Antibodies
- Сортировать:
- Вид таблицей
-
Anti-PD-1 Antibody, clone EH33
eCl@ss: 32160702
Кат. номер MABC1122-25UG MABC1122-100UG General descriptionProgrammed cell death protein 1 (UniProt: Q15116; also known as Protein PD-1, hPD-1, CD279) is encoded by the PDCD1 (also known as PD1) gene (Gene ID: 5133) in human. PD-1 is a monomeric inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. PD-1 is synthesized with a signal peptide (aa 1-20), which is subsequently cleaved off. The mature form contains an extracellular domain (aa 24-170), a transmembrane domain (aa 171-191), and a cytoplasmic domain (aa 192-288). PD-1 also contains a single N-terminal immunoglobulin variable region (IgV) like domain. PD-1 and its ligands, PD-L1 and PD-L2 play a key role in the maintenance of peripheral tolerance, a process by which the quiescence of autoreactive mature T cells is maintained. However, tumors and pathogens that cause chronic infections can exploit this pathway to escape T-cell mediated tumor-specific and pathogen-specific immunity. The effector functions of T-cells expressing PD-1 can be downregulated by PD-L1 or PD-L2 expressed by the tumor cells. PD-1 lacks SH2- or SH3-binding motifs on its cytoplasmic tail, but contains the N-terminal sequence VDYGEL that forms an immunoreceptor tyrosine-based inhibition motif (V/I/LxYxxL), which recruits SH2 domain-containing phosphatases. The cytoplasmic tail also contains the C-terminal sequence TEYATI, which forms an immunoreceptor tyrosine-based switch motif (TxYxxL). PD-1 ligation is reported to inhibit the activation of T-cell receptor proximal kinases, which results in attenuation of Lck-mediated phosphorylation of ZAP-70 and initiation of downstream events. PD-1 is also reported to impair the activation of the MEK-ERK MAP kinase pathway by inhibiting activation of PLC- 1 and Ras. (Ref.: Boussiotis, VA (2016). N. Engl. J. Med. 375; 1767-1778).
Specificity
Clone EH33 specifically detects PD-1 in human cells. It targets an epitope with the extracellular domain.ImmunogenRecombinant protein fragment corresponding to the extracellular domain of human PD-1 (as an Ig fusion protein).
Epitope: extracellular domainApplicationImmunohistochemistry Analysis: A representative lot detected PD-1 in Immunohistochemistry applications (Sridharan, V., et. al. (2016). Cancer Immunol Res. 4(8):679-87; Calles, A., et. al. (2015). J Thorac Oncol. 10(12):1726-35; Bachireddy, P., et. al. (2014). Blood. 123(9):1412-21).
Anti-PD-1, clone EH33, Cat. No. MABC1122, is a mouse monoclonal antibody that detects Programmed cell death protein 1 (PD-1) in human cells and has been tested for use in Immunohistochemistry (Paraffin).
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry in human tonsil and human bone marrow tissues.
Immunohistochemistry Analysis: A 1:250 dilution of this antibody detected PD-1 in human tonsil and human bone marrow tissues.
Target description
31.65 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone EH33.1F9.G4.5, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin) isotype IgG2a NCBI accession no. NP_005009.2, UniProt accession no. Q15116,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PD-1 Antibody, clone G4
eCl@ss: 32160702
Кат. номер MABC1132-25UG MABC1132-100UG General descriptionProtein PD-1, mPD-1, CD279) is encoded by the PDCD1 (also known as PD1) gene (Gene ID: 18566) in murine species. PD-1 is a monomeric inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. PD-1 is synthesized with a signal peptide (aa 1-20), which is subsequently cleaved off. The mature form contains an extracellular domain (aa 21-169), a transmembrane domain (aa 170-190), and a cytoplasmic domain (aa 191-288). PD-1 also contains a single N-terminal immunoglobulin variable region (IgV) like domain (aa 31-139). PD-1 and its ligands, PD-L1 and PD-L2 play a key role in the maintenance of peripheral tolerance, a process by which the quiescence of autoreactive mature T cells is maintained. However, tumors and pathogens that cause chronic infections can exploit this pathway to escape T-cell mediated tumor-specific and pathogen-specific immunity. The effector functions of T-cells expressing PD-1 can be downregulated by PD-L1 or PD-L2 expressed by the tumor cells. PD-1 lacks SH2- or SH3-binding motifs on its cytoplasmic tail, but contains the N-terminal sequence VDYGEL that forms an immunoreceptor tyrosine-based inhibition motif (V/I/LxYxxL), which recruits SH2 domain-containing phosphatases. The cytoplasmic tail also contains the C-terminal sequence TEYATI, which forms an immunoreceptor tyrosine-based switch motif (TxYxxL). PD-1 ligation is reported to inhibit the activation of T-cell receptor proximal kinases, which results in attenuation of Lck-mediated phosphorylation of ZAP-70 and initiation of downstream events. PD-1 is also reported to impair the activation of the MEK-ERK MAP kinase pathway by inhibiting activation of PLC- 1 and Ras.
Specificity
Clone G4 is an Armenian Hamster monoclonal antibody that specifically detects PD-1 in murine cells.ImmunogenMurine PD-1Ig fusion protein.ApplicationAffects Function Analysis: A representative lot detected PD-1 in Affects Funtion applications (Dronca, R.S., et. al. (2016). JCI Insight. 1(6); Hirano, F., et. al. (2005). Cancer Res. 65(3):1089-96; Overacre-Delgoffe, A.E., et. al. (2017). Cell. 169(6):1130; Tsushima, F., et. al. (2006). Blood. 110(1):180-5).
Flow Cytometry Analysis: A representative lot detected PD-1 in Flow Cytometry applications (Hirano, F., et. al. (2005). Cancer Res. 65(3):1089-96).
Detects Programmed cell death protein 1 using this armenian hamster monoclonal Anti-PD-1, clone G4, Cat. No. MABC1132, testted for use in Flow Cytometry and Affects Function.
Quality
Evaluated by Flow Cytometry in EL4 T lymphoma cells.
Flow Cytometry Analysis: 1 µg of this antibody detected PD-1 in 1X10E6 EL4 T lymphoma cells.
Target description
~31.84 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source hamster (Armenian) antibody form purified immunoglobulin antibody product type primary antibodies clone G4, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable NCBI accession no. NP_032824.1, UniProt accession no. Q02242, Узнать цену -
Anti-PD-L1 Antibody, clone 5H1
eCl@ss: 32160702
Кат. номер MABC1115-25UL MABC1115-100UL General descriptionProgrammed cell death 1 ligand 1 (UniProt Q9NZQ7; also known as B7-H1, B7 homolog 1, CD274, PD-L1, PDCD1 ligand 1, Programmed death ligand 1) is encoded by the CD274 (also known as B7H1, PDCD1L1, PDCD1LG1, PDL1) gene (Gene ID 29126) in human. PD-L1 is a single-pass type I membrane protein that plays a critical role in induction and maintenance of immune tolerance to self. It is expressed on activated T- and B-cells, dendritic cells, keratinocytes, and monocytes. Higher expression has also been reported in heart, skeletal muscle, placenta, and lung. PD-1 and PD-1 ligands 1 and 2 (PD-L1 and PD-L2) are B7:CD28 family members that regulate T cell activation and peripheral tolerance. When engaged together with the TCR, the interaction of PD-1 with its ligands delivers an inhibitory signal to T cell proliferation and cytokine production. While PD-L1 is broadly expressed in hematopoietic and nonhematopoietic cells, PD-L2 expression is highly restricted to antigen presenting cells (APCs), including dendritic cells (DCs) and macrophages. The PD-1 pathway plays a key role in the progressive loss of effector T cell responses during chronic HIV infection. Under some conditions, blockade of this pathway can restore many T cell functions. PD-L1 is initially produced with signal peptide (aa 1-18) sequence, which is subsequently cleaved off to produce the mature protein with a large extracellular (aa 19-238) region that contains an Ig-like V-type domain (aa 19-127) and an Ig-like C2-type domain (aa 133-225), followed by a transmembrane domain (aa 239-259) and a cytoplasmic tail (aa 260-290).
Specificity
Clone 5H1 detects human Programmed cell death ligand 1 (PD-L1). It targets an epitope with in the extracellular domain.ImmunogenEpitope: extracellular domain
Full-length human recombinant PD-L1.ApplicationAnti-PD-L1, clone 5H1, Cat. No. MABC1115, is a mouse monoclonal antibody that detects PD-L1 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Research Category
Apoptosis & Cancer
Immunohistochemistry (Paraffin) Analysis: A representative lot detected PD-L1 in Immunohistochemistry applications (Bigelow, E., et. al. (2013). J Vis Exp. 3;(71); Spranger, S., et. al. (2013). Sci Transl Med. 5(200):200ra116; Parra, E.R., et. al. (2018). Appl Immunohistochem Mol Morphol. 26(2):83-93; Andorsky, D.J., et. al. (2011). Clin Cancer Res. 17(13):4232-44; Sunshine, J.C., et. al. (2017). Clin Cancer Res. 23(16):4938-4944).
Western Blotting Analysis: A representative lot detected PD-L1 in Western Blotting applications (Parra, E.R., et. al. (2018). Appl Immunohistochem. Mol. Morphol. 26(2):83-93_.
Quality
Evaluated by Immunocytochemistry in MDA-MB-231 cells.
Immunocytochemistry Analysis: A 1:50 dilution of this antibody detected PD-L1 in MDA-MB-231 cells.
Target description
33.28 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5H1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_054862.1, UniProt accession no. Q9NZQ7,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PD-L1 B7-H1 Antibody, clone 10B5
eCl@ss: 32160702
Кат. номер MABC1131-25UG MABC1131-100UG General descriptionProgrammed cell death 1 ligand 1 (UniProt: Q9EP73; also known as PD-L1, PDCD1 ligand 1, Programmed death ligand 1, B7 homolog 1, B7-H1, CD274) is encoded by the Cd274 (also known as B7h1, Pdcd1l1, Pdcd1lg1, Pdl1) gene (Gene ID: 50533) in murine species. PD-L1 is a single-pass type I membrane protein that is highly expressed in the heart, thymus, skeletal muscle, and lung. Its expression is also reported on activated dendritic cells, B-cells, and macrophages. Numerous tumor cell lines of lymphoid origin also express PD-L1. PD-L1 expression can be up-regulated by interferon-gamma treatment in monocytes, B cells, and macrophages. PD-1 and its ligands, PD-L1 and PD-L2 play a key role in the maintenance of peripheral tolerance, a process by which the quiescence of autoreactive mature T cells is maintained. However, tumors and pathogens that cause chronic infections can exploit this pathway to escape T-cell mediated tumor-specific and pathogen-specific immunity. The effector functions of T-cells expressing PD-1 can be downregulated by PD-L1 or PD-L2 expressed by the tumor cells. PD-L1 is initially produced with signal peptide (aa. 1-18) sequence, the removal of which yields the mature protein with a large extracellular (aa. 19-239) domain, a transmembrane domain (aa 240-260), and a cytoplasmic domain (aa 261-290).
Specificity
This Armenian hamster monoclonal antibody detects Programmed cell death 1 ligand 1 (PD-L1) in murine species.ImmunogenRecombinant fragment corresponding to the extracellular domain of Mouse Programmed cell death 1 ligand 1.
Epitope: extracellular domainApplicationInhibits Activity/Function Analysis: A representative lot blocked the activity of PD-L1 B7-H1 and inhibited apoptosis of activated alloreactive 2C T cells. (Hirano, F., et. al. (2005). Cancer Res. 65(3):1089-96; Goldberg, M.V., et. al. (2007). Blood. 110(1):186-92; Joshi, T., et. al. (2009). PLoS Pathog. 5(5):e1000431; Liu, X., et. al. (2016). Sci Rep. 6:36722).
Flow Cytometry Analysis: A representative lot detected PD-L1 B7-H1 in Flow Cytometry applications (Hirano, F., et. al. (2005). Cancer Res. 65(3):1089-96; Dong, H., et. al. (2004). Immunity. 20(3):327-36).
Research Category
Apoptosis & Cancer
Anti-PD-L1 B7-H1, clone 10B5, Cat. No. MABC1131, is an Armenian hamster monoclonal antibody that detects Programmed cell death 1 ligand 1 (PD-L1) and has been tested for use in Flow Cytometry, Immunohistochemistry (Paraffin), and Inhibition Function assay.
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse heart tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:25 dilution of this antibody detected PD-L1 B7-H1 in mouse heart tissue sections.
Target description
32.78 kDa calculated.
Physical form
Purified armenian hamster monoclonal antibody IgG2-IgG3 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source hamster (Armenian) antibody form purified immunoglobulin antibody product type primary antibodies clone 10B5, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunohistochemistry: suitable (paraffin) NCBI accession no. NP_068693.1, UniProt accession no. Q9EP73,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PD-L2 Antibody, clone 366C.9E5
eCl@ss: 32160702
Кат. номер MABC1120-25UG MABC1120-100UG General descriptionProgrammed cell death 1 ligand 2 (UniProt: Q9BQ51; also known as PD-1 ligand 2, PD-L2, PDCD1 ligand 2, Programmed death ligand 2, Butyrophilin B7-DC, B7-DC, CD273) is encoded by the PDCD1LG2 (also known as B7DC, CD273, PDCD1L2, PDL2) gene (Gene ID: 80380) in human. Three isoforms of PD-L2 have been reported that are produced by alternative splicing. Isoforms 1 and 2 are single-pass type I membrane proteins and isoform 3 is a secreted protein. PD-1 and PD-1 ligands 1 and 2 (PD-L1 and PD-L2) are B7:CD28 family members that regulate T cell activation and peripheral tolerance. When engaged together with the TCR, the interaction of PD-1 with its ligands delivers an inhibitory signal to T cell proliferation and cytokine production. While PD-L1 is broadly expressed in hematopoietic and non-hematopoietic cells, PD-L2 expression is highly restricted to antigen presenting cells (APCs), including dendritic cells (DCs) and macrophages. The PD-1 pathway plays a key role in the progressive loss of effector T cell responses during chronic HIV infection. Under some conditions, blockade of this pathway can restore many T cell functions. PD-L2 is initially produced with signal peptide (aa 1-19) that is removed to produce the mature protein that contains a large extracellular region (aa. 20-220), a transmembrane domain (aa 221-241), and a cytoplasmic tail (aa 242-273).
Specificity
Clone 366C.12.9E5.E10.19.1F8 specifically detects PD-L2 in human cells. It targets an epitope within the extracellular domain.ImmunogenRecombinant protein fragment corresponding to the extracellular domain of human PD-L2 (as an Ig fusion protein).
Epitope: extracellular domainApplicationResearch Category
Apoptosis & Cancer
Anti-PD-L2, clone 366C.9E5, Cat. No. MABC1120, is a mouse monoclonal antibody that detects Programmed cell death 1 ligand 2 (PD-L2) and has has been tested for use in Immunohistochemistry (Paraffin).
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected PD-L2 in human prostate tissue.
Immunohistochemistry Analysis: A representative lot detected PD-L2 in Immunohistochemistry applications (Sridharan, V., et. al. (2016). Cancer Immunol Res. 4(8):679-87; Roemer, M.G., et. al. (2016). J Clin Oncol. 34(23):2690-7; Chong, L.C., et. al. (2016). Blood. 128(9):1206-13; Calles, A., et. al. (2015). J Thorac Oncol. 10(12):1726-35).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human tonsil tissue.
Immunohistochemistry Analysis: A 1:250 dilution of this antibody detected PD1-L2 in human tonsil tissue.
Target description
30.96 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 366C.12.9E5.E10.19.1F8, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin) isotype IgG1 NCBI accession no. NP_079515, UniProt accession no. Q9BQ51, Узнать цену -
Anti-PD2 (PAF1) Antibody, clone F169-3B2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT1495-25UG MABT1495-100UG General descriptionPancreatic differentiation protein 2 (UniProt: Q8N7H5; also known as RNA polymerase II-associated factor 1 homolog, PD2, hPAF1) is encoded by the PAF1 (also known as PD2) gene (Gene ID: 54623) in human. PD2 is a nuclear protein that serves as a subunit of the RNA polymerase II associated factor (PAF) complex. It has multiple functions during transcription by RNA polymerase II. It has been implicated in regulation of development and maintenance of embryonic stem cell pluripotency. It associates with RNA polymerase II through interaction with POLR2A C-terminal domain non-phosphorylated and serine 2 and serine 5 phosphorylated forms. It is involved in transcriptional elongation, acting both independently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. Three isoforms of PD2 have been described that are produced by alternative splicing. PD2 has oncogenic property and is shown to be overexpressed in pancreatic cancer cells. In normal murine pancreas, its expression is restricted to acinar cells, however, its expression is increased in the ductal cells of mouse model of pancreatic cancer with advancing age. (Ref.: Dey, P., et al (2014). Oncotarget, 5(12); 4480-4491).
Specificity
Clone F169-3B2 detects Pancreatic differentiation protein 2 (PD2) in human. It targets an epitope with in 22 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 22 amino acids from the C-terminal half of human Pancreatic differentiation protein 2 (PD2).ApplicationAnti-PD2 (PAF1), clone F169-3B2, Cat. No. MABT1495, is mouse monoclonal antibody that detects Pancreatic differentiation protein 2 and has been tested for use in ELISA, Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Immunocytochemistry Analysis: A representative lot detected PD2 (PAF1) in Immunocytochemistry applications (Dey, P., et. al. (2014). Oncotarget. 5(12):4480-91; Moniaux, N., et. al. (2006). Oncogene. 25(23):3247-57).
Immunoprecipitation Analysis: A representative lot immunoprecipitated PD2 (PAF1) in Immunoprecipitation applications (Moniaux, N., et. al. (2006). Oncogene. 25(23):3247-57).
ELISA Analysis: A representative lot detected PD2 (PAF1) in ELISA applications (Moniaux, N., et. al. (2006). Oncogene. 25(23):3247-57).
Immunohistochemistry Analysis: A representative lot detected PD2 (PAF1) in Immunohistochemistry applications (Dey, P., et. al. (2014). Oncotarget. 5(12):4480-91).
Western Blotting Analysis: A representative lot detected PD2 (PAF1) in Western Blotting applications (Moniaux, N., et. al. (2006). Oncogene. 25(23):3247-57).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Immunocytochemistry in Panc1 cells.
Immunocytochemistry Analysis: A 1:500 dilution of this antibody detected PD2 (PAF1) in Panc1 cells.
Target description
59.98 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone F169-3B2, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_061961, UniProt accession no. Q8N7H5, Узнать цену -
Anti-PDCD6-interacting protein Antibody, clone 12H1.2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT1229 MABT1229-25UG General descriptionProgrammed cell death 6-interacting protein (UniProt: Q8WUM4; also known as PDCD6-interacting protein, PDCD6IP, ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95) is encoded by the PDCD6IP (also known as AIP1, ALIX, KIAA1375) in human. PDCD6IP is a multifunctional protein that interacts with PDCD6 in a calcium-dependent manner. It is involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. It is a class E VPS protein that is involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. It also serves as an adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. It is reported to play a role in the regulation of both apoptosis and cell proliferation and its overexpression blocks apoptosis. Three isoforms of PDCD6IP have been described that are produced by alternative splicing.
Specificity
Clone 12H2.1 detects Programmed cell death 6-interacting protein in human cells. It targets an epitope within 126 amino acids from the C-terminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 126 amino acids from human Programmed cell death 6-interacting protein (PDCD6).ApplicationAnti-PDCD6-interacting protein, clone 12H1.2, Cat. No. MABT1229 is a mouse monoclonal antibody that detects Programmed cell death 6-interacting protein and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Western Blotting Analysis: 1 µg/mL from a representative lot detected PDCD6-interacting protein in Jurkat cell lysate.
Immunohistochemistry Analysis: A 1:2,000 dilution from a representative lot detected PDCD6-interacting protein in human pancreas, human prostate cancer, and human cervical cancer tissues.
Quality
Evaluated by Western Blotting in TF-1 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected PDCD6-interacting protein in TF-1 cell lysate.
Target description
~96 kDa observed; 96.02 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 12H2.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_037506, UniProt accession no. Q8WUM4, shipped in ambient Gene Information human ... PDCD6IP(10015)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-PDE6a Antibody, clone 7A11.1
eCl@ss: 32160702
Кат. номер MABN2250-25UG MABN2250-100UG General descriptionRod cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha (UniProt: P16499; also known as EC: 3.1.4.35, cGMP-PDE alpha, PDE V-B1) is encoded by the PDE6A (also known as PDEA) gene (Gene ID: 5145) in human. cGMP-PDE alpha is expressed in cells of the retinal rod outer segment. cGMP-PDE participates in processes of transmission and amplification of the visual signal. This holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by cGMP-PDE alpha, cGMP hydrolysis, and guanylate cyclase cGMP synthesis. cGMP-PDE alpha has five metal ion binding sites that bind two divalent metal cations per subunit. Site 1 preferentially binds zinc ions, while site 2 has a preference for magnesium and/or manganese ions. cGMP-PDE alpha has two GAF domains (aa 73-222 GAF1 and aa 254-431 GAF2). Mutations in PDE6A gene have been linked to retinitis pigmentosa that is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors.
Specificity
Clone 7A11.1 is a mouse monoclonal antibody that specifically detects Rod cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha (cGMP-PDE alpha) in human retinal tissue. It targets an epitope within 77 amino acids from the N-terminal region.ImmunogenGST/His-tagged recombinant fragment corresponding to 77 amino acids from the N-terminal region of human Rod cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha (cGMP-PDE alpha).ApplicationAnti-PDE6a, clone 7A11.1, Cat. No. MABN2250, is a highly specific mouse monoclonal antibody that targets cGMP-PDE alpha and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in human retinal tissue lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected PDE6a in Human retinal tissue lysate.
Target description
~100 kDa observed; 99.55 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 7A11.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_000431, UniProt accession no. P16499,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PDGF-C (GFD)
eCl@ss: 32160702
Кат. номер ABC1392-25UG ABC1392-100UG General descriptionPlatelet-derived growth factor C (UniProt: Q9NRA1; also known as PDGF-C, Fallotein, Spinal cord-derived growth factor, SCDGF, VEGF-E) is encoded by the PDGFC (also known as SCDGE, UNQ174/PRO200) gene (Gene ID: 56034) in human. PDGF-C is a disulfide-linked homodimeric growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. It also plays an important role in wound healing and angiogenesis. It also serves as a potent mitogen and chemoattractant for cells of mesenchymal origin. It is synthesized with a signal peptide (aa 1-22), which is subsequently cleaved off in the mature form. Its CUB domain is localized to amino acids 46 to 163 and proteolytic removal of the CUB domain is essential for unmasking the receptor-binding epitopes of the core domain. PDGF-C is expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract. Highly expressed in retinal pigment epithelia. Its high expression is also reported in retinal pigment epithelia. In the kidney, it is constitutively expressed in parietal epithelial cells of Bowmans capsule, tubular epithelial cells, and in arterial endothelial cells. Higher levels of PDGF-C and have been reported in the malignant breast tumor microenvironment. In MCF-7 cells increased expression of PDGF-C is reported to enhance cell proliferation and tumor cell motility. Tissue plasminogen activator and matriptase are shown to process PDGF-C in MCF-7 cells to its active form. (Ref.: Hurst, NJ., et al. (2012). Biochem. J. 441(3); 909-918; Lei, H., and Kazlauskas, A (2008). Exp. Eye Res. 86(5); 711-712).
Specificity
This rabbit polyclonal antibody detects full length platelet derived growth factor C (PDGF-C) and also the 18 kDa growth factor domain.ImmunogenA linear peptide corresponding to 21 amino acids from the C-terminal growth factor domain of human Platelet-derived growth factor C (PDGF-C).
Epitope: C-terminusApplicationAnti-PDGF-C, Cat. No. ABC1392, is a rabbit polyclonal antibody that detects Platelet-derived growth factor C and has been tested for use in Western Blotting.
Research Category
Signaling
Western Blotting Analysis: A representative lot detected PDGF-C in Western Blotting applications (Hurst, N.J., et. al. (2012). Biochem J. 441(3):909-18).
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected PDGF-C in HEK293T cells. (Courtesy of Hyeong-Reh Choi Kim lab at Wayne State University).
Quality
Evaluated by Western Blotting in HEK293T cells.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected PDGF-C in lysates from HEK293T cells.
Target description
~48 kDa observed; 39.03 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in PBS with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human species reactivity (predicted by homology) monkey (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG NCBI accession no. NP_057289, UniProt accession no. Q9NRA1, Gene Information human ... PDGFC(56034)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PDGF-D
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABC1451-25UG ABC1451-100UG General descriptionPlatelet-derived growth factor D (UniProt: Q9GZP0; also known as PDGF-D, Iris-expressed growth factor, Spinal cord-derived growth factor B, SCDGF-B) is encoded by the PDGFD (also known as IEGF, SCDGFB, MSTP036, UNQ1899/PRO4345) gene (Gene ID: 80310) in human. Four PDGF ligands known as PDGF-A, PDGF-B, PDGF-C, and PDGF-D have been described that exert their effect by binding to their cognate receptors. PDGF-D is expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen, and colon. PDGF-D is synthesized with a signal peptide (aa 1-18), which is subsequently removed. The latent form of PDGF-D contains a CUB domain at its N-terminal region, a growth factor domain and a hinge region in between. The latent form is activated by the proteolytic action of matriptase that removes the CUB domain, which results in unmasking of the receptor-binding epitopes on the core domain. YR247GR249S within the PDGF-D hinge region is shown to be the cleavage site for removal of the inhibitory CUB domain. PDGF-D plays an important role in wound healing and induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. PDGF-D also induces cellular transformation and promotes tumor growth by accelerating the proliferation rate of tumor cells and by stimulation of tumor neovascularization. (Ref.: Huang, W., and Kim, H-R, C (2015). J. Biol. Chem. 290(14); 9162-9170).
Specificity
This rabbit polyclonal antibody detects Platelet-derived growth factor D in human cells. It targets an epitope within the growth factor domain from the C-terminal half.ImmunogenA linear peptide corresponding to 18 amino acids from the C-terminal half of human Platelet-derived growth factor D.ApplicationAnti-PDGF-D, Cat. No. ABC1451, is a rabbit polyclonal antibody that detects Platelet-derived growth factor D in human cells and has been tested for use in Western Blotting.
Western Blotting Analysis: A representative lot detected PDGF-D in human recombinant-PDGF D (Huang, W., et. al. (2015). J Biol Chem. 290(14):9162-70) and LNCaP cells expressing PDGF-D, BS-C-1 cells transfected with the plasmid pTF7-PDGF D:HIS, recombinant PDGF-D (Ustach, C.V., et. al. (2004). Cancer Res. 64(5):1722-9).
Western Blotting Analysis: A representative lot detected PDGF-D in PBS exchanged condition media collected from LNCaP cells transfected with PDGF-D expression vector (Courtesy of Hyeong-Reh Choi Kim lab at Wayne State University).
Quality
Evaluated by Western Blotting condition media collected from LNCaP cells transfected with PDGF-D expression vector.
Western Blotting Analysis: 2 µg/mL of this antibody detected PDGF-D in PBS exchanged condition media collected from LNCaP cells transfected with PDGF-D expression vector.
Target description
~90 kDa Full Length PDGF D dimer, ~52 kDa PDGF D hemi-dimer,~32 kDa growth factor dimer in the non-reducing conditions; 42.85 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in PBS (pH 7.4) with 0.09% sodium azide.
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity human species reactivity (predicted by homology) rabbit (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG NCBI accession no. NP_079484, UniProt accession no. Q9GZP0, Gene Information human ... PDGFD(80310)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PDGFR Antibody
eCl@ss: 32160702
Кат. номер 7-276-25UL 7-276 7-276-100UL General descriptionPlatelet derived growth factor receptor (PDGF Receptor) is a transmembrane glycoprotein of 170-185 kDa which undergoes homo or heterodimerization into complexes of alpha and beta subunits upon ligand binding, depending on the isoform of PDGF (PDGF AA, BB or AB) that binds. The phosphorylation of tyrosine residues in the now activated receptor can control multiple signaling events such as actin reorganization, transcription, cell growth, migration and differentiation, and also lead to activation of the Ras, Raf and ERK 1 and 2 pathway.
Specificity
Recognizes PDGF Receptor alpha.Immunogenpeptide corresponding to amino acids 1035-1053 (C-GKRNRHSSQTSEESAIETG) of human PDGF Receptor αApplicationDetect PDGFRα using this Anti-PDGFRα Antibody validated for use in IP & WB.
Research Sub Category
Growth Factors & Receptors
Research Category
Signaling
Quality
routinely evaluated by immunoblot on 3T3/NIH cell lysate
Target description
150/170 kDa (doublet)
Physical form
Protein A Purified immunoglobulin in 0.14 M Tris-glycine, pH 7.4, 0.105 M NaCl, 0.035% sodium azide as a preservative.
ImmunoAffinity Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Analysis Note
Control
HeLa cells, extracts from 3T3/NIH or HepG2 cells, human brain tissueOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity mouse, human packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NM_011058, UniProt accession no. P16234, shipped in ambient Gene Information human ... PDGFRA(5156) Узнать цену -
Anti-PDGFR Antibody, clone CH-3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-1135-25UG 5-1135 5-1135-100UG General descriptionPDGFR (Platelet-Derived Growth Factor Receptor) is a receptor tyrosine kinase for the PDGF family of growth factors. PDGF homo and hetero- dimmers (dimer of A (17 kDa) and B (14 kDa) chains (AA, AB, or BB)) bind to the two structurally related a and b PDGF Receptors (PDGFRa and PDGFRb). The type A PDGF Receptor binds all three PDGFs with high affinity, whereas the type B PDGF Receptor is selective for PDGF-BB. This binding results in the dimerization of the receptor and the subsequent kinase activation of the receptor tyrosine kinase (RTK) and its autophosphorylation. These phosphorylations allow for various proteins, such as PI3 Kinase, PLCg, and Grb2, to bind through their SH2 domains and transduce signals into the cell. The activation of PDGFFR triggers the intracellular loop and activates Ras, Erk1/2, and ROS. PDGFb has been implicated in embryonic development, angiogenesis, and development of tumors of glial origin.ImmunogenRecombinant Platelet-Derived Growth Factor ReceptorApplicationELISA: A previous lot of this antibody was used in ELISA.
Immunohistochemistry(paraffin): Representative images from a previous lot.
Optimal Staining of PDGF-A With Citrate pH 6.0 Epitope Retrieval: Rat Brain
Research Sub Category
Growth Factors & Receptors
This Anti-PDGFR Antibody, clone CH-3 is validated for use in WB, ELISA, IH(P) for the detection of PDGFR.
Research Category
Signaling
Apoptosis & Cancer
Quality
Routinely evaluated by Western Blot on Jurkat lysates.
Western Blot Analysis: 1:500 dilution of this lot detected PDGFR on 10 µg of Jurkat lysates.
Target description
211 amino acids; 24043 DaLinkageReplaces: 04-397
Physical form
Purified mouse monoclonal IgG1 in buffer containing 20 mM sodium phosphate, 250 mM NaCl, 0.1% NaN3, pH. 7.6
Format: Purified
Protein A purified
Storage and Stability
Maintain at + 2-8 ° C in undiluted aliquots for up to 1 year from date of receipt.
Analysis Note
Control
Jurkat cell lysateOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone CH-3, monoclonal species reactivity human, mouse species reactivity (predicted by homology) rat packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 UniProt accession no. P09619, shipped in ambient Узнать цену -
Anti-PEG Antibody, clone 6.3
eCl@ss: 32160702
Кат. номер MABS1966-25UG MABS1966-100UG General descriptionPolyethylene glycols (PEG) are non-toxic, uncharged, hydrophilic long chain polymers with a big exclusion volume in aqueous solution. The covalent attachment of PEG is commonly employed to modify proteins and drugs that can increase their bioavailability and reduce immunogenicity and proteolytic degradation. Clone 6.3 displays high affinity and binds the PEG backbone and can be employed as a detection antibody for the quantification of PEG. It binds to a smaller epitope of the PEG backbone when compared to other antibodies. Since it binds to a smaller PEG epitope (~750 Da), it is not compatible with detergents that contain an ethylene oxide backbone, such as Tween 20. Instead 0.05% CHAPS is a more suitable detergent when using this antibody.
Specificity
Clone 6.3 specifically detects proteins conjugated with polyethylene glycol (PEG).ImmunogenPEG-conjugated to E.coli beta-glucuronidase.ApplicationResearch Category
Signaling
Anti-PEG, clone 6.3, Cat. No. MABS1966, is a mouse monoclonal antibody that detects PEG-conjugated proteins and it hs been tested for use in ELISA.
ELISA Analysis: A representative lot detected PEG in ELISA applications (Tung, H.Y., et. al. (2015). Mol Cancer Ther. 14(6):1317-26).
Quality
Evaluated by ELISA in Immobilized PEG (10K-PEG, 3K-PEG, and 2K-mPEG).
ELISA Analysis: 5 µg/mL of Immobilized PEG (10K-PEG, 3K-PEG, and 2K-mPEG) were detected with this antibody.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS with 0.04% sodium azide.
Format: Purified
Protein A purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 6.3, monoclonal species reactivity (predicted by homology) all packaging antibody small pack of 25 μg application(s) ELISA: suitable isotype IgG1κ
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Perilipin A Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер AB10200-25UG AB10200 General descriptionPerilipin A is the predominant isoform of perilipins a family of proteins which are the most abundant proteins at the surfaces of lipid droplets in adipocytes and are also found in steroidogenic cells.ImmunogenBovine Perilipin AApplicationDetect Perilipin A using this Anti-Perilipin A Antibody validated for use in WB.
Suggested dilutions:
Western Blot: 0.1-0.2 µg/mL
Research Category
Metabolism
Research Sub Category
Lipid Metabolism & Weight Regulation
Quality
Routinely evaluated by immunoblot.
Target description
64kDa
Physical form
Purified immunoglobulin presented as a liquid in 0.1 M Na-Phosphate buffer, pH 7.0 containing protease free bovine serum albumin.
Format: Purified
Storage and Stability
Maintain frozen at -20C in undiluted aliquots for up to 12 months from date of receipt. Avoid repeated freeze-thaw cycles.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified immunoglobulin antibody product type primary antibodies clone polyclonal species reactivity mouse, bovine packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) western blot: suitable NCBI accession no. NM_002666.3, UniProt accession no. O60240, shipped in dry ice storage temp. 20°C
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Peripherin-2 Antibody, clone 5H2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABN2435 MABN2435-25UG General descriptionPeripherin-2 (UniProt: P17810; also known as Retinal degeneration slow protein) is encoded by the PRPH2 (also known as RDS) gene in bovine species. Peripherin-2 is a disulfide-linked homodimeric, multi-pass membrane protein that may function as an adhesion molecule involved in stabilization and compaction of outer segment disks in retina and is considered to be essential for disk morphogenesis. It is exclusively expressed in outer segments. Peripherin-2 can form homo- and heteromeric protein complexes in outer segment. The core homomeric peripherin-2 unit is the non-covalent tetramer, which can also assemble into covalently linked octamers and higher-order oligomers. The homomeric peripherin-2 complexes are essential for proper outer segment morphology and architecture. Peripherin-2 is also shown to form heteromeric complexes with its homolog ROM-1. Mutations in PRPH2 gene can lead to autosomal dominant retinitis pigmentosa (adRP) And a majority of these mutations are located within the large loop domain connecting the transmembrane domain 3 and 4 (Ref.: Bohm, S et al. (2017). Scientific Reports 7, Article number: 2321).
Specificity
Clone 5H2 detects Peripherin-2 in bovine and mouse retina.ImmunogenPurified bovine whole peripherin.
Epitope: C-terminusApplicationAnti-Peripherin-2, clone 5H2, Cat. No. MABN2435, is a highly specific mouse monoclonal antibody that targets Peripherin-2 and has been tested in Immunofluorescence, Radioimmunoassay, and Western Blotting.
Research Category
Neuroscience
Western Blotting Analysis: A representative lot detected Peripherin-2 in Western Blotting applications (Connell, G., et. al. (1991). Proc Natl Acad Sci USA. 88(3):723-6; Zhang, Y., et. al. (2009). J Cell Sci. 122(Pt 8):1192-200).
Radioimmunoassay Analysis: A representative lot detected Peripherin-2 in Radioimmunoassay applications (Connell, G., et. al. (1991). Proc Natl Acad Sci USA. 88(3):723-6).
Immunofluorescence Analysis: A representative lot detected Peripherin-2 in Immunoflourescence applications (Zhang, Y., et. al. (2009). J Cell Sci. 122(Pt 8):1192-200).
Quality
Evaluated by Western Blotting in bovine retinal tissue lysate.
Western Blotting Analysis: 4 µg/mL of this antibody detected Peripherin-2 in 10 µg of bovine retinal tissue lysate.
Target description
~39 kDa observed; 38.99 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5H2, monoclonal species reactivity bovine, mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","radioimmunoassay: suitable","western blot: suitable isotype IgG1 UniProt accession no. P17810, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Peroxiredoxin 6 (N-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер P0050-25UL P0050-200UL General descriptionPeroxiredoxin 6 (1-Cys peroxiredoxin), is a member of the thiol-specific antioxidant peroxiredoxin family. Six mammalian peroxiredoxins have been identified. Peroxiredoxin 6 is the only one that contains a single redox-active cysteine and uses glutathione to catalyze the reduction of H2O2 and other organic peroxides. It is expressed in all tissues with the highest levels in the lung.ApplicationThe antibody has been used in several immunochemical techniques including immunoblotting and immunoprecipitation.
Biochem/physiol Actions
Peroxiredoxins are peroxidases, with the use of reducing equivalents provided by thiol-containing proteins that reduce hydrogen peroxide (H2O2) to water and alkyl hydroperoxides to alcohol. Peroxiredoxin 6 is a bifunctional enzyme with peroxidase and phospholipase A2 activities. Overexpression of peroxiredoxin 6 in cells protects them against oxidative damage, whereas knockdown of this enzyme results in oxidative stress and apoptosis. The phospholipase A2 activity plays an important role in surfactant homeostasis. Peroxiredoxin 6 is a major antioxidant enzyme which functions in antioxidant defense and lung phospholipid metabolism.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~25 kDa species reactivity mouse, rat, human packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunoprecipitation (IP): 5-10 µg using lysate of mouse brain","western blot: 2-5 µg/mL using whole extract of human HeLa cells","western blot: 5-10 µg/mL using whole extract of rat liver conjugate unconjugated UniProt accession no. P30041, shipped in dry ice storage temp. 20°C Gene Information human ... PRDX6(9588)
mouse ... Prdx6(11758)
rat ... Prdx6(94167)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PGAP1 antibody produced in rabbit
Human Protein Atlas Number: HPA069704 Human Protein Atlas characterization data
Кат. номер HPA069704-100UL HPA069704-25UL Immunogenpost-GPI attachment to proteins 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88241,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST conjugate unconjugated UniProt accession no. Q75T13, shipped in wet ice storage temp. 20°C Gene Information human ... PGAP1(80055)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PGC-1 alpha
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE868 ABE868-25UG General descriptionPeroxisome proliferator-activated receptor gamma coactivator 1-alpha (UniProt: O70343; also known as PGC-1-alpha, PPAR-gamma coactivator 1-alpha, PPARGC-1-alpha) is encoded by the Ppargc1a (also known as Pgc1, Pgc1a, Ppargc1) gene (Gene ID: 19017) in murine species. PGC-1 alpha is a member of a family of transcription coactivators that plays a central role in the regulation of cellular energy metabolism. It is a homooligomeric transcriptional coactivator for steroid receptors and nuclear receptors that greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. It is expressed in muscles, liver, kidney, brown adipose tissue, heart, and brain. It can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis and is also reported to play an essential role in metabolic reprogramming in response to dietary availability through coordination of the expression of a wide array of genes involved in glucose and fatty acid metabolism. PGC-1 alpha is known to induce the expression of PPARGC1- and ESRR-induced regulator, muscle 1 (PERM1) in the skeletal muscle in an estrogen-related receptors, -alpha (ESRRA)-dependent manner. PGC-1 alpha is significantly induced in brown adipose tissue and skeletal muscle by exposure to cold and is also shown to be up-regulated in brown adipose tissue of obese leptin-deficient (ob/ob) and leptin-unresponsive (db/db) mice. PGC-1 alpha is also required for oscillatory expression of clock genes, such as ARNTL/BMAL1 and NR1D1, through the co-activation of RORA and RORC, and metabolic genes, such as PDK4 and PEPCK.
Specificity
This rabbit polyclonal antibody detects PGC-1 alpha in human and murine adipose tissue. it targets an epitope within 21 amino acids from the C-terminus region.ImmunogenKLH-conjugated linear peptide corresponding to 21 amino acids from the C-terminus region of murine PPAR-gamma coactivator 1-alpha.
Epitope: C-terminusApplicationResearch Category
Epigenetics & Nuclear Function
Anti-PGC-1 alpha, Cat. No. ABE868, is a highly specific rabbit polyclonal antibody that targets Peroxisome proliferator-activated receptor gamma coactivator 1-alpha and has been tested for use in Immunocytochemistry and Western Blotting.
Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected PGC-1 alpha in A431, HUVEC, and NIH/3T3 cells.
Quality
Evaluated by Western Blotting in human brown adipose tissue lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected PGC-1 alpha in 10 µg of human brown adipose tissue lysate.
Target description
~100 kDa observed; 90.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human, mouse species reactivity (predicted by homology) bovine (based on 100% sequence homology), porcine (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable NCBI accession no. NP_032930.1, UniProt accession no. O70343, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-PGM5 (Aciculin) Antibody, clone 14F8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT1503-100UG MABT1503-25UG General descriptionPhosphoglucomutase-like protein 5 (UniProt: Q15124; also known as Aciculin, Phosphoglucomutase-related protein, PGM-RP) is encoded by the PGM5 (also known as PGMRP) gene (Gene ID: 5239) in human. Aciculin is a dystrophin and utrophin-binding protein that is highly homologous to the glycolytic enzyme phosphoglucomutase type 1. However, it lacks phosphoglucomutase activity. Aciculin is a component of adherens-type cell-cell and cell-matrix junctions and is concentrated in focal contacts at the ends of actin bundles and associates with actin filaments. Aciculin is also reported to be an interaction partner of Filamin C and Xin proteins. Higher levels of Aciculin are reported in smooth and cardiac muscle and lower levels are present in skeletal muscle, liver, kidney and brain tissue. In striated muscle, it mainly localizes to the intercalated discs of the heart and to myotendinous junctions. Low levels of Aciculin are expressed in 10-12-week-old fetus and these levels increase progressively into infancy reaching maximum levels at maturity. Two isoforms of Aciculin have been reported that are produced by alternative splicing. Aciculin knockdown in myotubes is shown to cause failure in myofibril assembly, alignment and membrane attachment, and a massive reduction in myofibril number. (Ref.: Molt, S., et al., (2014). J. Cell Sci.127(16); 3578-3592).
Specificity
Clone 14F8 detects Phosphoglucomutase-like protein 5 in mouse and rat cardiac tissue and is predicted to react with human.ImmunogenCytoskeletal fraction of the human myometrium tissue extract.ApplicationResearch Category
Cell Structure
Western Blotting Analysis: 1 µg/mL from a representative lot detected PGM5 (Aciculin) in rat heart tissue lysate.
Immunoprecipitation Analysis: A representative lot immunoprecipitated PGM5 (Aciculin) in Immunoprecipitation applications (Belkin, A.M., et. al. (1995). J Biol Chem. 270(11):6328-37; Belkin, A.M., et. al. (1995). Exp Cell Res. 221(1):132-40).
Immunofluorescence Analysis: A representative lot detected PGM5 (Aciculin) in Immunofluorescence applications (Belkin, A.M., et. al. (1994). J Cell Sci. 107 ( Pt 7):1993-2003).
Immunohistochemistry Analysis: A representative lot detected PGM5 (Aciculin) in Immunohistochemistry applications (Belkin, A.M., et. al. (1995). Exp Cell Res. 221(1):132-40).
Western Blotting Analysis: A representative lot detected PGM5 (Aciculin) in Western Blotting applications (Belkin, A.M., et. al. (1995). J Biol Chem. 270(11):6328-37; Belkin, A.M., et. al. (1994). J Cell Sci. 107 ( Pt 7):1993-2003).
ELISA Analysis: A representative lot detected PGM5 (Aciculin) in ELISA applications (Molt, S., et. al. (2014). J Cell Sci. 127(Pt 16):3578-92).
Anti-PGM5 (Aciculin), clone 14F8, Cat. No. MABT1503, is a mouse monoclonal antibody that detects Phosphoglucomutase-like protein 5 and has been tested for use in ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in mouse heart tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected PGM5 (Aciculin) in mouse heart tissue lysate.
Target description
~57 kDa observed; 62.22 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 14F8, monoclonal species reactivity human, rat, rabbit, bovine, mouse species reactivity (predicted by homology) porcine, frog, avian packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_068800, UniProt accession no. Q15124, Gene Information human ... PGM5(5239)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PHD finger protein 14 (PHF14)
eCl@ss: 32160702
Кат. номер ABE1359-25UL ABE1359-100UL General descriptionPHD finger protein 14 (UniProt: O94880) is encoded by the PHF14 (also known as KIAA0783) gene (Gene ID: 9678) in human. PHF14 is a member of the PHD finger protein family that serves as a chromatin-binding protein. It contains four putative PHD fingers, two coiled-coil regions, and four zinc fingers. PHF14 is highly conserved from C. elegans to humans and is considered as a transcriptional regulator of target gene expression. PHF14 has been identified as a regulator of mesenchyme growth in embryonic tissues. Two isoforms of PHF14 have been described that are produced by alternative splicing. PHF14 interacts with histones via its PHD1 and PHD3 domains indicating its role in epigenetic regulation. It is involved in chromatin-mediated transcriptional regulation and chromatin dynamics. During cell division, PHF14 is shown to be directly bound to and co-localized with KIF4A to form a functional complex. PHF14 is shown to be overexpressed in lung cancer and this overexpression is associated with poor prognosis of non-small cell lung carcinoma. (Ref.: Zhang, L., et al. (2017). Oncotarget. 8(12); 19684-19698; Yang, B., et al. (2017). Sci Rep. 7; 39888).
Specificity
This rabbit polyclonal antibody detects PHD Finger Protein 14 in human cells. It targets an epitope within 16 amino acids from the N-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids from the N-terminal half of human PHD finger protein 14.ApplicationAnti-PHD finger protein 14 (PHF14) Antibody, Cat. No. ABE1359, is a highly specific rabbit polyclonal antibody that detects PHD finger protein 14 and has been tested for use in Immunocytochemistry and in Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected PHD finger protein 14 (PHF14) in HeLa cells.
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected PHD finger protein 14 (PHF14) in HEK293 cell lysate.
Target description
100.0 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","western blot: suitable NCBI accession no. NP_055475.2, UniProt accession no. O94880, Gene Information human ... PHF14(9678)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-PHF1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE863 ABE863-25UL General descriptionInformation PHD finger protein 1 (UniProt: O43189; also known as PHF1, hPHF1, Polycomb-like protein 1, hPCl1) is encoded by the PHF1 (also known as PCL1) gene (Gene ID: 5252) in human. PHF1 is a member of the polycomblike family and contains two PHD-type zinc fingers (aa 87-142 and 186-240) and one Tudor domain (aa 29-86). It is essential for epigenetic regulation and genome maintenance. It specifically binds histone H3 trimethylated at Lys-36 (H3K36me3) via its Tudor domain and recruits the PRC2 complex. PHF1 is highly expressed in heart, skeletal muscle, and pancreas, with lower levels found in brain, placenta, lung, liver and kidney. It is involved in DNA damage response and is recruited at double-strand breaks. PHF1 localizes to the promoters of numerous target genes and to double-strand breaks (DSBs) sites following DNA damage. It has been reported that PRC2 recruitment by PHF1 promotes H3K27me3 and subsequent gene silencing by inducing spreading of PRC2 and H3K27me3 into H3K36me3 loci. A chromosomal aberration involving PHF1 is reported to be the causative factor in endometrial stromal tumors. (Ref.: Sarma, K et al. (2008). Mol. Cell. Biol. 28(8): 2718-31; Musselman, CA et al (2012). Nat. Struct. Mol. Biol. 19(12):1266-72).
Specificity
This rabbit polyclonal antibody detects Information PHD finger protein 1 (PHF1) in human cells. It targets an epitope within 137 amino acids from the internal region.ImmunogenGST-tagged recombinant fraction corresponding to 137 amino acids from the internal region of human PHD finger protein 1.ApplicationAnti-PHF1, Cat. No. ABE863, is a highly specific rabbit polyclonal antibody that targets PHD finger protein 1 and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected PHF1 in human pancreas and human kidney tissues.
Western Blotting Analysis: A 1:500 dilution from a representative lot detected PHF1 in 10 µg of HeLa cell lysate.
Quality
Evaluated by Western Blotting in HeLa cell nuclear extract.
Western Blotting Analysis: A 1:500 dilution of this antibody detected PHF1 in 10 µg of HeLa cell nuclear extract.
Target description
~65 kDa observed; 62.11 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_002627.1, UniProt accession no. O43189, shipped in ambient Gene Information human ... PHF1(5252)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho 4E-BP1 (Ser83) ABE2889-25UL
eCl@ss: 32160702 General descriptionEukaryotic translation initiation factor 4E-binding protein 1 (UniProt: Q13541; also known as 4E-BP1, eIF4E-binding protein 1, Phosphorylated heat- and acid-stable protein regulated by insulin 1, PHAS-I) is encoded by the EIF4EBP1 gene (Gene ID: 1978) in human. 4E-BP1 is a repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex. It mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. 4E-BP1 is phosphorylated on serine and threonine residues in response to insulin, EGF, and PDGF. Non-phosphorylated 4E-BP1 bind strongly to eIF4E; however, phosphorylated 4E-BP1 does not bind to eIF4E. 4E-BP1 is reported to act as an inhibitory factor of tumor cells survival and proliferation because of its role as a negative regulator of cap-dependent translation. Although 4E-BP1 serves as a well-characterized substrate of mTORC1, an mTOR-independent phosphorylation of 4E-BP1 has been also been suggested to be associated with the mTOR kinase inhibitor resistance in cancer cells. (Ref.: Shang, ZF et al (2012). Cell Cycle 11(18): 3463 3471).
Specificity
This rabbit polyclonal antibody targets the Eukaryotic translation initiation factor 4E-binding protein 1. It targets an epitope within 13 amino acids surrounding phospho serine 83.ImmunogenEpitope: unknown
A linear peptide corresponding to 13 amino acids surrounding phospho serine 83 from human Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1).ApplicationAnti-phospho 4E-BP1 (Ser83), Cat. No. ABE2889, is a highly specific rabbit polyclonal antibody that targets Eukaryotic translation initiation factor 4E-binding protein 1 phosphorylated at Ser83. It has been testedfor use in Flow Cytometry, Immunocytochemistry, Immunofluorescence, & Western Blotting.
Immunohistochemistry Analysis: A 1:200 dilution from a representative lot detected phospho 4E-BP1 (Ser83) in FFPE MCC tissue (Courtesy of Dr. Yuan Chang at University of Pittsburgh).
Flow Cytometry Analysis: A representative lot detected phospho 4E-BP1 (Ser83) in Nocodazole-arrested HeLa cells (Velasquez, C., et. al. (2016). Proc Natl Acad Sci USA. 113(30):8466-71).
Immunocytochemistry Analysis: A representative lot detected phospho 4E-BP1 (Ser83) in HEK293 and U2OS cells (Velasquez, C., et. al. (2016). Proc Natl Acad Sci USA. 113(30):8466-71).
Western Blotting Analysis: A representative lot detected phospho 4E-BP1 (Ser83) in Nocodazole-arrested HeLa cells, GST-4E-BP1 treated with mitotic HeLa lysate (Velasquez, C., et. al. (2016). Proc Natl Acad Sci USA. 113(30):8466-71).
Western Blotting Analysis: A representative lot detected phospho 4E-BP1 (Ser83) in Hela cells treated with Nocodazole (Courtesy of Dr. Yuan Chang at University of Pittsburgh).
Immunofluorescence Analysis: A 1:500 dilution from a representative lot detected phospho 4E-BP1 (Ser83) in FFPE MCC tissue (Courtesy of Dr. Yuan Chang at University of Pittsburgh).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HeLa cells treated with Nocodazole.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected phospho 4E-BP1 (Ser83) in lysate from HeLa cells treated with Nocodazole (100 ng/mL).
Target description
~19 kDa observed; 12.58 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Rabbit polyclonal antiserum with 0.02% sodium azide and 50% glycerol.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other Notesfeature_concentration_valuePlease refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable","immunocytochemistry: suitable","immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_004086, UniProt accession no. Q13541, shipped in ambient Gene Information human ... EIF4EBP1(1978)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho AEP (Ser226)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN2270-25UG ABN2270-100UG General descriptionLegumain (UniProt: Q99538; also known as EC: 3.4.22.34, Asparaginyl endopeptidase, AEP, Protease cysteine 1, Delta Secretase) is encoded by the LGMN (also known as PRSC1) gene (Gene ID: 5641) in human. AEP is a lysosomal endopeptidase that displays strict specificity for the hydrolysis of asparaginyl bonds and can simultaneously cleave both amyloid precursor protein (APP) and tau. It cleaves aspartyl bonds slowly, especially under acidic conditions. AEP is synthesized with a signal peptide (aa 1-17) and a propeptide (aa 324-433) that are cleaved off in the mature form. It exists a homodimer before removal of the propeptide and after autocatalytic processing exists as a monomer. In its zymogen form, the uncleaved propeptide blocks access to the active site. AEP is phosphorylated on serine 226 by serine-arginine protein kinase 2 (SRPK2), which accelerates its autocatalytic cleavage and enhances its enzymatic activity. The active form translocates to cytoplasm. In Alzheimer s disease brains AEP is reported to be highly phosphorylated. Depletion of AEP is shown to reduce amyloid peptide production and senile plaque formation in 5XFAD mouse brain that leads to restoration of synaptic activity and cognitive function. Three isoforms of AEP have been described that are produced by alternative splicing. (Ref.: Wang Z-H., et al. (2017). Mol. Cell 67(5); 812-825; Zhang, Z et al (2015). Nat. Commun. 6; p. 9762).
Specificity
This rabbit polyclonal antibody specifically detects Asparaginyl endopeptidase phosphorylated on Serine 226.ImmunogenKLH-conjugated linear peptide corresponding to 13 amino acids surrounding phosphoserine 226 of human Asparaginyl endopeptidase (AEP).
Epitope: unknownApplicationAnti-phospho AEP (Ser226), Cat. No. ABN2270, is a highly specific rabbit polyclonal antibody that targets Asparaginyl endopeptidase (AEP) and has been tested in Immunofluorescence, serine-arginine protein kinase 2 (SRPK2) Assay, and Western Blotting.
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected phospho AEP (Ser226) in lysates from HEK293 cells co-transfected mammalian GST-tagged (mGST) AEP and wild-type (WT) SRPK2. (Courtesy of Keqiang Ye, Ph.D., Professor, Emory University School of Medicine, Department of Pathology and Laboratory Medicine).
Immunofluorescence Analysis: A representative lot detected phospho AEP (Ser226) in Immunofluorescence applications (Wang, Z.H., et. al. (2017). Mol Cell. 67(5):812-825).
Kinase Assay: A representative lot detected phospho AEP (Ser226) in HEK293 cells treated with SRPK2 and in vitro kinase assays (Wang, Z.H., et. al. (2017). Mol Cell. 67(5):812-825).
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in HEK293 cells co-transfected with mammalian GST-tagged (mGST) AEP and with either wild-type (WT) or kinase-dead (KD) SRPK2.
Western Blotting Analysis: A 1:500 dilution of this antibody detected phospho AEP (Ser226) in lysates from HEK293 cells co-transfected mammalian GST-tagged (mGST) AEP and wild-type (WT) SRPK2, but not in cells co-transfected with knockdown (KD) SRPK2.
Target description
~73 kDa observed; 49.41 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in PBS with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µg application(s) activity assay: suitable","immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_005597, UniProt accession no. Q99538, Узнать цену -
Anti-phospho BAF60C (Ser247)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1298-100UL ABE1298-25UL General descriptionSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 (UniProt: Q6STE5; also known as 60 kDa BRG-1/Brm-associated factor subunit C, BRG1-associated factor 60C, BAF60C) is encoded by the SMARCD3 (also known as BAF60C) gene (Gene ID: 6604) in human. BAF60C plays a key role in ATP dependent nucleosome remodeling by SMARCA4 containing complexes. Two isoforms of BAF60C have been reported that are produced by alternative splicing. Both isoforms are expressed in brain, heart, kidney, placenta, prostate, salivary glands, spleen, testis, thyroid, trachea, and uterus. However, isoform 1 is expressed also in skeletal muscle and adipose tissue. BAF60C belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. BAF60C is also a component of nuclear Notch signaling and is required for the establishment of left-right asymmetry. Loss of BAF60C can lead to defects in the establishment of the left-right asymmetry cascade in mouse and zebrafish. It also serves a specific chromatin remodeling component for lipogenic gene transcription in liver. In response to insulin, it is phosphorylated at serine 247 by atypical PKC zeta//lambda, which causes translocation of BAF60C to the nucleus and allows a direct interaction of BAF60C with upstream stimulatory factor-1 (USF-1). (Ref.: Takeuchi, JK., et al. (2007). Proc. Natl. Acad. Sci. USA 104(3); 846-851; Wang, Y., et al. (2012). Mol. Cell 49(2); 283-297).
Specificity
This rabbit polyclonal antibody detects murine BAF60C phosphorylated on Serine 247.ImmunogenKLH-conjugated linear peptide corresponding to 9 amino acids surrounding phosphorylated serine 247 of human BAF60C. The immunogen is conserved between both isoforms.ApplicationAnti-phospho BAF60C (Ser247), Cat. No. ABE1298, is a highly specific rabbit polyclonal antibody that targets SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 (BAF60C) phosphorylatd on Serine 247 and has been tested for use in Peptide Inhibition & WB.
Peptide Inhibition Analysis: A 1:500 dilution from a representative lot was used with NIH3T3 Nuclear Extract for peptide block analysis.
Quality
Evaluated by Western Blotting in NIH3T3 Nuclear Extract.
Western Blotting Analysis: A 1:500 dilution of this antibody detected phospho BAF60C (Ser247) in NIH3T3 Nuclear Extract.
Target description
~55 kDa observed. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity mouse species reactivity (predicted by homology) bovine (based on 100% sequence homology), human (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) inhibition assay: suitable (peptide)","western blot: suitable NCBI accession no. NP_001003801.1, UniProt accession no. Q6STE5,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho Brd4 (Ser492/Ser494)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1453 ABE1453-25UL General descriptionBromodomain-containing protein 4 (UniProt O60885; also known as MCAP, Mitotic chromosome-associated protein, Protein HUNK1) is encoded by the BRD4 (also known as HUNK1, MCAP) gene (Gene ID 23476) in human. Bromodomain-containing protein 4 is a BET (bromodomain and extra-terminal) protein family member that functions as a chromatin reader by binding acetylated lysines in histones. It plays a key role in transmission of epigenetic memory across cell divisions and transcription regulation. It remains associated with acetylated chromatin throughout the entire cell cycle and provides epigenetic memory for post-mitotic G1 gene transcription by preserving acetylated chromatin status and maintaining high-order chromatin structure. During interphase, it plays a key role in regulating the transcription of signal-inducible genes by associating with the P-TEFb complex and recruiting it to promoters. Bromodomain-containing protein 4 is required to form the transcriptionally active P-TEFb complex where it displaces negative regulators such as HEXIM1 and 7SKsnRNA complex from P-TEFb and transforms it into an active form that can then phosphorylate the C-terminal domain of RNA polymerase II. It promotes the phosphorylation of Ser2 of the C-terminal domain of RNA polymerase II. In addition to acetylated histones, Bromodomain-containing protein 4 also recognizes and binds acetylated RELA, leading to further recruitment of the P-TEFb complex and subsequent activation of NF-kappa-B. It is also reported to act as a regulator of p53/TP53-mediated transcription and following phosphorylation by casein kinase 2K2, it is recruited to p53/TP53 specific target promoters. BRD4 knockout in mice is shown to be lethal, while BRD4 function blockage by inhibitor JQ1 (Cat. No. 500586) treatment is reported to affect the transcription of critical synaptic proteins, resulting in memory deficits and decreased seizure susceptibility in mice.
Specificity
This rabbit polyclonal antibody detects Bromodomain-conntaining protein 4 phosphorylated at Ser492/Ser494. It targets an epitope of 14 amino acids in the N-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids surrounding Ser492/Ser494 from the internal N-terminal half of human phospho Brd4 protein.ApplicationAnti-phospho Brd4 (Ser492/Ser494), Cat. No. ABE1453, is a highly specific rabbit polyclonal antibody that targets Bromodomain-containing protein 4 and has been tested in Dot Blot, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Research Category
Epigenetics & Nuclear Function
Western Blotting Analysis: A 1:500 dilution from a representative lot detected phospho Brd4 (Ser492/Ser494) in whole cell neuronal lysate (Courtesy of Erica Korb, Ph.D., Rockefeller University).
Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected phospho Brd4 (Ser492/Ser494) in cultured cortical cells from mouse (C47blac6). (Courtesy of Erica Korb, Ph.D., Rockefeller University).
Dot Blot Analysis: A representative lot detected phospho Brd4 (Ser492/Ser494) in phospho Brd4 peptides (Courtesy of Erica Korb, Ph.D., Rockefeller University).
Quality
Evaluated by Western Blotting in humans IPS cell lysate.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected phospho Brd44 (Ser492/Ser494) in 10 µg of human IPS cell lysate.
Target description
200 kDa observed, 152.22 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) porcine (based on 100% sequence homology), rat (based on 100% sequence homology), mouse (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) dot blot: suitable","immunocytochemistry: suitable","immunohistochemistry: suitable","western blot: suitable NCBI accession no. NP_490597, UniProt accession no. O60885, shipped in ambient Gene Information human ... BRD4(23476)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho DCC (Tyr1418)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABC1466-100UL ABC1466-25UL General descriptionNetrin receptor DCC (UniProt: Q63155; also known as Tumor suppressor protein DCC, Deleted in Colorectal Cancer) is encoded by the Dcc gene (Gene ID: 25311) in rat. Netrin receptor DCC is a single-pass type I membrane protein that serves as a receptor for netrin and is essential for axon guidance. In response to netrin-1 stimulation, DCC becomes a signaling platform to recruit proteins that promote axon outgrowth and guidance. It is detected in embryonic spinal cord, predominantly in axons of commissural neurons. Deficiencies in netrin-1 or DCC expression can result in the loss of cerebral and spinal commissures. Netrin receptor DCC also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand and has been implicated as a tumor suppressor gene. It is synthesized with a signal peptide (aa 1-25), which is subsequently cleaved off. It has four Ig-like C2-type domains and six fibronectin type-III domains. In response to netrin-1 stimulation DCC is phosphorylated on serine, threonine, and tyrosine residues. Its phosphorylation on Tyrosine 1418 by Src family kinases is shown to be essential for netrin-1 to mediate axon outgrowth and guidance. It has been reported that in response to netrin-1, p120RasGAP is recruited to DCC in growth cones and forms a multiprotein complex with focal adhesion kinase (FAK) and extracellular signal regulated kinase (ERK). Activities of both Ras and ERK as shown to be elevated in p120RasGAP deficient neurons. (Ref.: Antoine-Bertrand J., et al., (2016). J. Biol. Chem. 291(9):4589-602).
Specificity
This rabbit polyclonal antibody detects Netrin receptor DCC phosphorylalted on Tyrosine 1418 in rat cells. It targets an epitope within 15 amino acids from the C-terminal region.ImmunogenA linear peptide corresponding to 15 amino acids surrounding phospho-tyrosine 1418 from the C-terminal region of rat Netrin receptor DCC.
Epitope: C-terminusApplicationAnti-phospho DCC (Tyr1418), Cat. No. ABC1466, iis a rabit polyclonal antibody that detects Netrin receptor DCC and has been tested for use in Dot Blot, Immunofluorescence, and Western Blotting.
Dot Blot Analysis: A representative lot detected phospho DCC (Tyr1418) in Dot Blot applications (Antoine-Bertrand, J., et. al. (2016). J Biol Chem. 291(9):4589-602).
Immunofluorescence Analysis: A representative lot detected phospho DCC (Tyr1418) in Immunofluorescence applications (Plooster, M., et. al. (2017). Mol Biol Cell. 28(18):2374-2385).
Western Blotting Analysis: A representative lot detected phospho DCC (Tyr1418) in Western Blotting applications (Plooster, M., et. al. (2017). Mol Biol Cell. 28(18):2374-2385; Petrie, R.J., et. al. (2009). Biol Cell. 101(2):77-90).
Research Category
Apoptosis & Cancer
Quality
Evaluated by Western Blotting in HEK293 transfected with pRK5-DCC (DCCWT).
Western Blotting Analysis: A 1:500 dilution of this antibody detected phospho DCC (Tyr1418) in HEK293 transfected wtih pRK5-DCC (DCCWT).
Target description
~190 kDa observed; 157.94 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Rabbit polyclonal antiserum with 0.05% sodium azide with 20% glycerol.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form serum antibody product type primary antibodies clone polyclonal species reactivity rat packaging antibody small pack of 25 µL application(s) dot blot: suitable","immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_036973, UniProt accession no. Q63155,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho GATA6 (Ser37)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE2897-100UG ABE2897-25UG General descriptionTranscription factor GATA-6 (UniProt: Q92908; also known as GATA-binding factor 6) is encoded by the GATA6 gene (Gene ID: 2627) in human. GATA6 is a zinc-finger transcription factor that belongs to the six-member family of transcription factors that bind to the consensus sequence (A/T)GATA(A/G). GATA1, GATA2, and GATA3 are mainly expressed in hematopoietic cell lineages, while GATA4, GATA5, and GATA6 are predominantly expressed in the heart, gonads, and endodermal-derived tissues. It has two zinc-finger repeats localized to amino acids 390-414 and 444-468, which mediate interaction with LIM and cysteine-rich domains protein 1 (LMCD1). GATA-6 is shown to be important in the endodermal differentiation of organ tissues and has been indicated in proper lung development by controlling the late differentiation stages of alveolar epithelium and aquaporin-5 promoter activation. It has also been linked to the production of LIF that encourages proliferation of endodermal embryonic stem cells and blocks early epiblast differentiation. GATA6 is also required for definitive endoderm specification in human embryonic stem cells and induced pluripotent stem cells. Phosphorylation of GATA6 by GSK-3 on serine 37 is reported to promote its degradation, thereby preventing GATA6 from repressing transcripts that are induced by TNF and attenuated by insulin. Two isoforms of GATA-6 have been reported that are produced by alternative initiation. (Ref.: Chitforoushzadeh, Z., et al. (2016). ScienceSignaling 9 (431), ra59; Tiyaboonchai, A., et al. (2017). Stem Cell Reports 8 (3); 589-604).
Specificity
This rabbit polyclonal antibody detects GATA6 phosphorylated on Serine 37.ImmunogenKLH-conjugated linear peptide corresponding to 11 amino acids surrounding phosphoserine 37 of human Transcription factor GATA-6.
Epitope: unknownApplicationWestern Blotting Analysis: A 1:500 dilution from a representative lot detected phospho GATA6 (Ser37) in 293T cells transfected with 3XFLAG-tagged GATA6L.
Western Blotting Analysis: A representative lot detected phospho GATA6 (Ser37) in Western Blotting applications (Chitforoushzadeh, Z., et. al. (2016). Sci Signal. 9(431):ra59).
Immunoprecipitation Analysis: 4 µg/mL from a representative lot immunoprecipitated phospho GATA6 (Ser37) in 293T cells were transfected with 3xFLAG-GATA6 (Courtesy of Dr. Kevin A. Janes at University of Virginia).
Immunoprecipitation Analysis: A representative lot immunoprecipitated phospho GATA6 (Ser37) in Immunoprecipitation applications (Chitforoushzadeh, Z., et. al. (2016). Sci Signal. 9(431):ra59).
Research Category
Epigenetics & Nuclear Function
Anti-phospho GATA6 (Ser37), Cat. No. ABE2897, is a highly specific rabbit polyclonal antibody that targets Transcription factor GATA-6 (GATA-binding factor 6) and has been tested for use in Dot Blot, Immunoprecipitation, and Western Blotting.
Quality
Dot Blot Analysis: A 1:500 dilution from a representative lot detected phospho GATA6 (Ser37) in Phosphorylated GATA6 peptide.
Target description
~75 kDa observed; 60.03 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), porcine (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) dot blot: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_005248, UniProt accession no. Q92908, Gene Information human ... GATA6(2627) Узнать цену -
Anti-phospho Histone H4 (Tyr51)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE2909 ABE2909-25UL General descriptionHistone H4 (UniProt: P62805 ) is encoded by the HIST14A (also known as H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4) gene (Gene ID: 121504, 554313, 8294, 8359, 8360, 8361, 8362, 8363, 8364, 8365, 8366, 8367, 8368, 8370) in human. Histones play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone H4 is one of the main histone proteins that contribute to the chromatin structure in both prokaryotic and eukaryotic cells. Histone H4 can undergo several different types of epigenetic modifications that influence cellular processes, including methylation, acetylation, and phosphorylation. Acetylation at Lys6, Lys9, Lys13 and Lys17 is shown to occur in coding regions of the genome but not in heterochromatin. Monomethylation and asymmetric dimethylation at Arg4 is reported to favor acetylation at Lys9 and Lys13. Histone H4 can be phosphorylated by Tie2 on Tyr51, which is shown to preferentially occur in the presence of core histones. The phosphorylated H4 (H4Y51) is recognized by the proto-oncogene ABL1. Histone H4 is also phosphorylated on Ser48 by PAK2, which is shown to increase the association of H3.3-H4 with the histone chaperone HIRA, thus promoting nucleosome assembly of H3.3-H4 and inhibiting nucleosome assembly of H3.1-H4. Chromosomal aberrations involving histone H4 causes of B-cell non-Hodgkin lymphomas. (Ref.: Hossain, MB., et al. (2016). Sci. Adv. 2; e1501290).
Specificity
This rabbit polyclonal antibody detects Histone H4 phosphorylated on Tyrosine 51. It targets an epitope within 11 amino acids surrounding phosphotyrosine 51.ImmunogenTwo linear peptides (phosphorylated on Tyr 51 and non-phosphorylated) corresponding to 11 amino acids from the internal region of human Histone H4.
Epitope: unknownApplicationAnti-phospho Histone H4 (Tyr51) Antibody, Cat. No. ABE2909, is a highly specific rabbit polyclonal antibody that targets Histone H4 phosphorylated on Tyr51 and has been tested for use in in Immunocytochemistry, Immunofluorescence, and Western Blotting.
Western Blotting Analysis: A representative lot detected Tyr51 phosphorylation of Histone H4 in the presence of active recombinant Tie2, following analysis by Western blotting. (Hossain, MB., et al. (2016). Sci. Adv. 2; e1501290).
Immunofluorescence Analysis: A representative lot detected phospho Histone H4 (Tyr51) in HEK293 Tie2 cells treated with Angiopoietin 1 (ANG1) and ionizing radiation (Hossain, MB., et al. (2016). Sci. Adv. 2; e1501290).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Immunocytochemistry in HEK293 Tie2-myc cells treated with Angiopoietin 1 (ANG1).
Immunocytochemistry Analysis: A 1:250 dilution of this antibody detected phospho Histone H4 (Tyr51) in HEK293 Tie2-myc cells treated with Angiopoietin 1 (ANG1).
Target description
11.38 kDa calculated.
Physical form
Purified rabbit polyclonal antibody containing PBS without preservatives and 40% glycerol.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_778224 (Multiple NP# numbers), UniProt accession no. P62805, shipped in ambient Gene Information human ... HIST2H4B(554313)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-phospho Rab1 (Thr75)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS2131 ABS2131-25UL General descriptionRas-related protein Rab-1A (UniProt: P62820; also known as YPT1-related protein) is encoded by the RAB1A (also known as RAB1) gene (Gene ID: 5861) in human. Rab1 is a member of the small GTPase superfamily. Rab proteins are the largest family of small Ras-like GTPases. Three isoforms of Rab1 have been reported that are produced by alternative splicing. Rab GTPases are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. They cycle between an inactive GDP-bound form and an active GTP-bound form, which is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering, and fusion. Rab1 is reported to regulate vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface. Rab1 is also shown to be involved in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Rab1 is shown to be phosphorylated at Thr75 by TGF-beta activated kinase 1 (TAK1), which preferentially phosphorylates the inactive (GDP-bound) state of Rab1. Phosphorylation disrupts interaction with GDP dissociation inhibitor 1 (GDI1), but not GEF or GAP. Phosphorylation at Thr75 is shown to be essential for Rab1 function.
Specificity
This rabbit polyclonal antibody detects Ras-related protein Rab-1A (Rab1) in human cells. It targets an epitope within 14 amino acids surrounding phosphorylated Thr75.ImmunogenA linear peptide corresponding to 14 amino acids surrounding phosphorylated Thr75 from the N-terminal half of human Ras-related protein Rab-1A.
Epitope: unknownApplicationResearch Category
Signaling
Anti-phospho Rab1 (Thr75), Cat. No. ABS2131, is a rabbit polyclonal antibody that detects Ras-related protein Rab-1A and has been tested for use in Western Blotting.
Western Blotting Analysis: A representative lot detected phospho Rab1 (Thr75) in Western Blotting applications (Levin, R.S., et. al. (2016). Proc Natl Acad Sci USA. 113(33):E4776-83).
Quality
Evaluated by Western Blotting in lysate from HEK293T stably expressing GST-Rab1a-Tak1.
Western Blotting Analysis: A 1:250 dilution of this antibody detected phospho Rab1 (Thr75) in lysates from HEK-293T stably expressing GST-Rab1a-Tak1.
Target description
~48 kDa observed; 22.68 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in PBS with 0.02% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human species reactivity (predicted by homology) bovine (based on 100% sequence homology), rat (based on 100% sequence homology), sheep (based on 100% sequence homology), porcine (based on 100% sequence homology), mouse (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG NCBI accession no. NP_004152, UniProt accession no. P62820, Gene Information human ... RAB1A(5861)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho RasGRP2 (Ser116/Ser117)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS2130 ABS2130-25UG General descriptionRAS guanyl-releasing protein 2 (UniProt: Q9QUG9; also known as Calcium and DAG-regulated guanine nucleotide exchange factor I, RasGRP2, CalDAG-GEFI, F25B3.3 kinase-like protein) is encoded by the Rasgrp2 gene (Gene ID: 19395) in murine species. RasGRP proteins are considered as activators of Ras and other related small GTPases by virtue o functioning as guanine nucleotide exchange factors (GEFs). RasGRP-1 through -4 share many structural domains, however, they display subtle differences between each of the different family members. They are expressed in distinct patterns, such as in different cells of the hematopoietic system and in the brain. RasGRP2s expression is restricted to platelets and their precursors, megakaryocytes as well as neutrophils. RasGRP2 functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. It may also activate other GTPases such as RRAS, RRAS2, NRAS, KRAS, but not HRAS. It is also reported to functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils, probably through inside-out integrin activation. RaGRP2 is found both in the cytosol and associated with membranes. It is shown to be enriched at juxtamembrane areas and membrane ruffles. Three isoforms of RasGRP2 have been reported that are generated by alternative splicing. It contains two EF-hand domains, one N-terminal Ras-GEF domain, one phorbol-ester/DAG-type zinc finger domain, and one Ras-GEF domain. RasGRP2 deficient animals exhibit bleeding problems due to defects in platelets aggregation and degranulation. (Ref.: Olga Ksionda, O et al. (2013). Front Biol (Beijing). 8(5): 508 532).
Specificity
This rabbit polyclonal antibody detects RAS guanyl-releasing protein 2 phosphorylated on Ser116/117 in Mouse and Monkey cells. It targets an epitope with in 12 amino acids surrounding Ser116/Ser117 from the N-terminal region.ImmunogenA linear peptide corresponding to 12 amino acids surrounding phosphorylated Ser116/117 from the N-terminal region of murine RAS guanyl-releasing protein 2.
Epitope: unknownApplicationImmunofluorescence Analysis: A representative lot detected phospho RasGRP2 (Ser116/Ser117) in nucleus accumbens (NAc) from Drd1-mVenus transgenic mice treated with cocaine (Nagai, T., et. al. (2016). Neuron. 89(3):550-65).
Western Blotting Analysis: A representative lot detected phospho RasGRP2 (Ser116/Ser117) in RasGRP2 purified from GST-Rasgrp2 transfected COS-7 cells and phosphorylated by GST-PKAc alpha, Forskolin stimulated mouse striatal muscle slices (Courtesy of Dr. Kozo Kaibuchi at Nagoya University, Japan).
Western Blotting Analysis: A representative lot detected phospho RasGRP2 (Ser116/Ser117) in a kinase assay with GST-Rasgrp2 (amino acids 1-374) and PKA, Forskolin and SKF81279 stimulated mouse striatal muscle slices, COS-7 cells transfected with EGFP-Rasgrp2 and Myc-PKA, nucleus accumbens (NAc) from mice treated with cocaine, Nucleus accu (Nagai, T., et. al. (2016). Neuron. 89(3):550-65).
Research Category
Signaling
Anti-phospho RasGRP2 (Ser116/Ser117), Cat. No. ABS2130, is a rabbit polyclonal antibody that detects RAS guanyl-releasing protein 2 phosphorylated on Ser116/Ser117 and has been tested for use in Immunofluorescence and Western Blotting.
Quality
Evaluated by Western Blotting in RAS guanyl-releasing protein 2 purified from GST-RasGRP2 transfected COS-7 cells and phosphorylated on Ser116/Ser117 by GST-PKAc alpha.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected RAS guanyl-releasing protein 2 in RasGRP2 purified from GST-RasGRP2 transfected COS-7 cells and phosphorylated on Ser116/Ser117 by GST-PKAc alpha
Target description
~90 kDa observed; 69.45 kda calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in buffer containing 0.1M Tris-Glycine, 10% Ethylene Glycol, pH 7.6 with 0.05% sodium azide.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, monkey species reactivity (predicted by homology) rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_035372, UniProt accession no. Q9QUG9, Узнать цену -
Anti-phospho RasGRP2 (Ser554)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS2095 ABS2095-25UG General descriptionRAS guanyl-releasing protein 2 (UniProt: Q9QUG9; also known as Calcium and DAG-regulated guanine nucleotide exchange factor I, RasGRP2, CalDAG-GEFI, F25B3.3 kinase-like protein) is encoded by the Rasgrp2 gene (Gene ID: 19395) in murine species. RasGRP proteins are considered as activators of Ras and other related small GTPases by virtue of functioning as guanine nucleotide exchange factors (GEFs). RasGRP-1 through -4 share many structural domains, however, they display subtle differences between each of the different family members. They are expressed in distinct patterns, such as in different cells of the hematopoietic system and in the brain. RasGRP2s expression is restricted to platelets and their precursors, megakaryocytes, and neutrophils. RasGRP2 functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. It may also activate other GTPases such as RRAS, RRAS2, NRAS, KRAS, but not HRAS. It is also reported to function in aggregation of platelets and adhesion of T-lymphocytes and neutrophils, probably through inside-out integrin activation. RaGRP2 is found both in the cytosol and associated with membranes. It is shown to be enriched at juxtamembrane areas and membrane ruffles. Three isoforms of RasGRP2 have been reported that are generated by alternative splicing. It contains two EF-hand domains, one N-terminal Ras-GEF domain, one phorbol-ester/DAG-type zinc finger domain, and one Ras-GEF domain. RasGRP2 deficient animals exhibit bleeding problems due to defects in platelets aggregation and degranulation. (Ref.: Olga Ksionda, O et al. (2013). Front Biol (Beijing). 8(5): 508 532).
Specificity
This rabbit polyclonal antibody detects RAS guanyl-releasing protein 2 phosphorylated on Ser554 in various mammalian species. It targets an epitope within 11 amino acids surrounding Ser554 from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 11 amino acids surrounding Ser554 from the C-termnal region of murine RAS guanyl-releasing protein 2.ApplicationWestern Blotting Analysis: A representative lot detected phospho RasGRP2 (pSer554) in a kinase assay with GST-Rasgrp2 (amino acids 1-374) and PKA, Forskolin and SKF81279 stimulated mouse striatal muscle slices, COS-7 cells transfected with EGFP-Rasgrp2 and Myc-PKA, nucleus accumbens (NAc) from mice treated with cocaine, Nucleus accu (Nagai, T., et. al. (2016). Neuron. 89(3):550-65).
Western Blotting Analysis: A representative lot detected RAS guanyl-releasing protein 2 purified from GST-Rasgrp2 transfected COS-7 cells and phosphorylated with GST-PKA catalytic subunit alpha, Forskolin stimulated mouse striatal muscle slices (Courtesy of Dr. Kozo Kaibuchi at Nagoya University, Japan).
Anti-phospho RasGRP2 (Ser554), Cat. No. ABS2095, is a rabbit polyclonal antibody that detects RAS guanyl-releasing protein 2 phosphorylated on Ser554 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting with RAS guanyl-releasing protein 2 purified from GST-RasGRP2 transfected COS-7 cells and phosphorylated on Ser554 by GST-PKA calalytic subunit alpha (PKAc alpha).
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected phospho RasGRP2 (Ser554) purified from GST-RasGRP2 transfected COS-7 cells and phosphorylated on Ser554 by GST-PKA catalytic subunit alpha (PKAc alpha).
Target description
~90 kDa observed; 69.45 kda calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, monkey species reactivity (predicted by homology) rabbit (based on 100% sequence homology), baboon (based on 100% sequence homology), rat (based on 100% sequence homology), porcine (based on 100% sequence homology), human (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG NCBI accession no. NP_035372, UniProt accession no. Q9QUG9, Узнать цену -
Anti-phospho RasGRP2 (Ser586)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS2118 ABS2118-25UG General descriptionRAS guanyl-releasing protein 2 (UniProt: Q9QUG9; also known as Calcium and DAG-regulated guanine nucleotide exchange factor I, RasGRP2, CalDAG-GEFI, F25B3.3 kinase-like protein) is encoded by the Rasgrp2 gene (Gene ID: 19395) in murine species. RasGRP proteins are considered as activators of Ras and other related small GTPases by virtue o functioning as guanine nucleotide exchange factors (GEFs). RasGRP-1 through -4 share many structural domains, however, they display subtle differences between each of the different family members. They are expressed in distinct patterns, such as in different cells of the hematopoietic system and in the brain. RasGRP2s expression is restricted to platelets and their precursors, megakaryocytes as well as neutrophils. RasGRP2 functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. It may also activate other GTPases such as RRAS, RRAS2, NRAS, KRAS, but not HRAS. It is also reported to functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils, probably through inside-out integrin activation. RaGRP2 is found both in the cytosol and associated with membranes. It is shown to be enriched at juxtamembrane areas and membrane ruffles. Three isoforms of RasGRP2 have been reported that are generated by alternative splicing. It contains two EF-hand domains, one N-terminal Ras-GEF domain, one phorbol-ester/DAG-type zinc finger domain, and one Ras-GEF domain. RasGRP2 deficient animals exhibit bleeding problems due to defects in platelets aggregation and degranulation. (Ref.: Olga Ksionda, O et al. (2013). Front Biol (Beijing). 8(5): 508 532).
Specificity
This rabbit polyclonal antibody detects RAS guanyl-releasing protein 2 phosphorylated on Ser586 in Mouse and Monkey cells. It targets an epitope with in 11 amino acids surrounding Ser586 from the C-terminal region.ImmunogenA linear peptide corresponding to 11 amino acids surrounding phosphorylated Ser586 from the C-terminal region of murine RAS guanyl-releasing protein 2 .
Epitope: C-terminusApplicationWestern Blotting Analysis: A representative lot detected phospho RasGRP2 (Ser586) in Kinase assay with GST-Rasgrp2 (amino acids 1-374) and PKA, Forskolin and SKF81279 stimulated mouse striatal slices, COS-7 cells transfected with EGFP-Rasgrp2 and Myc-PKA, nucleus accumbens (NAc) from mice treated with cocaine, Nucleus accu (Nagai, T., et. al. (2016). Neuron. 89(3):550-65).
Western Blotting Analysis: A representative lot detected phospho RasGRP2 (Ser586) in RasGRP2 purified from GST-Rasgrp2 transfected COS-7 cells and phosphorylated by GST-PKAc alpha, Forskolin stimulated mouse striatal slices (Courtesy of Dr. Kozo Kaibuchi at Nagoya University, Japan).
Anti-phospho RasGRP2 (Ser586), Cat. No. ABS2118, is a rabbit polyclonal antibody that detects RAS guanyl-releasing protein 2 phosphorylated on Ser586 and has been tested for use in Western Blotting.
Research Category
Signaling
Quality
Evaluated by Western Blotting in RAS guanyl-releasing protein 2 purified from GST-RasGRP2 transfected COS-7 cells and phosphorylated on Ser586 by GST-PKA catalytic subunit alpha (PKAc alpha)
Western Blotting Analysis): A 1:1,000 dilution of this antibody detected RAS guanyl-releasing protein 2 purified from GST-RasGRP2 transfected COS-7 cells and phosphorylated on Ser586 by GST-PKA catalytic subunit alpha (PKAc alpha).
Target description
~90 kDa observed; 69.45 kda calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in buffer containing 0.1M Tris-Glycine, 10% Ethylene Glycol, pH 7.6 with 0.05% sodium azide.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, monkey species reactivity (predicted by homology) rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG NCBI accession no. NP_035372, UniProt accession no. Q9QUG9,
Safety Informationpictograms GHS08 signalword Warning hcodes H373 pcodes P260 - P314 - P501 Target Organs Kidney WGK Germany WGK 1 Узнать цену -
Anti-phospho TFEB (Ser142)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1971-I-25UL ABE1971-I-100UL General descriptionTranscription factor EB (UniProt: P19484; also known as Class E basic helix-loop-helix protein 35, bHLHe35) is encoded by the TFEB (also known as BHLHE35) gene (Gene ID: 7942) in human. TFEB is a basic Helix-Loop-Helix (bHLH) leucine zipper transcription factor that plays a major role in the regulation of lysosomal biogenesis. TFEB is also a main player in the transcriptional response to starvation and controls autophagy by positively regulating autophagosome formation and autophagosome-lysosome fusion. TFEB is phosphorylated by mTORC1 and ERK at Ser142, which prevents its nuclear translocation. Pharmacological inhibition of mTORC1, as well as starvation and lysosomal disruption, activates TFEB nuclear translocation. Similarly, the serine-threonine kinase RIP1/RIPK1 is shown to suppress basal autophagic flux by activating ERK, which in turn phosphorylates TFEB at Ser142 and thereby prevents TFEB-mediated transcription of gene products involved in autophagy.
Specificity
This rabbit polyclonal antibody specifically detects Transcription factor EB phosphorylated on Serine 142 in human cells.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids surrounding phosphoserine 142 from the N-terminal half of human Transcription factor EB, isoform 1.ApplicationAnti-phospho TFEB (Ser142), Cat. No. ABE1971-I, is a highly specific rabbit polyclonal antibody that targets Transcription factor EB phosphorylated on Serine 142 and has been tested for use in Western Blotting.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in transfected HEK293 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected phospho TFEB (Ser142) in lysate of HEK293 cells transfected with FLAG-tagged wild type TFEB.
Target description
~65 kDa observed; 52.87 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Affinity Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), rat (based on 100% sequence homology), bovine (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) western blot: suitable NCBI accession no. NP_001161299, UniProt accession no. P19484, Gene Information human ... TFEB(7942) Узнать цену -
Anti-phospho-4E BP1 (Ser83) Antibody, clone CM14D3
Кат. номер MABS2243-25UL MABS2243-100UL General descriptionEukaryotic translation initiation factor 4E-binding protein 1 (UniProt: Q13541; also known as 4E-BP1, eIF4E-binding protein 1, Phosphorylated heat- and acid-stable protein regulated by insulin 1, PHAS-I) is encoded by the EIF4EBP1 gene (Gene ID: 1978) in human. 4E-BP1 is a member of a family of translation repressor proteins, and a well-known substrate of mTOR signaling pathway. In response to upstream stimuli, such as insulin, EGF, and PDGF, mTORC1 is shown to phosphorylate S6 kinase 1 (S6K1) and 4E-BP1 that stimulates protein synthesis. About 30% of the 4E-BP1 expressed in cells is localized in the nucleus, where it regulates the availability of eIF4E for the cytoplasmic translational machinery, by retaining eIF4E in the nucleus. 4E-BP1 can undergo phosphorylation at multiple sites (Thr 37, 46, 70 and Ser 65, 83, 101, and 112) and the first five sites are phylogenetically conserved among all species. The phosphorylated form is also considered as a marker of activated mTOR signaling. Phosphorylations at Thr37 and Thr46 serve as a priming event, which is followed by phosphorylation at Thr70 and then at Ser 65. The hyperphosphorylated form is regulated by mTORC1 and abolishes binding to elF4E. Several other kinases have also been shown to phosphorylate 4E-BP1 dependent or independent of mTOR. Phosphorylation of 4E-BP1 at Thr37 and Thr46 by GSK3 reduces its association with elF4E and its release from eIF4E allows cap-dependent translation to proceed. High level of phosphorylated 4E-BP1 is reported in several human cancers and is associated with an unfavorable outcome in several malignancies. Overexpression of cytosolic 4E-BP1 is reported to orchestrate a hypoxia-activated switch from cap-dependent to cap-independent mRNA translation that promotes increased tumor angiogenesis and growth at the level of selective mRNA translation. (Ref.: Qin, X., et al. (2016). Cell Cycle. 15(6); 781-786).
Specificity
Clone CM14D3 is a rat monoclonal antibody that detects Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) phosphorylated on serine 83.ImmunogenKLH-conjugated linear peptide corresponding to 13 amino acids from surrounding phosphoserine 83 from the C-terminal half of human Eukaryotic translation 4E-BP1.ApplicationQuality Control Testing
Evaluated by Western Blotting in lysate from A431 cells treated with PMA.
Western Blotting Analysis (WB): A 1:500 dilution of this antibody detected 4E-BP1 in lysate from A431 cells treated with PMA (200 nM, 20 min. at 37C), but not in untreated cells.
Anti-phospho-4E BP1 (Ser83), clone CM14D3, Cat. No. MABS2243, is a rat monoclonal antibody that detects Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) phosphorylated on serine 83 and is tested for use in Western Blotting.
Physical form
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rat antibody form purified antibody antibody product type primary antibodies clone CM14D3, monoclonal mol wt calculated mol wt 12.58 kDa","observed mol wt ~15 kDa purified by using protein G species reactivity human species reactivity (predicted by homology) mouse packaging antibody small pack of 100 µL application(s) western blot: suitable isotype IgG epitope sequence C-terminal half conjugate unconjugated Protein ID accession no. NP_004086, UniProt accession no. Q13541, shipped in 2-8°C Gene Information human ... EIF4EBP1(1978)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho-Acetyl CoA Carboxylase (Ser79) Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 7-303 7-303-25UG 7-303-100UG General descriptionAcetyl CoA carboxylase (ACC) is a biotin-dependent enzyme that catalyzes carboxylation of acetyl-CoA to produce malonyl-CoA through its two catalytic activities, biotin carboxylase (BC) and carboxyltransferase (CT). ACC is a multi-subunit enzyme in most prokaryotes, whereas it is a large, multi-domain enzyme in most eukaryotes. The activity of ACC can be controlled at the transcriptional level as well as by small molecule modulators and covalent modification. Human genome contains the genes for two different ACCs - ACACA and ACACB. The activity of the enzyme is controlled by the reversible phosphorylation. The activities of the enzyme is inhibited if phosphorylated; the phosphorylation takes place when the hormones, glucagon or epinephrine bind to the receptors or the energy status of the cell is low, leading to the activation of the AMP-activated protein kinase. The presence of fatty acid inhibits the activities of the enzyme. When insulin binds to its receptors of the cell, it activates a phosphatase to dephosphorylate the enzyme; the activities of the acetyl CoA carboxylase is thus enhanced. Acetyl CoA carboxylase has recently become a target in the design of new anti-obesity and antibiotic drugs.
Specificity
Recognizes Acetyl CoA Carboxylase phosphorylated at Serine 79, MW 257 kDa.ImmunogenKLH conjugated synthetic peptide (C-HM RSSM[pS]GLHLVK) corresponding to amino acid 73-85 of rat Acetyl CoA Carboxylase.
Epitope: N-terminalApplicationAnti-phospho-Acetyl CoA Carboxylase (Ser79) Antibody is an antibody against phospho-Acetyl CoA Carboxylase (Ser79) for use in WB.
Research Category
Signaling
Research Sub Category
Insulin/Energy Signaling
Quality
Evaluated by Western Blot on Lambda phosphatase-treated and untreated A375 cell lysate.
Western Blot Analysis: 1:500 dilution of this antibody detected endogenous phospho-Acetyl CoA Carboxylase (Ser79) in lysate from Lambda phosphatase-treated and untreated A375 cells.
Target description
257 kDaLinkageReplaces: 04-1009
Physical form
Protein A purified in buffer containing in 0.1M Tris-Glycine (pH7.4), 150 mM NaCl, with 0.05% NaN3.
Format: Purified
Protein A chromatography
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity canine, human species reactivity (predicted by homology) bovine (immunogen homology), chicken (immunogen homology), rat (immunogen homology), dog (immunogen homology), mouse (immunogen homology) packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) western blot: suitable NCBI accession no. NP_942131, UniProt accession no. Q13085, shipped in ambient Узнать цену -
Anti-phospho-AKT1 Antibody, Thr479
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS1526 ABS1526-25UG General descriptionRAC-alpha serine/threonine-protein kinase (UniProt: P31749; EC: 2.7.11.1; Protein kinase B, PKB, Protein kinase B alpha, PKB alpha, Proto-oncogene c-Akt, RAC-PK-alpha, AKT1) is encoded by the AKT1 (also known as PKB, RAC) gene (Gene ID: 207) in human. AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) that regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. In mammals these 3 isoforms of AKT exhibit a high degree of homology, but differ slightly in the localization of their regulatory phosphorylation sites. AKT1 is constitutively phosphorylated on Ser124, in the region between PH and catalytic domains, and on Thr450, in the C-terminal region in unstimulated cells. Phosphorylation at Thr308 and Ser473 induces complete activation of AKT1. AKT1 contains one PH domain (aa 5-108), one protein kinase domain (aa 150-408), and one AGC-kinase C-terminal domain (aa 409-480). Binding of the PH domain to phosphatidylinositol 3,4,5-trisphosphate (PIP3) results in its targeting to the plasma membrane. AKT1 can be phosphorylated at Ser477/Thr479 by Cdk2/Cyclin A, which locks it into an active conformation. Ser477/Thr479 phosphorylation is believe to trigger Akt1 activation either through enhancing the association between AKT1 and mTORC2 to promote phosphorylation of Ser473, or by functionally compensating for phosphorylated Ser473 to lock AKT1 in its active conformation. AKT1 phosphorylated at Ser477/Thr479 is reported to display increased association with Sin1 and mTOR complexes. (Ref.: Liu, P et al (2014). Nature. 508(7497): 541-545).
Specificity
This rabbit polyclonal antibody detects AKT1 phosphorylated on Thr479.ImmunogenKLH-conjugated linear peptide corresponding to 10 amino acids surrounding Thr479 from the C-terminal region of human AKT1.ApplicationPeptide Inhibition Analysis: A 1:500 dilution from a representative lot detected phospho-AKT1, Thr479 in RAT2 cells.
Research Category
Signaling
Anti-phospho-AKT1, Thr479, Cat. No. ABS1526, is a rabbit polyclonal antibody that detects AKT1 phosphorylated on Thr479 and has been tested for use in Western Blotting and Peptide Inhibition Assay.
Quality
Evaluated by Western Blotting in RAT2 cells transfected with Src (21-154).
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected phospho-AKT1, Thr479 in lysate of RAT2 cells transfected with Src (21-154).
Target description
~56 kDa observed; 55.68 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat species reactivity (predicted by homology) mouse (based on 100% sequence homology), human (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) inhibition assay: suitable (peptide)","western blot: suitable NCBI accession no. NP_001014431.1, UniProt accession no. P31749, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho-alpha-synuclein (Ser129) Antibody, clone LS4-1B1
eCl@ss: 32160702
Кат. номер MABN2419-25UG MABN2419-100UG General descriptionAlpha-synuclein (UniProt: P37840; also known as Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP) is encoded by the SNCA (also known as NACP, PARK1) gene (Gene ID: 6622) in human. Alpha-synuclein is a membrane-bound protein in dopaminergic neurons that is involved in the regulation of dopamine release and transport. It is also reported to induce fibrillization of microtubule-associated protein tau and reduces neuronal responsiveness to various apoptotic stimuli. Aggregation of alpha-synuclein is known to be a causative factor in the development of Parkinsons disease (PD), which leads to the degeneration of dopaminergic neurons in the substantia nigra (SN) in the midbrain region. Aggregates of alpha-synuclein are present in Lewy bodies. Alpha-synuclein can be phosphorylated, predominantly on serine residues by casein kinase 1. Phosphorylation of Ser129 is reported to be selective and extensive in synucleinopathy lesions and promotes insoluble fibril formation. Mutations in the SNCA gene produce defective alpha-synuclein that induces conformational changes making it more prone to self-aggregation and deposition in Lewy bodies. Mutant forms of alpha-synuclein impair synaptic vesicle formation, elevate cytoplasmic levels of dopamine, and increases superoxide radicals, which lead to oxidative stress and misfolding of alpha-synuclein.
Specificity
Clone LS4-1B1 specifically detects alpha-synuclein phosphorylated on serine 129.ImmunogenKLH-conjugated linear peptides corresponding to aa 121-137 and 124-134 phosphorylated on Serine 129 from the C-terminal region of human alpha synuclein.ApplicationWestern Blotting Analysis: A representative lot detected phospho-alpha-synuclein (Ser129) in Western Blotting applications (Rutherford, N.J., et. al. (2016). Acta Neuropathol Commun. 4(1):80).
Immunohistochemistry Analysis: A representative lot detected phospho-alpha-synuclein (Ser129) in Immunohistochemistry applications (Rutherford, N.J., et. al. (2016). Acta Neuropathol Commun. 4(1):80).
Anti-phospho-alpha-synuclein (Ser129), clone LS4-1B1, Cat. No. MABN2419, is a highly specific mouse monoclonal antibody that targets alpha-synuclein and neurofilament light polypeptide (NFL) phosphorylated on Ser129 and has been tested in Western Blotting and Immunohistochemistry.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in mouse brain tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected phospho-alpha-synuclein (Ser129) in mouse brain tissue lysate.
Target description
~70 kDa observed (aggregated); 14.46 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone LS4-1B1, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_000336, UniProt accession no. P37840, Gene Information human ... SNCA(6622)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho-ATM (Ser1981) Antibody, clone 10H11.E12
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 5-740 5-740-25UG 5-740-100UG General descriptionAtaxia telangiectasia mutated kinase (ATM) and ataxia telangiectasia and Rad3-related kinase (ATR) are related kinases that regulate cell cycle checkpoints and DNA repair. Mutation in the ATM gene results in the autosomal recessive disease ataxia telangiectasia (AT). The identified substrates for ATM are p53, p95/NBS1, MDM2, Chk2, BRCA1, CtIP, 4E-BP1 and Chk1. The essential requirement for the substrates of ATM/ATR is S/TQ. Hydrophobic amino acids at positions -3 and -1, and negatively charged amino acids at position +1 are positive determinants for substrate recognition by these kinases. Positively charged residues surrounding the S/TQ are negative determinants for substrate phosphorylation. The complex phenotype of cells derived from patients with AT suggests that ATM has additional cellular substrates. In unirradiated cells, ATM is present as an inactive homodimer or multimer. Double-stranded breaks in DNA caused by ionizing radiation cause rapid ATM kinase activation through dissociation of this complex and ATM autophosphorylation at Ser1981.
Specificity
Predicted to cross-react with rat based on sequence homology
This antibody recognizes ATM, Mr ~370 kDa. A non-specific protein was also detected, Mr ~ >400 kDa.ImmunogenKLH-conjugated, synthetic peptide corresponding to amino acids 1974-1988 (SLAFEEG[pS]QSTTISS) of human ATM. The immunizing sequence has 11/12 identical amino acids in mouse and rat.ApplicationResearch Sub Category
Cell Cycle, DNA Replication & Repair
Use Anti-phospho-ATM (Ser1981) Antibody, clone 10H11.E12 (Mouse Monoclonal Antibody) validated in ICC, IF, IP, WB to detect phospho-ATM (Ser1981) also known as A-T mutated.
Immunoprecipitation:
Phosphorylated ATM was immunoprecipitated from irradiated HeLa cells (Figure A, lanes 3 and 4).
Immunocytochemistry:
Foci are detected in irradiated human and mouse fibroblasts. Determined by an independent laboratory.
Research Category
Epigenetics & Nuclear Function
Quality
Routinely evaluated by immunoblot on in crude lysates from irradiated HeLa cells.
Western Blot Analysis:
0.5 µg/mL of this lot detected phosphorylated ATM in crude lysates from irradiated HeLa cells.
Target description
~370 kDa
Physical form
Protein G Purified
Protein G purified mouse IgG in 0.014 M phosphate buffer, pH 7.6, with 0.175 M NaCl, 0.07 % Sodium Azide and 30% glycerol. Liquid at -20°C.
Format: Purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations:
Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.
Analysis Note
Control
Irradiated HeLa cell lysatesOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 10H11.E12, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) immunocytochemistry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_000042, UniProt accession no. Q13315, shipped in ambient Gene Information human ... ATM(472) Узнать цену -
Anti-phospho-BRCA1 (Ser114) Antibody, clone 3C10G8
Кат. номер MABC1639-25UL MABC1639-100UL General descriptionBreast cancer type 1 susceptibility protein (UniProt: P38398; also known as EC:2.3.2.27, RING finger protein 53, RING-type E3 ubiquitin transferase BRCA1) is encoded by the BRCA1 (also known as RNF53) gene (Gene ID: 672) in human. BRCA1 and BRCA2 are important in maintaining genomic stability by promoting efficient and precise repair of double-strand breaks. BRCA1 is expressed in all cells and plays a broader role in various cellular processes in response to DNA damage. It promotes the protection of nascent DNA at stalled replication forks independently of the canonical BRCA1-PALB2 interaction. Its recruitment to DNA damage sites is mediated by ABRAXAS1 and the BRCA1-A complex. BRCA1 contains two BRCT domains (aa 1642-1736 and 1756-1855) that recognize and bind phosphorylated pSXXF motif on proteins. The interaction with the phosphorylated pSXXF motif of ABRAXAS1 recruits BRCA1 at DNA damage sites. BRCA1 is reported to exist as a heterodimeric complex with BARD1, a structurally related protein that also contains a N-terminal RING-finger domain and two C-terminal BRCT motifs. This heterodimer regulates the localization and loading of RAD51 at break sites through PALB2-BRCA2. Their association is mediated through their respective RING domains, and together they exhibit E3 ubiquitin ligase activity, which can be disrupted by mutations within the RING domain of BRCA1. BRCA1 and BARD1 are shown to be phosphorylated at residues that are located close to the site of interaction between BARD1 and RAD51 (Ser148 on BARD1 and Ser114 on BRCA1) and Ser114 phosphorylation promotes BRCA1 interaction with PIN1. PIN1 increases interactions between the BRCA1-BARD1 complex and RAD51 resulting in recruitment of RAD51 to stalled replication forks and enhance protection of the nascent DNA strand. Cells lacking BRCA1 show defects in DNA repair by homologous recombination. Mutations in BRCA1 gene have been linked to breast and ovarian cancers. A vast majority of inherited breast cancers result from mutations in the BRCA 1 gene. Male subjects with BRCA1 mutations exhibit about 3-fold increase in risk of prostate cancer. (Ref.: Daza-Martin, M., et al. (2019). Nature. 571(7766); 521-527; Gudumundsdottir, K., and Ashworth, A. (2006). Oncogene 25; 5864-5874).
Specificity
Clone 3C10G8 is a mouse monoclonal antibody that specifically detects BRCA1 phosphorylated on serine 114.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids surrounding phosphoserine 114 from the N-terminal region of human BRCA1.ApplicationQuality Control Testing
Evaluated by Western Blotting with a construct containing GST-tagged recombinant fragment of phosphorylated BRCA1.
Western Blotting Analysis (WB): A 1:500 dilution of this antibody detected a construct containing GST-tagged recombinant BRCA1 fragment phosphorylated on Serine 114 but did not react with non-phosphorylated construct. (BRCA1 construct: Courtesy of Dr. Jesse Rinehart, Yale University, School of Medicine).
Tested Applicaitons
Western Blotting Analysis: A representative lot detected phospho-BRCA1 (Ser114) in Western Blotting applications (Daza-Martin, M., et al. (2019). Nature.;571(7766):521-527).
Immunocytochemistry Analysis: A representative lot detected phospho-BRCA1 (Ser114) in Immunocytochemistry applications (Daza-Martin, M., et al. (2019). Nature.;571(7766):521-527).
Immunofluorescence Analysis: A representative lot detected phospho-BRCA1 (Ser114) in Immunofluorescence applications (Daza-Martin, M., et al. (2019). Nature.;571(7766):521-527).
Immunoprecipitation Analysis: A representative lot immunoprecipitated phospho-BRCA1 (Ser114) in Immunoprecipitation applications (Daza-Martin, M., et al. (2019). Nature.;571(7766):521-527).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-phospho-BRCA1 (Ser114), clone 3C10G8, Cat. No. MABC1639, is a mouse monoclonal antibody that detects BRCA1 phosphorylated on serine 114 and is tested in Immunocytochemistry, Immunofluorescence, Immunoprecipitation, and Western Blotting.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 3C10G8, monoclonal mol wt calculated mol wt 207.72 kDa","observed mol wt ~30 kDa purified by using protein G species reactivity human species reactivity (predicted by homology) monkey packaging antibody small pack of 100 µL application(s) immunocytochemistry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 epitope sequence N-terminal conjugate unconjugated Protein ID accession no. NP_009255, UniProt accession no. P38398, shipped in 2-8°C Gene Information human ... BRCA1(672)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho-CaMKII beta (Ser331)
eCl@ss: 32160702
Кат. номер ABS2107 ABS2107-25UL General descriptionCalcium/calmodulin-dependent protein kinase type II subunit beta (UniProt: P08413; also known as EC: 2.7.11.17, CaM kinase II subunit beta, CaMK-II subunit beta) is encoded by the Camk2b gene (Gene ID: 24245) in rat. CaM kinase II is one of the most widely studied multi-functional enzyme. It is found in high concentrations in the brain and in some regions it may constitute up to 2% of the total protein content. CaM kinase II is a complex of about 12 subunits, which exist in four differentially expressed forms (alpha, beta, gamma, and delta). CaMKII beta contains an auto-inhibitory domain (aa 283-293), a calmodulin-binding domain (aa 291-301) and a unique C-terminal association domain responsible for oligomerization. It is activated Ca2+/calmodulin and binding of calmodulin results in conformational change that relieves intrasteric autoinhibition and allows autophosphorylation of Thr-287 which turns the kinase in a constitutively active form and confers to the kinase a Ca2+-independent activity that persists even after withdrawal of calcium. Phosphorylation of Thr-287 locks the kinase into an activated state. CaM Kinase II typically recognizes the phosphorylation site sequence Arg-X-X-Ser/Thr. It prefers arginine in the P3 position, which is reported to make an electrostatic contact with Glu96 in the catalytic core.
Specificity
This rabbit polyclonal antibody detects beta subunit of CaM Kinase II when phosphorylated on Ser331.ImmunogenA linear peptide corresponding to 10 amino acids surrounding phopho serine 331 of rat CaM Kinase II beta.ApplicationAnti-phospho-CaMKII beta (Ser331), Cat. No. ABS2107, is a highly specific rabbit polyclonal antibody that targets Calcium/calmodulin-dependent protein kinase type II subunit beta (CaMK-II subunit beta) and has been tested for use in Immunocytochemistry and Western Blotting.
Western Blotting Analysis: A representative lot detected phospho-CaMKII beta (Ser331) in HEK293T cells transfected with CaMKII WT or mutants (Kim, K., et. al. (2015). Neuron. 87(4):813-26).
Immunocytochemistry Analysis: A representative lot detected phospho-CaMKII beta (Ser331) in dissociated hippocampal neurons (Kim, K., et. al. (2015). Neuron. 87(4):813-26).
Quality
Evaluated by Western Blotting in HEK293T cells transfected with CaMKII WT or mutant S331A.
Western Blotting Analysis: A 1:500 dilution of this antibody detected phospho-CaMKII beta (Ser331) in HEK293T cells transfected with CaMKII WT, but not the mutant S331A.
Target description
~60 kDa observed; 60.40 kDa calculated. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat species reactivity (predicted by homology) human (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_068507, UniProt accession no. P08413,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-phospho-CENP-A (Ser7) Antibody, clone NL41, rabbit monoclonal
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 4-792-25UL 4-792 4-792-100UL General descriptionCENP-A is a variant version of histone H3 found only at centromeres. It is phosphorylated at serine 7 during mitosis.
Centromere protein A (CENP-A) is a 17 kDa centromere-specific histone variant with 62% amino acids homology to the C-terminal of histone H3. Localized in the centromere, it plays a central role in the centromere-specific chromatin formation. The depletion of histone H3 at the CENP-A binding domain suggests CENP-A to be a possible replacement for histone H3 in the packaging process of α-satellite DNA into primary chromation structure. CENP-A is essential in the formation of specialized nucleosomes at the centromere, implicating CENP-A as a centromere-specific epigenetic marker.
Specificity
Others not tested.
CENP-A phosphorylated on serine 7Immunogenpeptide containing the sequence RRpSRK in which pS is phospho-serine corresponding to amino acid 7 of human CENP-A (centromere protein A)ApplicationResearch Sub Category
Cell Cycle, DNA Replication & Repair
Research Category
Epigenetics & Nuclear Function
Anti-phospho-CENP-A (Ser7) Antibody, clone NL41 is a high quality Rabbit Monoclonal Antibody for the detection of phospho-CENP-A (Ser7) & has been validated in Mplex, WB, ICC.
Quality
routinely evaluated by immunoblot on acid extracted proteins from colcemid-arrested HeLa cells (Catalog #17-306)
Target description
~17kDaLinkageReplaces: 05-792
Physical form
Cultured supernantant in 0.05% sodium azide
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
For maximum recovery of product, centrifuge the vial prior to removing the cap. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Analysis Note
Control
Acid extracted proteins from colcemid-arrested HeLa cellsLegal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form culture supernatant antibody product type primary antibodies clone NL41, monoclonal species reactivity human packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) immunocytochemistry: suitable","multiplexing: suitable","western blot: suitable isotype IgG NCBI accession no. NM_001809, UniProt accession no. P49450, shipped in dry ice Узнать цену -
Anti-phospho-cytokeratin-18 (K18) (Ser33) Antibody, clone IB4
eCl@ss: 32160702
Кат. номер MABT875-25UG MABT875-100UG General descriptionKeratin, type I cytoskeletal 18 (UniProt: P05783; also known as Cell proliferation-inducing gene 46 protein, Cytokeratin-18, CK-18, Keratin-18, K18) is encoded by the KRT18 (also known as CYK18, PIG46) gene (Gene ID: 3875) in human. Cytokeratin-18 is a type I, acidic, protein that is expressed in colon, placenta, and liver. Higher expression levels have been reported in lymph nodes of breast carcinoma. Cytokeratin-18 is involved in the uptake of thrombin-antithrombin complexes by hepatic cells. Upon phosphorylation, it plays a role in filament reorganization. It is proteolytically cleaved by caspases during epithelial cell apoptosis and this cleavage is shown to occur at Asp-238. Phosphorylation of cytokeratin-18 at serine 33 is shown to increase during mitosis in cultured cells and in regenerating liver. Serine 33 phosphorylation is considered to be essential for its association with 14-3-3 proteins and has a role in keratin organization and distribution. Cytokeratin-18 can undergo O-glycosylation, which results in its increased solubility and reduction in its stability. Mutations in KRT18 gene are known to cause liver cirrhosis characterized by severe panlobular liver-cell swelling with Mallory body formation, prominent pericellular fibrosis, and marked deposits of copper.
Specificity
Clone IB4 specifically detects human cytokeratin-18 phosphorylated on serine 33.ImmunogenKLH-conjugated linear peptide corresponding to 13 amino acids surrounding phosphorylated serine 33 (initiator methionine removed) from the N-terminal region of human cytokeratin-18.ApplicationResearch Category
Cell Structure
Immunocytochemistry Analysis: A representative lot detected phospho-cytokeratin-18 (K18) (Ser33) in immunocytochemistry applications (Ku, N.O., et. al. (1998). EMBO J. 17(7):1892-906).
Immunoprecipitation Analysis: A representative lot immunoprecipitated phospho-cytokeratin-18 (K18) (Ser33) in immunoprecipitation applications (Ku, N.O., et. al. (1998). EMBO J. 17(7):1892-906).
Immunofluorescence Analysis: A representative lot detected phospho-cytokeratin-18 (K18) (Ser33) in Immunofluorescence applications (Ku, N.O., et. al. (1998). EMBO J. 17(7):1892-906).
Western Blotting Analysis: A representative lot detected phospho-cytokeratin-18 (K18) (Ser33) in Western Blotting applications (Yoon, K.H., et. al. (2001). J Cell Biol. 153(3):503-16).
Anti-phospho-cytokeratin-18 (K18) (Ser33), clone IB4, Cat. No. MABT875, is a mouse monoclonal antibody that detects type I cytoskeletal-18 and has been tested for use in Immunocytochemistry, Immunofluorescence, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in lysates from HeLa cells treated with Calyculin A/Okadaic Acid.
Western Blotting Analysis: 2 µg/mL of this antibody detected phospho-cytokeratin-18 (K18) (Ser33) in lysate from HeLa cells treated with Calyculin A/Okadaic Acid.
Target description
~48 kDa observed; 48.06 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone IB4, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_000215, UniProt accession no. P05783, Gene Information human ... KRT18(3875) Узнать цену -
Anti-phospho-cytokeratin-8 (K8) (Ser431) Antibody, clone 5B3
eCl@ss: 32160702
Кат. номер MABT338-25UG MABT338-100UG General descriptionKeratin, type II cytoskeletal 8 (UniProt: P05787; also known as Cytokeratin-8, CK-8 Keratin-8, K8, Type-II keratin Kb80) is encoded by the KRT8 (also known as CYK8) gene (Gene ID: 3856) in human. Cytokeratin-8 is a type II, neutral to basic, protein of the intermediate filament family that together with Cytokeratin-19 (KRT19) helps to link the contractile apparatus to dystrophin at the costameres of striated muscle. Cytokeratin-8 can undergo phosphorylation on three major serine residues: Serine 23, 431, and 73. Serine 23 is shown to be highly conserved in all type II keratins. Phosphorylation at Serine 431 is reported to increase during mitosis and upon treatment with epidermal growth factor. Cytokeratin-8 can also undergo O-glycosylation in a cell cycle-dependent manner and glycosylation increases its solubility and reduces stability by inducing proteasomal degradation. Mutations in KRT8 gene have been linked to liver cirrhosis that is characterized by severe panlobular liver-cell swelling with Mallory body formation, prominent pericellular fibrosis, and marked deposits of copper. Two isoforms of Cytokeratin-8 have been described that are produced by alternative splicing.
Specificity
Clone 5B3 specifically detects cytokeratin-8 phosphorylated on serine 431.ImmunogenCytokeratin-8/18 purified from okadaic acid-treated HT29 cells.ApplicationImmunofluorescence Analysis: A representative lot detected phospho-cytokeratin-8 (K8) (Ser431) in Immunofluorescence applications (Ku, N.O., et. al. (1997). J Biol Chem. 272(11):7556-64).
Western Blotting Analysis: A representative lot detected phospho-cytokeratin-8 (K8) (Ser431) in Western Blotting applications (Yoon, K.H., et. al. (2001). J Cell Biol. 153(3):503-16; Ridge, K.M., et. al. (2005). J Biol Chem. 280(34):30400-5; Ku, N.O., et. al. (1997). J Biol Chem. 272(11):7556-64).
Anti-phospho-cytokeratin-8 (K8) (Ser431), clone 5B3, Cat. No. MABT338, is a mouse monoclonal antibody that detects type II Cytokeratin-8 phopshorylated on serine 431 and has been tested for use in Immunofluorescence and Western Blotting.
Quality
Evaluated by Western Blotting in lysates from HeLa cells treated with Calyculin A/Okadaic Acid.
Western Blotting Analysis: 2 µg/mL of this antibody detected phospho-cytokeratin-8 (K8) (Ser431) in lysate from HeLa cells treated with Calyculin A/Okadaic Acid.
Target description
~53 kDa observed; 53.70 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5B3, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001243222, UniProt accession no. P05787, Узнать цену -
Anti-phospho-cytokeratin-8 (K8) (Ser73) Antibody, clone LJ4
eCl@ss: 32160702
Кат. номер MABT344-25UG MABT344-100UG General descriptionKeratin, type II cytoskeletal 8 (UniProt: P05787; also known as Cytokeratin-8, CK-8 Keratin-8, K8, Type-II keratin Kb80) is encoded by the KRT8 (also known as CYK8) gene (Gene ID: 3856) in human. Cytokeratin-8 is a type II, neutral to basic, protein of the intermediate filament family that together with Cytokeratin-19 (KRT19) helps to link the contractile apparatus to dystrophin at the costameres of striated muscle. Cytokeratin-8 can undergo phosphorylation on three major serine residues: Serine 23, 431, and 73. Serine 23 is shown to be highly conserved in all type II keratins. Phosphorylation at Serine 73 is reported to increase during cellular stress, including hear and drug exposure. However, under normal conditions serine 73 remains largely dephosphorylated. Cytokeratin-8 can also undergo O-glycosylation in a cell cycle-dependent manner and glycosylation increases its solubility and reduces stability by inducing proteasomal degradation. Mutations in KRT8 gene have been linked to liver cirrhosis that is characterized by severe panlobular liver-cell swelling with Mallory body formation, prominent pericellular fibrosis, and marked deposits of copper. Two isoforms of Cytokeratin-8 have been described that are produced by alternative splicing.
Specificity
Clone LJ4 detects human cytokeratin-8 phosphorylated on serine 73 and murine cytokeratin-8 phosphorylated on serine 79.ImmunogenCytokeratin-8 purified from HT29 cells treated with okadaic acid (1 mg/ml, 2h).ApplicationImmunofluorescence Analysis: A representative lot detected phospho-cytokeratin-8 (K8) (Ser73) in Immunofluorescence applications (McIntosh, P.B., et. al. (2010). J Cell Sci. 123(Pt 16):2810-22; Liao, J., et. al. (1997). J Biol Chem. 272(28):17565-73; Ku, N.O., et. al. (2003). Hepatology. 37(5):1006-14; Toivola, D.M., et. al. (2002). Mol Biol Cell. 13(6):1857-70).
Immunoprecipitation Analysis: A representative lot immunoprecipitaated phospho-cytokeratin-8 (K8) (Ser73) in Immunoprecipitation applications (Ku, N.O., et. al. (2003). Hepatology. 37(5):1006-14; Liao, J., et. al. (1997). J Biol Chem. 272(28):17565-73).
Immunocytochemistry Analysis: A representative lot detected phospho-cytokeratin-8 (K8) (Ser73) in Immunocytochemistry applications (Toivola, D.M., et. al. (2002). Mol Biol Cell. 13(6):1857-70).
Western Blotting Analysis: A representative lot detected phospho-cytokeratin-8 (K8) (Ser73) in Western Blotting applications (Toivola, D.M., et. al. (2002). Mol Biol Cell. 13(6):1857-70; Ku, N.O., et. al. (2003). Hepatology. 37(5):1006-14; Liao, J., et. al. (1997). J Biol Chem. 272(28):17565-73; McIntosh, P.B., et. al. (2010). J Cell Sci. 123(Pt 16):2810-22).
ELISA Analysis: A representative lot detected phospho-cytokeratin-8 (K8) (Ser73) in ELISA applications (Liao, J., et. al. (1997). J Biol Chem. 272(28):17565-73).
Anti-phospho-cytokeratin-8 (K8) (Ser73), clone LJ4, Cat. No. MABT344, is a mouse monoclonal antibody that detects human type II cytoskeletal 8 phophrorylated on serine 73 and murine cytokeratin-8 phophorylated on serine 79 and has been tested for use in ELISA, Immunocytochemistry, Immunofluoresce
Quality
Evaluated by Western Blotting in lysates from HeLa cells treated with Calyculin A/Okadaic Acid.
Western Blotting Analysis: 2 µg/mL of this antibody detected phospho-cytokeratin-8 (K8) (Ser73) in lysate from HeLa cells treated with Calyculin A/Okadaic Acid, but not in lysate from untreated cells.
Target description
~53 kDa observed; 53.70 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone LJ4, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunocytochemistry: suitable","immunofluorescence: suitable isotype IgG1 NCBI accession no. NP_001243222, UniProt accession no. P05787, Узнать цену -
Anti-phospho-E2F1 (Ser375) Antibody, clone 71-10
eCl@ss: 32160702
Кат. номер MABE1782-25UL MABE1782-100UL General descriptionTranscription factor E2F1 (UniProt: Q01094; also known as E2F-1, PBR3, Retinoblastoma-associated protein 1, RBAP-1, Retinoblastoma-binding protein 3, RBBP-3, pRB-binding protein E2F-1) is encoded by the E2F1 (also known as RBBP3) gene (Gene ID: 1869) in human. E2F-1 is a transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5-TTTC[CG]CGC-3 found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. It is a component of the DRTF1/E2F transcription factor complex and forms heterodimers with DP family members. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F1 complex is shown to bind specifically hypophosphorylated retinoblastoma protein RB1. During the cell cycle, RB1 becomes phosphorylated in mid-to-late G1 phase and detaches from the DRTF1/E2F complex that renders E2F transcriptionally active. E2F-1 can be phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase. It is also phosphorylated at serine 364 by CHEK2, which stabilizes it upon DNA damage and regulates its effect on transcription and apoptosis. Acetylation of E2F-1 by P/CAF/KAT2B stimulates its DNA-binding.
Specificity
Clone 71-10 is a rabbit monoclonal antibody that specifically detects human E2F1 phosphorylated on Serine 375.ImmunogenKLH-conjugated linear peptide corresponding to 17 amino acids surrounding phosphoserine 375 from the C-terminal region of human transcription factor E2F1.ApplicationAnti-phospho-E2F1 (Ser375), clone 71-10, Cat. No. MABE1782, is a highly specific rabbit monoclonal antibody that targets Transcription factor E2F1 phosphorylated on Serine 375 and has been tested in ELISA and Western Blotting.
Research Category
Epigenetics & Nuclear Function
ELISA Analysis: A representative lot detected phospho-E2F1 (Ser375) in ELISA applications (Dale, T., et. al. (2015). Nat Chem Biol. 11(12):973-980).
Quality
Evaluated by Western Blotting in HEK293 cells transfected with pcDNA3.1 empty vector, HEK 293 cells transfected with E2F1 wild type-GST, HEK 293 cells transfected with E2F1 wild type-GST with alanine substituted for serine at 375.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected phospho-E2F1 (Ser375) in HEK293 cells transfected with E2F1 wild type-GST,, but not in HEK 293 cells transfected with E2F1 wild type-GST with alanine substituted for serine at 375.
Target description
~80 kDa observed ( GST fusion protein); 46.92 kDa calculated (without GST). Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit monoclonal antibody IgG in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form purified antibody antibody product type primary antibodies clone 71-10, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) ELISA: suitable","western blot: suitable isotype IgG NCBI accession no. NP_005216.1, UniProt accession no. Q01094, Узнать цену -
Anti-phospho-EGFR (Tyr1173) Antibody, clone 9H2, Alexa Fluor® 488 16-244
eCl@ss: 32160702 NACRES: NA.41
Specificity
the motif NAE[pY]LRV corresponding to the major autophosphorylation site of the human EGFRImmunogenKLH-conjugated, synthetic peptide containing the Y1173 motif (...NAE[pY1173]LRV...) of the human EGFRApplicationResearch Category
Signaling
Anti-phospho-EGFR (Tyr1173) Antibody, clone 9H2, Alexa Fluor 488 detects level of phospho-EGFR (Tyr1173) & has been published & validated for use in FC & IC.
Research Sub Category
Growth Factors & Receptors
Quality
Routinely evaluated by positive immunostaining for phospho-EGFR in A431 cells.
Target description
175kDa
Storage and Stability
1 year at 4°C from date of shipmentLegal InformationALEXA FLUOR is a registered trademark of Life Technologies
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Alexa Fluor® is a registered trademark of Molecular Probes, Inc.
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form affinity purified immunoglobulin antibody product type primary antibodies clone 9H2, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) flow cytometry: suitable","immunocytochemistry: suitable isotype IgG1 conjugate ALEXA FLUOR® 488 NCBI accession no. NM_005228.3,","NM_201282.1,","NM_201283.1,","NM_201284.1, UniProt accession no. P00533, shipped in wet ice Узнать цену -
Anti-phospho-eIF-2 (Ser51)
eCl@ss: 32160702
Кат. номер 7-760-I-25UL 7-760-I General descriptionNuclear receptor subfamily 5 group A member 2 (UniProt: O00482; also known as Alpha-1-fetoprotein transcription factor, B1-binding factor, hB1F, CYP7A promoter-binding factor, Hepatocytic transcription factor, Liver receptor homolog 1, LRH-1) is encoded by the NR5A2 (also known as B1F, CPF, FTF) gene (Gene ID: 2494) in human. It is a member of the nuclear receptor superfamily that binds to the sequence element 5-AACGACCGACCTTGAG-3 of the enhancer II of hepatitis B virus genes. It contains a DNA binding region (aa 83-104) and two NR C4-type zinc finger domains (aa 86-106 and 122-146). It is abundantly expressed in pancreas, but at reduced levels in liver, and at very low levels in heart and lung. It s expression has been demonstrated in the Hep-G2 cell line. Four different isoforms of LRH-1 have been described that are generated by alternate splicing. LRH-1 is reported to be involved in the regulation of expression of transcription factors, such as Oct4, HNF1, 3, and 4, which are known to participate in embryonic development. Its presence in high levels in beta-III Tubulin+ and NeuN+ neurons of the mantle zone (MZ) in early neural tube of mice (E10.5 and E12.5) indicate its involvement in neural differentiation. (Ref.: Stergiopoulos, A., and Politis, PK (2016). Nat. Commun. DOI: 10.1038/ncomms12230; Venteclef, N et al. (2008). J. Biol. Chem. 283(7); 3694 3701).
Specificity
This rabbit polyclonal antibody detects elf-2 alpha phosphorylated on Serine 51 in human.ImmunogenKLH-conjugated linear peptide corresponding to 13 amino acids surrounding phosphorylated ser51 of human Eukaryotic translation initiation factor 2 subunit 1.
Epitope: N-terminusApplicationAnti-phospho-eIF-2 (Ser51), Cat. No. 07-760-I, is a rabbit polyclonal antibody that detects Eukaryotic translation initiation factor 2 subunit 1 and has been tested for use in Peptide Inhibition Assay and Western Blotting.
Peptide Inhibition Assay: A 1:1,000 dilution from a representative lot detected phospho-eIF-2 (Ser51) in HeLa treated Calyculin A.
Research Category
Signaling
Quality
Evaluated by Western Blotting in HeLa treated with Calyculin A cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected phospho-eIF-2 (Ser51) in HeLa treated with Calyculin A cell lysate.
Target description
~38 kDa observed; 38.65 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) Drosophila (based on 100% sequence homology), rat (based on 100% sequence homology), bovine (based on 100% sequence homology) packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) ChIP: suitable (ChIP-seq)","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_001285329, UniProt accession no. P41374, shipped in ambient Узнать цену -
Anti-phospho-erbB-2/HER-2 (Tyr1248) Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 6-229-25UL 6-229 6-229-100UL General descriptionThe ErbB-2 proto-oncogene, also called Neu, EGFR-2 or HER-2, is a member of the transmembrane receptor tyrosine kinase family, which also includes EGF receptor and EGFR-3 (HER-3 or ErbB-3). Although, ErbB-2 does not have any known high-affinity ligands, its kinase activity can be activated without ligand by either overexpression or heteroassociation with other members of the ErbB family. Amplification of the ErbB-2 gene and overexpression of its product has been detected in almost 40% of primary human breast tumors, which correlates with poor prognosis in node positive breast cancer. ErbB-2 overexpression is also observed in ovarian, gastric, salivary and non-small cell lung carcinomas. Because of this, ErbB-2 is one of the major drug targets for breast cancer and other cancer treatments.
Specificity
Predicted to cross react with rat based on conservation of immunogenic sequence.
Recognizes and is specific for the activated form of erbB-2/HER-2 oncoprotein, MW ~138 kDa.ImmunogenSynthetic phosphopeptide, residues 1243-1255, corresponding to a major auto-phosphorylation (Tyr1248) site of human erbB-2/HER-2 (C-AENPEpYLGLDVPV).
Epitope: Tyr1248ApplicationResearch Sub Category
Growth Factors & Receptors
Kinases & Phosphatases
Research Category
Signaling
This Anti-phospho-erbB-2/HER-2 (Tyr1248) Antibody is validated for use in IC, WB for the detection of phospho-erbB-2/HER-2 (Tyr1248).
Immunohistochemistry:
IHC was performed by an independent laboratory.
Immunocytochemistry:
2 µg/mL of a previous lot showed positive immunostaining for phospho-erbB2/HER-2 in EGF treated A431 cells.
Quality
Evaluated by Western Blot on A431+/-EGF lysates.
Western Blotting Analysis:
1:1000 dilution of this antibody detected phospho-erbB2/Her2 on 10 µg of A431+EGF lysates.
Target description
185 kDa
Physical form
Double immunoaffinity purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH7.4
ImmunoAffinity Purified
Storage and Stability
Stable for 1 year at -20C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Analysis Note
Control
EGF treated A431 cellsOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat, human packaging antibody small pack of 25 µL Торговая марка Upstate® application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NM_004448, UniProt accession no. P04626, shipped in ambient Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
