nat. Cell Biol. 2(12); 888-92).
Specificity
This rabbit polyclonal antibody detects human Triple functional domain protein (TRIO). It targets an epitope within 17 amino acids from the C-terminal half. The immunogen sequence is conserved in all 5 isoforms.ImmunogenKLH-conjugated liner peptide corresponding to 17 amino acids from the C-terminal half of human Triple functional domain protein.ApplicationImmunohistochemistry Analysis: A 1:250 dilution of this antibody detected TRIO in human cerebral cortex, human pancreas, and human testis tissue.
Anti-TRIO Antibody, Cat. No. ABN1452, is a highly specific rabbit polyclonal antibody that targets Triple functional domain protein (TRIO) and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected TRIO in 10 µg of HEK293 cell lysate.
Target description
~300 kDa observed; 346.90 kDa calculalted. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_009049.2, UniProt accession no. O75962, shipped in ambient Gene Information human ... TRIO(7204)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Tropomyosin-1 Antibody, clone 7F8B8
eCl@ss: 32160702
Кат. номер MABT1365-25UL MABT1365-100UL General descriptionTropomyosin alpha-1 chain (UniProt: P09493; also known as Alpha-tropomyosin, Tropomyosin-1) is encoded by the TPM1 (also known as C15orf13, TMSA) gene (Gene ID: 7168) in human. Tropomyosin-1 is a cytoskeletal protein that associates with F-actin stress fibers. It binds to actin filaments in muscle and non-muscle cells and plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. It stabilizes actin filaments and regulates the interaction of actin filament with other actin-binding proteins. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. Tropomyosin-1 is a homodimeric protein, but can form heterodimer of an alpha (TPM1, TPM3, or TPM4) and a beta (TPM2) chain. Mutations in TPM1 gene have been linked to cardiomyopathy characterized by ventricular hypertrophy and ventricular dilation and impaired systolic function that results in congestive heart failure and arrhythmia. Ten different isoforms of Tropomyosin-1 have been described that are produced by alternative splicing.
Specificity
Clone 7F8B8 detects human and murine Tropomyosin-1. It targets an epitope with in the N-terminal region.ImmunogenKLH-conjugated linear peptides corresponding to 24 amino acids from the N-terminal region of isoform 5 and 4 amino acids from the N-terminal region of isoform 2 of human tropomyosin-1.
Epitope: N-terminusApplicationAnti-Tropomyosin-1, clone 7F8B8, Cat. No. MABT1365, is a rat monoclonal antibody that detects Tropomyosin-1 and has been tested for use in Immunocytochemistry and Western Blotting.
Research Category
Cell Structure
Immunocytochemistry Analysis: A representative lot detected Tropomyosin-1 in Immunocytochemistry applications (Brayford, S., et. al. (2016). Curr Biol. 26(10):1312-8).
Quality
Evaluated by Western Blotting in mouse embryonic fibroblast (MEF) lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Tropomyosin-1 in mouse embryonic fibroblast (MEF) lysate.
Target description
~30 kDa observed; 28.38 kDa for isoform 5. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 7F8B8, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_000357.3, UniProt accession no. P09493, Узнать цену -
Anti-Troponin I Antibody, clone 5C11.1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT546-100UL MABT546-25UL General descriptionTroponin I, cardiac muscle (UniProt: P19429; also known as Cardiac troponin I) is encoded by the TNNI3 (also known as TNNC1) gene (Gene ID: 7137) in human. Troponin is a complex that regulates the contraction of skeletal muscle, It consists of 3 subunits known as C, T, and I, which are located periodically along the thin filament of the myofibrils. Troponin C (TnC) binds calcium ions, Troponin I is the inhibitory subunit of troponin that inhibits actomyosin ATPase and Troponin T binds to tropomyosin. It also confers calcium-sensitivity to actomyosin ATPase. Amino acids region 32-79 of Troponin I is involved in binding to TnC and region 129-149 is involved in binding to both TnC and actin. It is thought that troponin I acts as a switch, by moving away from actin toward troponin C, following Ca2+ binding to TnC. Cardiac muscle Troponin I has 31 amino acid residues on its N-terminal that are not present in the skeletal muscle form. Hence, cardiac specificity of this isoform is shown to offer accuracy in diagnosis in patients with acute or chronic skeletal muscle injury. Mutation in TNNI3 gene are reported to result in multiple types of cardiomyopathies that can result in premature death. (Ref.: Li, H-C., and Fajer, PG (1998). Biochemistry 37(19); 6628-6635).
Specificity
Clone 5C11.1 specifically detects Tropinin I in multiple species. It targets an epitope with in 14 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids from the C-terminal region of human Troponin I.ApplicationAnti-Troponin I, clone 5C11.1, Cat. No. MABT546, is a mouse monoclonal antibody that detects Troponin I and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in human skeletal muscle tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Troponin I in human skeletal muscle tissue lysate.
Target description
~22 kDa observed; 24.00 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5C11.1, monoclonal species reactivity human species reactivity (predicted by homology) bovine (based on 100% sequence homology), chicken (based on 100% sequence homology), mouse (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG2a NCBI accession no. NP_000354, UniProt accession no. P19429, Узнать цену -
Anti-TRPV2 Antibody, clone 17A11
eCl@ss: 32160702
Кат. номер MABN2425-25UG MABN2425-100UG General descriptionTransient receptor potential cation channel subfamily V member 2 (UniProt: Q9WUD2; also known as TrpV2, Osm-9-like TRP channel 2, OTRPC2, Stretch-activated channel 2B, Vanilloid receptor-like protein 1, VRL-1) is encoded by the Trpv2 (also known as Sac2b, Vrl1) gene (Gene ID: 29465) in rat. TrpV2 is an ubiquitously expressed, calcium-permeable, non-selective cation channel with an outward rectification. It has been implicated in various physiological and pathological processes, including growth factor signaling, macrophage migration, cancer cell metastasis, heart disease, and neuronal cell development. It appears to be regulated by growth factors, like IGF1, PDGF, and morphogenetic neuropeptide/head activator. It is also activated by temperatures higher than 52 degree C, but is not activated by vanilloids and acidic pH. TrpV2 channel is upregulated by the nerve growth factor (NGF) via the mitogen-activated protein kinase (MAPK) signaling pathway to augment neurite outgrowth. Although NGF increases TrpV2 content, it does not induce the translocation of TrpV2 from cytoplasm to cell surface in PC12 cells. (Ref.: Cohen MR., et al. (2015). Mol. Cell Biol. 35(24): 4238-4252).
Specificity
Clone 17A11 detects Transient receptor potential cation channel subfamily V member 2 (TRPV2) in mouse and rat cells.Immunogen1D4-tagged full length rat Transient receptor potential cation channel subfamily V member 2 (TRPV2).ApplicationAnti-TRPV2, clone 17A11, Cat. No. MABN2425, is a highly specific mouse monoclonal antibody that targets TRPV2 and has been tested for use in Immunocytochemistry and Western Blotting.
Western Blotting Analysis: A representative lot detected TRPV2 in Western Blotting applications (Cohen, M.R., et. al. (2013). PLoS One. 8(12):e85392).
Immunocytochemistry Analysis: A representative lot detected TRPV2 in Immunocytochemistry applications (Cohen, M.R., et. al. (2013). PLoS One. 8(12):e85392; Cohen M.R., et. al. (2015). Mol Cell Biol. 35(24):4238-52).
Quality
Evaluated by Immunocytochemistry in PC12 cells treated with NGF.
Immunocytochemistry Analysis: 2-10 µg/mL of this antibody detected TRPV2 in PC12 cells treated with mouse NGF.
Target description
86.71 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 17A11, monoclonal species reactivity rat, mouse packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_058903.2, UniProt accession no. Q9WUD2, Узнать цену -
Anti-TrpV2 Antibody, clone 2D6
eCl@ss: 32160702
Кат. номер MABN2426 MABN2426-25UL General descriptionTransient receptor potential cation channel subfamily V member 2 (UniProt: Q9WUD2; also known as TrpV2, Osm-9-like TRP channel 2, OTRPC2, Stretch-activated channel 2B, Vanilloid receptor-like protein 1, VRL-1) is encoded by the Trpv2 (also known as Sac2b, Vrl1) gene (Gene ID: 29465) in murine species. TrpV2 is an ubiquitously expressed, calcium-permeable, non-selective cation channel with an outward rectification. It has been implicated in various physiological and pathological processes, including growth factor signaling, macrophage migration, cancer cell metastasis, heart disease, and neuronal cell development. It appears to be regulated by growth factors, like IGF1, PDGF, and morphogenetic neuropeptide/head activator. It is also activated by temperatures higher than 52C, but is not activated by vanilloids and acidic pH. TrpV2 channel is upregulated by the nerve growth factor (NGF) via the mitogen-activated protein kinase (MAPK) signaling pathway to augment neurite outgrowth. Although NGF increases TrpV2 content, it does not induce the translocation of TrpV2 from cytoplasm to cell surface in PC12 cells. (Ref.: Cohen MR et al. (2015). Mol. Cell Biol. 35(24): 4238-4252).
Specificity
Clone 2D6 detects Transient receptor potential cation channel subfamily V member 2 (TrpV2) in Hamster, Mouse, and Rat.ImmunogenA full length recombinant rat Transient receptor potential cation channel subfamily V member 2 (TrpV2).ApplicationWestern Blotting Analysis: A reperesentative lot detected TrpV2 in Western Blotting applications (Cohen, M.R., et. al. (2013). PLoS One. 8(12):e85392; Cohen, M.R., et. al. (2015). Mol Cell Biol. 35(24):4238-52).
Immunoprecipitation Analysis: A reperesentative lot detected TrpV2 in Immunoprecipitation applications (Cohen, M.R., et. al. (2013). PLoS One. 8(12):e85392).
Anti-TrpV2, clone 2D6 Antibody, Cat. No. MABN2426, is a highly specific mouse monoclonal antibody that targets TRPV2 and has been tested in Immunoprecipitation and Western Blotting.
Quality
Evaluated by Western Blotting in PC12 cells treated with NGF.
Western Blotting Analysis: A 1:500 dilution of this antibody detected TrpV2 in 10 µg of PC12 cells treated with NGF 7S (100 ng/72 hours).
Target description
~86 kDa observed; 86.71 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 2D6, monoclonal species reactivity hamster, rat, mouse packaging antibody small pack of 25 µL application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_058903.2, UniProt accession no. Q9WUD2,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TSH Receptor Antibody, clone CS-17
Кат. номер MABS2240-25UL MABS2240-100UL General descriptionThyrotropin receptor (UniProt: P16473; also known as Thyroid-stimulating hormone receptor, TSH-R) is encoded by the TSHR (also known as LGR3) gene (Gene ID: 7253) in human. TSH-R is a multi-pass membrane protein of the G-protein coupled receptor (GPCR) family that is synthesized with a signal peptide (aa 1-20), which is subsequently cleaved off to generate the mature form that contains four extracellular domains, seven transmembrane domains, and four cytoplasmic domains. The extracellular domain is linked to a distal signal-specific domain the hinge region that is attached to a transmembrane domain consisting of extracellular and intracellular loops. It serves as a receptor the thyroid-stimulating hormone and TSH binding to this receptor induces thyrocyte growth and proliferation primarily by activating the adenylate cyclase signaling pathway. Clone CS-17 acts allosterically and serves as an inverse agonist for TSH-R constitutive activity. When administered in vivo it is shown to suppress thyroid function and reduces serum T4 levels in BALB/c mice. (Ref.: Chen, RR., et al. (2018). Thyroid. 28(77); 933-940; Chen, CR., et al. (2007). Endocrinology. 148(5); 2375-2382).
Specificity
Clone CS-17 is a mouse monoclonal antibody that detects human Thyrotropin receptor. It targets an epitope within the first extracellular domain from the N-terminal region.ImmunogenAdenovirus expressing TSH receptor fragment (aa 22-289). adenovirus.ApplicationQuality Control Testing
Evaluated by Flow Cytometry in TSH-R transfected HEK293 cells.
Flow Cytometry Analysis: 1 µg of this antibody detected TSH Receptor in one million TSH-R transfected HEK293 cells.
Tested Applications
Flow Cytometry: A representative lot detected TSH Receptor in Flow Cytometry applications (Chen, C.R., et al. (2007). Endocrinology. 148(5):2375-82; Chen, C.R., et al. (2009). Endocrinology. 150(7):3401-8; Chen, C.R., et al. (2018). Thyroid. 28(7):933-940).
Inhibition: A representative lot inhibited the constitutive activity of the TSH Receptor. (Furmaniak, J. et al. (2012). Autoimmun Highlights. 4(1):11-26).
Radioimmunoassay: A representative lot detected TSH Receptor in Radioimmunoassay applications (Chen, C.R., et al. (2007). Endocrinology. 148(5):2375-82).
Antagonist Function: A representative lot bloced TSH binding to the TSH Receptor. Endocrinology. 150(7):3401-8; Chen, C.R., et al. (2018). Thyroid. 28(7):933-940).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-TSH Receptor, clone CS-17, Cat. No. MABS2240, is a mouse monoclonal antibody that detects Thyroid-stimulating hormone receptor (TSH-R) and is tested for use in Flow Cytometry, Antagonist Function, Inhibition Assay, and Radioimmunoassay.
Physical form
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Storage and Stability
Store at -10°C to -25°C. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone CS-17, monoclonal mol wt calculated mol wt 86.83 kDa purified by using protein G species reactivity human packaging antibody small pack of 100 µL application(s) agglutination assay: suitable","flow cytometry: suitable","inhibition assay: suitable","radioimmunoassay: suitable isotype IgG2a epitope sequence N-terminal conjugate unconjugated Protein ID accession no. NP_000360, UniProt accession no. P16473, shipped in dry ice Gene Information human ... TSHR(7253)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TSLP Receptor Antibody, clone 1A6
eCl@ss: 32160702
Кат. номер MABF2042-25UG MABF2042-100UG General descriptionCytokine receptor-like factor 2 (UniProt: Q9HC73; also known as Cytokine receptor-like 2, IL-XR, Thymic stromal lymphopoietin protein receptor, TSLP receptor) is encoded by the CRLF2 (also known as CRL2, ILXR, TSLPR) gene (Gene ID: 64109) in human. TSLP receptor is a single-pass type I membrane protein that serves as a receptor for thymic stromal lymphopoietin. It forms a functional complex with TSLP and IL7R to stimulate cell proliferation via activation of STAT3 and STAT5. It is primarily expressed in dendrites and monocytes and its expression has also been reported in heart, skeletal muscle, kidney and liver. Its levels are up-regulated in activated peripheral monocytes and THP-1 cells. TSLP receptor is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off in the mature form. It contains an extracellular domain (aa 23-231), a transmembrane domain (aa 232-252), and a cytoplasmic domain (aa 253-371). It also has a WSXWS motif (aa 200-204) that is essential for proper protein folding and efficient intracellular transport and cell-surface binding. In addition, its Box 1 motif (aa 261-269) is reported to be important for its association with JAKs. Three isoforms of TSLP receptors have been described that are produced by alternative splicing.
Specificity
Clone 1A6 specifically detects human TSLP receptor protein. It targets an epitope with in the extracellular domain.ImmunogenFc-fusion protein of ectodomain region of human TSLP receptor protein.
Epitope: extracellular domainApplicationAnti-TSLP Receptor, clone 1A6, Cat. No. MABF2042, is a mouse monoclonal antibody that detects TSLP receptor and has been tested for use in Flow Cytometry.
Research Category
Inflammation & Immunology
Quality
Evaluated by Flow Cytometry in one million THP-1 monocytic peripheral blood cells.
Flow Cytometry Analysis: 1 µg of this antibody detected TSLP Receptor in one million THP-1 monocytic peripheral blood cells.
Target description
42.01 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1A6, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable isotype IgG2a NCBI accession no. NP_071431.2, UniProt accession no. Q9HC73,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
