Antibodies
- Сортировать:
- Вид таблицей
-
Anti-Neuregulin-1 Antibody, clone 4F10
eCl@ss: 32160702
Кат. номер MABN2292-25UG MABN2292-100UG General descriptionNeuregulin-1 (UniProt: Q02297; also known as Acetylcholine receptor-inducing activity, ARIA, Breast cancer cell differentiation factor p45, Glial growth factor, Heregulin, HRG, Neu differentiation factor, Sensory and motor neuron-derived factor) is encoded by the NRG1 (also known as GGF, HGL, HRGA, NDF, SMDF) gene (Gene ID: 3084) in human. Neuregulin-1 is a single-pass type 1 membrane protein that acts as a direct ligand for ErbBB3 and ErbB4 tyrosine kinase receptors. It concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Eleven isoforms of Neuregulin-1 are known that are produced by alternative splicing. They have been classified as type I (isoforms with an Ig domain and a glycosylation domain) type II NRGs (isoforms with an Ig domain, but no glycosylation domain). These multiple isoforms perform diverse cellular functions, such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells and inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction. Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form. Dual cleavage of Neuregulin-1 by beta-secretase 1 (BACE1) and ADAM17 is shown to liberate EGF-like domain, which stimulates ErbB3 signaling. (Ref.: Fleck, D., et a. (2013). J. Neurosci. 33(18):7856-7869).
Specificity
Clone 4F10 is a rat monoclonal antibody that detects human Neuregulin-1. It targets an epitope within 10 amino acids from the N-terminal half.ImmunogenA linear peptide corresponding to 10 amino acids from the N-terminal, extracellular domain of human Neuregulin 1, isoform 6.
Epitope: extracellular domainApplicationWestern Blotting Analysis: A representative lot detected Neuregulin-1 in Western Blotting applications (Fleck, D., et. al. (2013). J Neurosci. 33(18):7856-69; Cheret, C., et. al. (2013). EMBO J. 32(14):2015-28; Fleck, D., et. al. (2016). J Biol Chem. 291(1):318-33; Ben Halima, S., et. al. (2016). Cell Rep. 14(9):2127-2141).
Anti-Neuregulin-1 clone 4F10, Cat. No. MABN2292, is a highly specific rat monoclonal antibody that targets Typ III NRG1 beta-1 and has been tested for use in Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in HEK293 cells transfected with Type I NRG1 and Type III NRG1 and treated with BACE inhibitor.
Western Blotting Analysis: 1 µg/mL of this antibody detected Neuregulin-1 in HEK293 cells transfected with Type I NRG1 and Type III NRG1 and treated with BACE inhibitor.
Target description
~ 71 kDa observed; 71.16 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified antibody antibody product type primary antibodies clone 4F10, monoclonal species reactivity human species reactivity (predicted by homology) mouse (based on 100% sequence homology), chimpanzee (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2b NCBI accession no. NP_039250, UniProt accession no. Q02297-6, Gene Information human ... NRG1(3084) Узнать цену -
Anti-Neuritin (CPG15) Antibody, clone A6.1
eCl@ss: 32160702
Кат. номер MABN1840-25UG MABN1840-100UG General descriptionNeuritin (UniProt: Q9NPD7) is encoded by the NRN1 (also known as NRN) gene (Gene ID: 51299) in human. Neuritin, a conserved, glycosylphosphatidylinositol (GPI)-anchored protein that plays a role in the development, survival and function of neurons. Its activity is induced by brain-derived neurotrophic factor (BDNF) and neurotrophin-3 (NT-3). It is highly expressed by induced and natural regulatory T cells (TREGs). It also promotes the maintenance of the TREGs pool by stabilizing Foxp3 expression and promoting the persistence of these cells. Deficiency of Neuritin is shown to result in an imbalance between central and peripheral TREG populations and functions. Neuritin has a wide variety of effects in the nervous system, such as promoting neurite outgrowth, modulating neurite outgrowth during neuronal differentiation, and protecting motor neuron axons. It can also promote dendritic growth, regulate synaptic plasticity, and stabilize active synapses, and promote synaptic maturation. Its expression in the hippocampus is shown to be induced by neuronal activity following chemical- or electrical-induced seizures, ischemia, and exercise. Chronic antidepressant treatment is reported to increase neuritin expression in rat brain. Neuritin is synthesized with a signal peptide (aa 1-27) and a propeptide (aa 28-116) that are cleaved off in the mature form (aa 117-142). (Ref.: Son, H., et al. (2012). Proc. Natl. Acad. Sci. USA. 109(28); 11378-83; Zhou, S., and Zhou, J (2014). Curr. Med. Chem. 21(10); 1212-19). Note: A6.1 hybridoma clone, and WT/KO validation, courtesy of Lauren Makuch and Dr. Elly Nedivi, Massachusetts Institute of Technology.
Specificity
Clone A6.1 detects human and rat Neuritin.ImmunogenGST-tagged full-length human recombinant Neuritin.ApplicationResearch Category
Neuroscience
Anti-Neuritin (CPG15), clone A6.1, Cat. No. MABN1840, is a highly specific mouse monoclonal antibody that targets Neuritin and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting with recombinant human/rat neuritin.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected recombinant human/rat Neuritin (CPG15).
Target description
~15 kDa observed; 15.33 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone A6.1, monoclonal species reactivity rat, human species reactivity (predicted by homology) monkey (based on 100% sequence homology), bovine (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2b NCBI accession no. NP_001265639, UniProt accession no. Q9NPD7, Gene Information human ... NRN1(51299)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Neurocan
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABT1382 ABT1382-25UL General descriptionNeurocan core protein (UniProt: P55067; also known as 245 kDa early postnatal core glycoprotein, Chondroitin sulfate proteoglycan 3) is encoded by the Ncan (also known as Cspg3) gene in rat. Neurocan is a secreted protein of the aggrecan/versican proteoglycan family that is found in early postnatal and adult brain. During early postnatal development neurocan accounts for at least 20% of the protein of the soluble brain proteoglycans. Neurocan mostly contains chondroitin sulfate, but also has N-linked and O-linked oligosaccharides. It is shown to be involved in the modulation of cell adhesion and migration and regulates neurite outgrowth. Neurocan interact with several cell surface molecules, such as N-CAM, L1/Ng-CAM, etc., and modulates the cell-binding and neurite outgrowth promoting activates of these molecules. Neurocan is synthesized with a 22 aa signal peptide that is subsequently cleaved to produce the mature form. Neurocan contains one C-type lectin domain, two EGF-like domains, one Ig-like V type domain, two link domains and one Sushi (CCP/SCR) domain. (Ref.: Rauch, U., et al. (2001) Cell Mol. Life Sci. 58(12-13):1842-56; Zhou, XH et al. (2001). Mol. Cell Biol. 21(17): 5970-78).
Specificity
This rabbit polyclonal antibody detects Neurocan in fetal and adult rat brain.ImmunogenFull-length Neurocan isolated from 7-day embryonic rat brain and purified by monoclonal antibody immunoaffinity chromatography.
Epitope: unknownApplicationResearch Category
Cell Structure
This rabbit polyclonal Anti-Neurocan, Cat. No. ABT1382, is a rabbit polyclonal antibody that detects Neurocan core protein and has been tested for use in Immunofluorescence.
Quality
Evaluated by Immunofluorescence in E14 embryonic rat brain (frozen sections) and adult rat brain (frozen sections).
Immunofluorescence Analysis: A 1:500 dilution of this antibody detected Neurocan in E14 embryonic rat brain (frozen sections) and rat E14 neocortex.
Target description
135.55 kDa calculated.
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form unpurified antibody product type primary antibodies clone polyclonal species reactivity rat packaging antibody small pack of 25 µL application(s) immunofluorescence: suitable isotype IgG NCBI accession no. NP_113841 (neurocan core protein precursor), UniProt accession no. P55067, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Neurocan Antibody, C-terminal
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABT1347 ABT1347-25UL General descriptionNeurocan core protein (UniProt: P55067; also known as 245 kDa early postnatal core glycoprotein, Chondroitin sulfate proteoglycan 3) is encoded by the Ncan (also known as Cspg3) gene in rat. Neurocan is a secreted protein of the aggrecan/versican proteoglycan family that is found in early postnatal and adult brain. During early postnatal development neurocan accounts for at least 20% of the protein of the soluble brain proteoglycans. Neurocan mostly contains chondroitin sulfate, but also has N-linked and O-linked oligosaccharides. It is shown to be involved in the modulation of cell adhesion and migration and regulates neurite outgrowth. Neurocan interact with several cell surface molecules, such as N-CAM, L1/Ng-CAM, etc., and modulates the cell-binding and neurite outgrowth promoting activates of these molecules. Neurocan is synthesized with a 22 aa signal peptide that is subsequently cleaved to produce the mature form. Neurocan contains one C-type lectin domain, two EGF-like domains, one Ig-like V type domain, two link domains and one Sushi (CCP/SCR) domain. (Ref.: Rauch, U., et al. (2001) Cell Mol. Life Sci. 58(12-13):1842-56; Zhou, XH et al. (2001). Mol. Cell Biol. 21(17): 5970-78).
Specificity
This rabbit polyclonal antibody detects Neurocan in fetal and adult rat brain.ImmunogenEpitope: C-terminus
GST-tagged recombinant fragment corresponding to 212 amino acids from the C-terminal half of rat Neurocan core protein.ApplicationRadioimmunoassay Analysis: A representative lot detected Neurocan in rat brain (Milev, P., et. al. (1998). Biochem Biophys Res Commun. 247(2):207-12).
Immunohistochemistry Analysis: A representative lot detected Neurocan in E13 and E14 mouse ventral diencephalon and retina in C57 mouse embryos (Leung, K.M., et. al. (2004). Brain Res Dev Brain Res. 152(1):1-10).
Research Category
Cell Structure
Anti-Neurocan, C-terminal, Cat. No. ABT1347, is a rabbit polyclonal antibody that detects Neurocan core protein and has been tested for use in Immunofluorescence, Immunohistochemistry, and Radioimmunoassay.
Quality
Evaluated by Immunofluorescence in E14 rat embryo, E14 rat neocortex, and adult rat brain hippocampus cells.
Immunofluorescence Analysis: A 1:500 dilution of this antibody detected Neurocan in E14 rat embryo, E14 rat neocortex, and adult rat brain hippocampus cells.
Target description
135.55 kDa calculated.
Physical form
Format: Unpurified
Rabbit polyclonal antiserum with 0.02% sodium azide.
Unpurified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form unpurified antibody product type primary antibodies clone polyclonal species reactivity rat, mouse packaging antibody small pack of 25 µL application(s) immunofluorescence: suitable","immunohistochemistry: suitable","radioimmunoassay: suitable isotype IgG NCBI accession no. NP_113841 (neurocan core protein precursor), UniProt accession no. P55067, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Neurocan antibody, Mouse monoclonal
MDL number: MFCD02263808 NACRES: NA.41
Кат. номер N0913-200UL N0913-25UL General descriptionMonoclonal Anti-Neurocan (mouse IgG1 isotype) is derived from the hybridoma 650.24 produced by the fusion of mouse myeloma cells (P3X cells) and splenocytes from BALB/c mice immunized with embryonic rat brain proteoglycans. Neurocan is a chondroitin sulfate proteoglycan (known also as CSPG3). It accounts for 20−30% of chondroitin sulfate proteoglycans in early postnatal rat brain. The mouse neurocan cDNA encodes for a 1,257-amino acid protein with a 22-amino acid signal peptide followed by an immunoglobulin-like domain and repeating motifs characteristic of the hyaluronic acid-binding region of aggregating proteoglycans. Neurocan is found in large amounts in glial scar, a primarily astrocytic structure formed after an injury in the central nervous system (CNS).
Neurocan is a proteoglycan which is expressed in the nervous tissue.Immunogenembryonic rat brain proteoglycans.ApplicationAnti-Neurocan antibody, Mouse monoclonal has been used in:- western blotting
- immunofluorescence
- enzyme-linked immunosorbent assay (ELISA)
- immunocytochemistry
- immunohistochemistry
Biochem/physiol Actions
Neurocan can inhibit the growth of axons. In presence of central nervous system injuries, it also takes part in tissue repair and neural network reconstruction.
Neurocan participates in the modulation of cell adhesion and migration. It exerts a negative effect on growing cerebellar axons.
Target description
Neurocan is a chondroitin sulfate proteoglycan (knownalso as CSPG3) thought to be involved in the modulation of cell adhesion and migration. It accounts for 20-30% of chondroitin sulfate proteoglycans in early postnatal rat brain.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone 650.24, monoclonal form buffered aqueous solution mol wt antigen 260 kDa (additional band at 160 kDa) species reactivity rat packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunocytochemistry: suitable","immunohistochemistry (frozen sections): suitable","indirect ELISA: suitable","western blot: 0.1-0.2 µg/mL using neonatal rat brain treated with chondroitinase. isotype IgG1 conjugate unconjugated UniProt accession no. P55067, shipped in dry ice storage temp. 20°C Gene Information rat ... Ncan(58982)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Neurocan Antibody, N-terminal
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABT1384 ABT1384-25UL General descriptionNeurocan core protein (UniProt: P55067; also known as 245 kDa early postnatal core glycoprotein, Chondroitin sulfate proteoglycan 3) is encoded by the Ncan (also known as Cspg3) gene in rat. Neurocan is a secreted protein of the aggrecan/versican proteoglycan family that is found in early postnatal and adult brain. During early postnatal development neurocan accounts for at least 20% of the protein of the soluble brain proteoglycans. Neurocan mostly contains chondroitin sulfate, but also has N-linked and O-linked oligosaccharides. It is shown to be involved in the modulation of cell adhesion and migration and regulates neurite outgrowth. Neurocan interact with several cell surface molecules, such as N-CAM, L1/Ng-CAM, etc., and modulates the cell-binding and neurite outgrowth promoting activates of these molecules. Neurocan is synthesized with a 22 aa signal peptide that is subsequently cleaved to produce the mature form. Neurocan contains one C-type lectin domain, two EGF-like domains, one Ig-like V type domain, two link domains and one Sushi (CCP/SCR) domain. (Ref.: Rauch, U., et al. (2001) Cell Mol. Life Sci. 58(12-13):1842-56; Zhou, XH et al. (2001). Mol. Cell Biol. 21(17): 5970-78).ImmunogenGST-tagged recombinant fragement corresponding to 164 amino acids from the N-terminal region of rat Neurocan.ApplicationAnti-Neurocan, N-terminal, Cat. No. ABT1384, is a rabbit polyclonal antibody that detects Neurocan core protein and has been tested for use in Immunofluorescence, Immunohistochemistry, and Radioimmunoassay.
Radioimmunoassay Analysis: A representative lot detected Neurocan in rat brain (Milev, P., et. al. (1998). Biochem Biophys Res Commun. 247(2):207-12).
Immunohistochemistry Analysis: A representative lot detected Neurocan in E13 and E14 mouse ventral diencephalon and retina in C57 mouse embryos (Leung, K.M., et. al. (2004). Brain Res Dev Brain Res. 152(1):1-10).
Quality
Evaluated by Immunofluorescence in E14 Embryonic rat brain (frozen section), rat E14 neocortex, and rat hippocampus cells.
Immunofluorescence Analysis: A 1:500 dilution of this antibody detected Neurocan in E14 Embryonic rat brain (frozen section), rat E14 neocortex, and rat hippocampus cells.
Target description
135.55 kDa calculated.
Physical form
Format: UnpurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form unpurified antibody product type primary antibodies clone polyclonal species reactivity rat, mouse packaging antibody small pack of 25 µL application(s) immunofluorescence: suitable","immunohistochemistry: suitable","radioimmunoassay: suitable isotype IgG NCBI accession no. NP_113841 (neurocan core protein precursor), UniProt accession no. P55067, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NeuroD1 antibody produced in rabbit
MDL number: MFCD03097085 NACRES: NA.41
Кат. номер N3663-25UL N3663-200UL General descriptionNeuroD1 gene is mapped to human chromosome 2q31.3.
Neuronal differentiation 1 (NEUROD1) is a transcription factor which is highly expressed in the brain, pancreas and retina.
Specificity
Anti-NeuroD1 specifically recognizes human, mouse and rat NeuroD1.Immunogensynthetic peptide corresponding to amino acids 76-91 of human NeuroD1 conjugated to BSA. The corresponding sequence differs in mouse and rat by two and three amino acids, respectively.ApplicationAnti-NeuroD1 antibody produced in rabbit has been used in chromatin immunoprecipitation and immunoblotting.
Biochem/physiol Actions
NeuroD1 is a basic helix-loop-helix (bHLH) transcription factor, which regulates the fate of specific neuronal, endocrine and retinal cells.
Neuronal differentiation 1 (NEUROD1) binds to promoters and regulates gene expression. It can also enhance tumor cell survival in lung tumors. Mutations in the gene encoding NEUROD1 have been associated with neurological problems and early-onset diabetes.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~45 kDa (doublet bands) species reactivity human, rat, mouse packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) western blot: 0.5-1 µg/mL using whole extracts of HEK-293T cells expressing human NeuroD1 conjugate unconjugated UniProt accession no. Q13562, shipped in dry ice storage temp. 20°C Gene Information human ... NEUROD1(4760)
mouse ... Neurod1(18012)
rat ... Neurod1(29458)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Neurofibromin C Antibody, clone NFC
eCl@ss: 32160702
Кат. номер MABE1820-25UL MABE1820-100UL General descriptionNeurofibromin (UniProt: P21359; also known as Neurofibromatosis-related protein NF-1) is encoded by the NF1 gene (Gene ID: 4763) in human. Neurofibromin is a GTPase-activating protein that negatively regulatres RAS/MAOK pathway by enhancing the hydrolysis of Ras-bound GTP. Hence, it can display tumor suppressor properties. Neurofibromin has been detected in brain, peripheral nerves, lung, colon, and muscle tissues. It has a CRAL-TRIO domain (aa 1580-1738) that facilitates its binding to phospholipids. It binds primarily glycerophospholipids with monounsaturated C18:1 and/or C16:1 fatty acid moieties and a phosphatidylethanolamine or phosphatidylcholine head group. Neurofibromin also has a Ras-GTP domain (aa 1235-1451). Mutations in NF1 gene are known to cause Neurofibromatosis type I that involved tumors in the peripheral nervous system and fibromatous skin tumors. Some mutations are also known to cause colorectal cancer and juvenile leukemia. Six different isoforms of Neurofibromin have been described that are produced by alternative splicing. (Ref.: Rossi, S., et al. (2018). Mod. Pathol. 31(1), 160-168).
Specificity
Clone NFC specifically detects human Neurofibromin C. it targets an epitope with in the C-terminal region.ImmunogenRecombinant fragment corresponding to 281 amino acids from the C-terminal region of human Neurofibromin C.
Epitope: C-terminusApplicationAnti-Neurofibromin C, clone NFC, Cat. No. MABE1820, is a highly specific mouse monoclonal antibody that targets Neurofibromin and has been tested for use in Immunohistochemistry (Paraffin).
Immunohistochemistry (Paraffin) Analysis: A representative lot detected Neurofibromin C in Immunohistochemistry applications (Rossi, S., et. al. (2018). Mod Pathol. 31(1):160-168).
Western Blotting Analysis: A representative lot detected Neurofibromin C lysate from human NF1 +/+ cells, but not in -/- cells or NF1+/+ cells transfected with siRNA targeting neurofibromin (Reuss, DE.,et al., (2014). Acta Neuropathol. 127(4); 565-572).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Immunohistochemistry (Paraffin) in human kidney tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected Neurofibromin C in human kidney tissue sections.
Target description
319.37 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone NFC, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin) isotype IgG1 UniProt accession no. P21359, Gene Information human ... NF1(4763) Узнать цену -
Anti-Neurofilament NF-H Antibody, phosphorylated Antibody, clone NP1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MAB1592-C MAB1592-C-25UG General descriptionNeurofilament heavy polypeptide (UniProt: P12036; also known as NF-H, 200 kDa neurofilament protein, Neurofilament triplet H protein) is encoded by the NEFH (also known as KIAA0845, NFH) gene (Gene ID: 4744) in human. Neurofilaments (~ 10 nm in diameter) are intermediate filaments that serve as major elements of the cytoskeleton supporting the axon cytoplasm. They are the most abundant fibrillar components of the axon, being on average 3-10 times more frequent than axonal microtubules. They are built from three intertwined protofibrils, which are themselves composed of two tetrameric protofilament complexes of monomeric proteins. The neurofilament triplet proteins (68/70, 160, and 200 kDa) occur in both the central and peripheral nervous system and are usually neuron specific. The 68/70 kDa NF-L protein can self-assemble into a filamentous structure, however the 160 kDa NF-M and 200 kDa NF-H proteins require the presence of the 68/70 kDa NF-L protein to co-assemble. Antibodies to NF-H are useful for identifying neuronal cells and their processes in tissue sections and in tissue culture. NF-H antibodies are helpful in the identification of neurofilament accumulations seen in many neurological diseases, such as Amyotrophic lateral sclerosis (ALS) and Alzheimers disease. The purified immunogen used to generate this antibody was the very heavily phosphorylated form of NF-H and this antibody binds only this heavily phosphorylated form. Similar, but far fewer phosphorylation sites are also found in NF-M. Hence, this antibody displays some reactivity with NF-M. Enzymatic phosphorylation of porcine and bovine neurofilaments is shown to result in loss of binding.
Specificity
Clone NP1 detects heavily phosphorylated form of Neurofilament H. Displays weaker reactivity with phosphorylated Neurfilament -M.ImmunogenNative Neurofilament H purified from pig spinal cord.ApplicationImmunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Neurofilament NF-H in human ovary tissue.
Immunohistochemistry Analysis: A representative lot detected Neurofilament NF-H in Immunohistochemistry applications (Benson, D.L., et. al. (1996). J Neurocytol. 25(3):181-96; Boylan, K., et. al. (2009). J Neurochem. 111(5):1182-91).
Western Blotting Analysis: A representative lot detected Neurofilament NF-H in Western Blotting applications (Benson, D.L., et. al. (1996). J Neurocytol. 25(3):181-96; Boylan, K., et. al. (2009). J Neurochem. 111(5):1182-91).
ELISA Analysis: A representative lot detected Neurofilament NF-H in ELISA applications (Boylan, K., et. al. (2009). J Neurochem. 111(5):1182-91; Toedebusch, C.M., et. al. (2017). J Vet Intem Med. 31(2):513-520; Mashita, T., et. al. (2015). J Vet Med Sci. 77(4):433-8).
Research Category
Neuroscience
Anti-Neurofilament NF-H, phosphorylated, clone NP1, Cat. No. MAB1592-C, is a highly specific mouse monoclonal antibody that targets Neurofilament heavy polypeptide and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Quality
Evaluated by Immunohistochemistry in human cerebral cortex tissue.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected Neurofilament NF-H in human cerebral cortex tissue.
Target description
112.48 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS with 5 mM sodium azide and 50% glycerol.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone NP1, monoclonal species reactivity mouse, human, rat, canine species reactivity (predicted by homology) porcine (based on 100% sequence homology), bovine (based on 100% sequence homology), chicken (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_066554, UniProt accession no. P12036, shipped in ambient Узнать цену -
Anti-Neurogranin
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 7-425-I-25UG 7-425-I-100UG General descriptionNeurogranin (UniProt: Q92686; also known as Ng, RC3) is encoded by the NRGN gene (Gene ID: 4900) in human. Neurogranin is abundantly expressed in cerebral cortex, hippocampus, amygdala, and striatum. In neurons, it is found concentrated at dendritic spines. It acts as a third messenger and serves as a substrate for protein kinase C-mediated molecular cascades during synaptic development and remodeling. It contains an IQ domain (aa 26-347) and a collagen-like domain (aa 48-78). The IQ domain mediates its interaction with calmodulin and phosphatidic acid (PA). Neurogranin is intrinsically unstructured, however, upon binding with calmodulin, the IQ domain adopts a helical conformation. Neurogranin is phosphorylated at serine 36 by protein kinase C and following phosphorylation neurogranin is unable to bind either calmodulin or PA, which can lead to decline in memory-associated functions. Higher levels of neurogranin have also been reported in brains of elderly and is considered a factor in memory decline, independent of Alzheimer s disease. (Ref.: Javier Dez-Guerra, F. (2010). Life. 62(8): 597-606; Casaletto, KB et al. (2017). Neurology 89(17); 1782-1788).
Specificity
This rabbit polyclonal antibody sepecifically detects Neurogranin. It targets an epitope with in 12 amino acids from the C-terminal region.ImmunogenEpitope: C-terminus
KLH-conjugated linear peptide corresponding to 12 amino acids from the C-terminal region of human Neurogranin.ApplicationAnti-Neurogranin Antibody, Cat. No. 07-425-I, is a highly specific rabbit polyclonal antibody that targets Neurogranin and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected Neurogranin in human and rat brain tissue sections.
Quality
Evaluated by Western Blotting in rat brain tissue lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected Neurogranin in rat brain tissue lysate.
Target description
~15 kDa observed; 7.62 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human, rat species reactivity (predicted by homology) mouse (based on 100% sequence homology), goat (based on 100% sequence homology), bovine (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_001119653, UniProt accession no. Q92686, Gene Information human ... NRGN(4900) Узнать цену -
Anti-Neuropeptide Y (NPY) antibody produced in rabbit
MDL number: MFCD00162717 NACRES: NA.41
Кат. номер N9528-.2ML N9528-25UL General descriptionAnti-Neuropeptide Y (NPY) is developed in rabbits using synthetic neuropeptide Y (porcine) conjugated to keyhole limpet hemocyanin (KLH) as the immunogen.
Neuropeptide Y (NPY), a 36-amino acid peptide amide, is a major regulatory neuropeptide widely distributed in the mammalian central (CNS) and peripheral nervous systems (PNS). NPY belongs to the pancreatic polypeptide family of peptides which are characterized by a common tertiary structure. Within this family, an intestinal peptide hormone, peptide YY (PYY), is most closely related to NPY. In the CNS, NPY is involved in regulation of blood pressure, memory processing, circadian rhythm, and stimulation of food intake. In the PNS, NPY has potent vasoconstrictor activity and acts as a neurotransmitter/neuromodulator of sympathetic neurons and adrenal glands. NPY is one of the most abundant peptides found in the CNS, widely distributed in the brain. High levels of NPY are present in the cerebral cortex, amygdaloid nuclei, hippocampal formation, and hypothalamus. In the PNS, NPY is found mainly in sympathetic neurons that innervate vascular smooth muscle, heart, and urogenital tract. The biological actions of NPY in the brain and periphery are mediated by at least two different NPY receptors, designated Y1 and Y2 receptor subtypes.
Specificity
The antibody recognizes by ELISA, NPY (human), NPY (porcine), NPY (sheep), NPY (13-36), NPY (18-36), and cross-reacts with PYY (human). It does not cross-react with neurokinin B (NKB), neurokinin A (NKA), substance P (SP), calcitonin, somatostatin and BSA.Immunogensynthetic neuropeptide Y (NPY, porcine), conjugated to KLH. The corresponding sequence is highly conserved (single amino acid substitution) in human and rat NPY and is highly conserved (84% identity) in the C-terminus region (24-36) of human peptide YY.ApplicationAnti-Neuropeptide Y (NPY) antibody produced in rabbit has been used in:- single-labeling immunocytochemistry
- immunofluorescence
- immunostaining
- dot blot
- radioimmunoassay (RIA)
- enzyme-linked immunosorbent assay (ELISA)
Biochem/physiol Actions
Neuropeptide Y (NPY) plays a vital role in feeding behaviour, anxiety, epilepsy, circadian, rhythm memory processing, sleep, pain and drug addiction. In addition, it is also implicated in regulation of appetite, body weight and obesity. It controls central endocrine secretion and has potent vasoactive effects on the cardiovascular system. NPY is involved in the pathogenesis of atherosclerosis and coronary artery disease.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form whole antiserum antibody product type primary antibodies clone polyclonal contains 15 mM sodium azide species reactivity pig, human, rat, sheep packaging antibody small pack of 25 µL application(s) immunohistochemistry (frozen sections): 1:8,000-1:16,000 using 4% paraformaldehyde perfusion-fixed sections of rat brain","indirect ELISA: 1:5,000-1:10,000 using using peptide coating at 0.5-1 µg/well in 0.05 M carbonate/bicarbonate buffer, pH 9.6, and pNPP as substrate conjugate unconjugated UniProt accession no. P01303, shipped in dry ice storage temp. 20°C Gene Information rat ... Npy(24604)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Neuropilin-2b
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN2262-25UG ABN2262-100UG General descriptionNeuropilin-2 (UniProt: O60462; also known as Vascular endothelial cell growth factor 165 receptor 2) is encoded by the NRP2 (also known as VEGF165R2) gene (Gene ID: 8828) in human. Neuropilin-2 is a single-pass type I membrane protein that serves as a high affinity receptor for VEGF165 and VEGF145, semaphorins 3C, 3F, and the PLGF-2 isoform of PGF. It is synthesized with a signal peptide (aa 1-20) that is subsequently cleaved in the mature form. Neuropilin-2 has an extracellular domain (aa 21-864), a transmembrane domain (aa 865-889), and cytoplasmic tail (aa 890-931). It contains two CUB domains (aa 28-142 and 149-267) that mediate its binding to semaphorin. It also has two F5/8 type -C domains that are responsible for heparin and VEGF binding. Six different isoforms of Neuropilin-2 have been described that are produced by alternative splicing. In non small cell lung cancer (NSCLC) cell lines, TGF-beta signaling is reported to preferentially increase the abundance of NRP2b. Although it has been shown that the presence of NRP2b inhibits the proliferation of cultured cells and diminishes primary tumor growth, it also enhances cellular migration, invasion into Matrigel, and tumorsphere formation in cultured cells in response to TGF-beta. In addition, it is shown to promote metastasis in xenograft murine models. In lung cancer cell lines, knocking down of NRP2 is shown to impair both baseline and TGF-beta-induced migration and invasion. (Ref.: Gemmill, RM., et al., (2017). Sci. Signal. 10, eaag0528).
Specificity
This rabbit polyclonal antibody detects Neuropilin-2b in human and murine cells.ImmunogenEpitope: C-terminus
Mixture of two KLH-conjugated peptides corresponding to 17 and 16 amino acids from the C-terminal region of human Neuropilin-2b.ApplicationAnti-Neuropilin-2b, Cat. No. ABN2262, is a highly specific rabbit polyclonal antibody that targets Neuropilin-2b (NRP2b) and has been tested for use in Immunocytochemistry,Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Immunoprecipitation Analysis: A representative lot immunoprecipitated Neuropilin-2b in Immunoprecipitation applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Immunocytochemistry Analysis: A representative lot detected Neuropilin-2b in Immunocytochemistry applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Western Blotting Analysis: A representative lot detected Neuropilin-2b in Western Blotting applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Western Blotting Analysis: A 1:250 dilution from a representative lot detected Neuropilin-2b in HEK293 transfected with NRP2b (Courtesy of Dr. Robert Gemmill @ Medical University of South Carolina).
Immunohistochemistry Analysis: A representative lot detected Neuropilin-2b in Immunohistochemistry applications (Gemmill, R.M., et. al. (2017). Sci Signal. 10(462); eaag0528).
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in NIH3T3 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Neuropilin-2b in NIH3T3 cell lysate.
Target description
~115 kDa observed. 104.86 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_061004,","NP_957719, UniProt accession no. O60462, Gene Information human ... NRP2(8828) Узнать цену -
Anti-Nexilin antibody,Mouse monoclonal
Кат. номер SAB4200124-25UL SAB4200124-200UL General descriptionMonoclonal Anti-Nexilin (mouse IgG2a isotype) is derived from the hybridoma NX-38 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide conjugated to KLH. Nexilin is a filamentous actin-binding protein that localizes to focal contacts. Alternative splicing of the gene yields two different isoforms namely, b-nexilin and s-nexilin.
NEXN (nexilin), a cardiac Z-disc protein is made of 675 amino acids. It is present in the heart and skeletal muscle. NEXN is mapped to human chromosome 1p31.
Specificity
Monoclonal Anti-Nexilin recognizes human, rat, and mouse nexilin.ApplicationAnti-Nexilin antibody,Mouse monoclonal may be used in immunoblotting and immunocytochemistry.
Biochem/physiol Actions
NEXN (nexilin) plays an important role in protecting cardiac Z-discs from forces generated within the sarcomere. Mutations in NEXN results in hypertrophic cardiomyopathy.
Nexilin may be involved in cell adhesion and migration.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, store at 2–8 °C for up to one month. For extended storage, freeze at –20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone NX-38, monoclonal form buffered aqueous solution mol wt antigen 80 kDa species reactivity rat, human, mouse packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunocytochemistry: suitable","western blot: 1-2 µg/mL using using rat brain S1 fraction extracts isotype IgG2a conjugate unconjugated UniProt accession no. Q0ZGT2, shipped in dry ice storage temp. 20°C Gene Information human ... NEXN(91624)
rat ... Nexn(246172), Nexn(68810)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NF-E2-related factor 2 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE413-25UG ABE413 General descriptionNF-E2-related factor 2 (Nuclear factor erythroid 2-related factor 2) is a transcription activator that binds to antioxidant response elements (ARE) in the promoter regions of target genes. NF-E2-related factor 2 mediates the coordinated up-regulation of genes in response to oxidative stress. NF-E2-related factor 2 may also be involved in the transcriptional activation of genes of the beta-globin cluster. NF-E2-related factor 2 is widely expressed, with highest expression in adult muscle, kidney, lung, liver and fetal muscle.
Specificity
This antibody recognizes the C-terminus of NF-E2 related factor 2ImmunogenKLH-conjugated linear peptide corresponding to the C-terminus of human NF-E2 related factor 2.
Epitope: C-terminusApplicationAnti-NF-E2-related factor 2 Antibody is a highly specific rabbit polyclonal antibody, that targets NF-E2-related factor 2 & has been tested in western blotting & ICC.
Research Sub Category
Transcription Factors
Western Blotting Analysis: 1 µg/mL from a representative lot detected NF-E2 related factor 2 in 10 µg of Jurkat cell lysate.
Immunocytochemistry Analysis: A 1:200 dilution from a representative lot detected NF-E2 related factor 2 in cells untreated and treated with hydrogen peroxide (Note: Cytoplasmic staining is increased under oxidative stress.).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in Ramos cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected NF-E2 related factor 2 in 10 µg of Ramos cell lysate.
Target description
~75 kDa observed. Two isoforms at 68 kDa (isoform 1) and 66 kDa (isoform 2) are known to exist. This protein has been observed at ~75 kDa due to the abundance of acidic residues found in Nrf2, which causes it to migrate anomalously in SDS-PAGE (Abu-Bakar, A., et al. (2007) Drug Metab Dispos. 35(5):787-794.). A ubiquitinated form of NF-E2-related factor 2 may be observed at ~110 kDa (Li, J., et al. (2005). Toxicol Sci. 83(2):313-328.).
Physical form
Purified rabbit polyclonal in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Affinity purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
Ramos cell lysateOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) chimpanzee (based on 100% sequence homology), mouse (based on 100% sequence homology), rhesus macaque (based on 100% sequence homology), rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable NCBI accession no. NP_006155, UniProt accession no. Q16236, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NFB Antibody, p65 subunit, active subunit, clone 12H11
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MAB3026 MAB3026-25UG MAB3026-100UG General descriptionThe transcription factor NFkappaB (Nuclear Factor kappa B) is involved in the expression and regulation of a number of important cellular and physiological processes such as growth, development, apoptosis, immune and inflammatory response, and activation of various viral promoters including human immunodeficiency virus long terminal repeats. NFkappaB represents a group of structurally related and evolutionarily conserved proteins related to the proto-oncogene c-Rel with five members in mammals that include Rel (cRel), RelA (p65), RelB, NFkappaB1 (p50 and its precursor p105), and NFkappaB2 (p52 and its precursor p100). NFkappaB/Rel proteins exist as homo- or heterodimers to form transcriptionally competent or repressive complexes. Although most NFkappaB dimers are activators of transcription, the p50/50 and p52/52 homodimers can repress the transcription of their target genes. The p50/p65 heterodimer of NFkappaB is the most abundant in cells.
Specificity
Recognizes an epitope overlapping the nuclear location signal (NLS) of the p65 subunit of the NFkB heterodimer. Thus it selectively binds to the activated form of NFkB (Zabel et al., 1993). The antibody can also be used for electrophoretic mobility supershift assays (EMSA). The nuclear factor kB (NFkB) is a sequence-specific DNA-binding protein (Sen & Baltimore, 1986). It is a pleiotropic transcription factor which is involved in the expression of a variety of cellular and viral genes (Lenardo & Baltimore, 1989). NFkB consists of two subunits which are named according to their molecular weight, p50 and p65 (Kawakami et al., 1988). The subunits are stabilized by a so-called inhibitory chain IkB (Baeuerle & Baltimore, 1988). In quiescent cells, NFkB resides in the cytosol in an inactive form which can be activated in vivo by treatment of cells with cytokines or protein kinase activators. In vitro, it is possible to generate the active form of NFkB by treatment with sodium deoxycholate, formadine or electrophoretic size fractionation. The active form of NFkB is a heterotetrameric protein, consisting of the two p50 and two p65 subunits (Lenardo et al., 1987). After activation NFkB translocates from the cytosol to the nucleus of the cell, binds to specific DNA sequences and initiates transcription.ImmunogenEpitope: p65 subunit, active subunit
Peptide corresponding to human p65 coupled to BSA.ApplicationResearch Sub Category
Transcription Factors
Use Anti-NFκB Antibody, p65 subunit, active subunit, clone 12H11 (Mouse Monoclonal Antibody) validated in EMSA, FC, ICC, IF, IHC, IHC(P), WB to detect NFκB also known as Rel A.
Research Category
Epigenetics & Nuclear Function
Immunofluorescence:
A 1-10 µg/mL concentration of a previous lot was used in immunofluorescence.
Immunohistochemistry (paraffin sections):
A 5-10 µg/mL (APAAP) concentration of a previous lot was used in immunohistochemistry.
Immunohistochemistry (frozen sections):
A 5-10 µg/mL (APAAP) concentration of a previous lot was used in immunohistochemistry.
Immunohistochemistry:
The clone 12H11 works best in fresh frozen or acetone fixed human tissues, however some groups have had reactivity in traditional formalin fixed tissue when the tissue is of human origin. It is recommended that ABC or enhanced detection systems be employed for the best visualization in either acetone or formalin fixed tissues. The antibody reacts with human tissues best. Rat tissue will also react but at a lower affinity, and the antibody does not react with mouse, other species have not been examined. Microwave citric acid buffer or trypsin digestion antigen recovery have both been successful with 12H11 on formalin fixed tissues.
Western blot: 5-10 µg/mL (ECL)
Electrophoretic Mobility Supershift Assay:
A 0.5-1 µg/mL concentration of a previous lot was used in Supershift assay.
Flow cytometry:
A previous lot of this antibody was used in flow cytometry. Fixed cells only, acetone fixed cells.
Optimal working dilutions must be determined by end user.
Quality
Routinely evaluated by Western Blot on PC12 lysates.
Western blot:
1:500 dilution of this lot detected NF KAPPA B, P65 on 10 µg of PC12 lysates.
Target description
65 kDa
Physical form
Purified mouse monoclonal IgG3 liquid in buffer containing 0.02 M Phosphate buffer, 0.25 M NaCl, pH 7.6 with 0.1% sodium azide.
Format: Purified
Protein A purified
Storage and Stability
Stable for 6 months at 2-8C from date of receipt.
Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
TNF -treated HeLa cells, PMA and calcium ionophore-treated Jurkat cells.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 12H11, monoclonal species reactivity rabbit, rat, human species reactivity (predicted by homology) mouse packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) electrophoretic mobility shift assay: suitable","flow cytometry: suitable","immunocytochemistry: suitable","immunofluorescence: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG3 NCBI accession no. NP_068810.3, UniProt accession no. Q04206, shipped in ambient storage temp. 2-8°C Узнать цену -
Anti-NFB p50 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер 6-886-I 6-886-I-25UG 6-886-I-100UG General descriptionNuclear factor NF-kappa-B p105 subunit (UniProt P19838; also known as DNA-binding factor KBF1, EBP-1, NF-kappa-B, NF-kappaB, NF-kB1, NFkappaB, NFKB-p105, NFKB-p50, Nuclear factor NF-kappa-B p50 subunit, Nuclear factor kappa-B DNA binding subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) is encoded by the NFKB1 gene (Gene ID 4790) in human. NF-κB is a protein complex that plays a key role in regulating the immune response to infection/inflammation. NF-κB1 is synthesized as a 968 a.a protein (p105), which undergoes posttranslational processing to generate the p50 subunit (a.a. 1-433). The p50 NF-κB participates in target gene transactivation by forming heterodimers with RelA, RelB, or c-Rel. In addition, p50 homodimer can bind the nuclear protein Bcl-3 and form a functional transcriptional activator complex. In unstimulated cells, the NF-κB dimers are sequestered in the cytoplasm by the family of IκB (Inhibitor of κB) proteins (IκBα, IκBβ, IκBε, and Bcl-3). Upon stimulation, IκB becomes phosphorylated by the IκB kinase (IKK) complex, leading to IκB ubiquitination and proteasomal degradation. With the degradation of IκB, the NF-κB complex is then freed to enter the nucleus to activate the transcription of target genes.
Specificity
Dectects 105 kDa recursor and 50 kDa processed forms. Immunogen sequence is a.a. 1-12, this polyclonal antibody can therefore detect isoforms 1 and 2, but not 3. Note that isoform 3 is missing amino acids 1-180.ImmunogenKLH conjugated synthetic peptide (MAEDDPYLGRPE-C) corresponding to amino acids 1-12 of NFκB p50, containing a C-terminal cysteine.
Epitope: Amino acid 1-12ApplicationImmunoprecipitation Analysis: 10 µg of antibody from a representative lot immunoprecipitated NFkB p50 in 500 µg of A431 cell lysate.
Anti-NFκB p50 Antibody is an antibody against NFκB p50 for use in Western Blotting, Immunoprecipitation.
Quality
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: 0.2 µg/mL of this antibody detected NFkB p50 in 10 µg of A431 cell lysate.
Target description
~50/105 kDa observedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) rhesus macaque (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunoprecipitation (IP): suitable","western blot: suitable NCBI accession no. NP_003989, UniProt accession no. P19838, shipped in ambient Gene Information human ... NFKB1(4790) Узнать цену -
Anti-NFB p65 Antibody, CT
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE347-25UG ABE347 General descriptionThe transcription factor NFκB (Nuclear Factor κB) is involved in the expression and regulation of a number of important cellular and physiological processes such as growth, development, apoptosis, immune and inflammatory response, and activation of various viral promoters including human immunodeficiency virus long terminal repeats. NFκB represents a group of structurally related and evolutionarily conserved proteins related to the proto-oncogene c-Rel with five members in mammals that include Rel (cRel), RelA (p65), RelB, NFκB1 (p50 and its precursor p105), and NFκB2 (p52 and its precursor p100). NFκB/Rel proteins exist as homo- or heterodimers to form transcriptionally competent or repressive complexes. Although most NFκB dimers are activators of transcription, the p50/50 and p52/52 homodimers can repress the transcription of their target genes. The p50/p65 heterodimer of NFκB is the most abundant in cells.
Specificity
This antibody recognizes NFκB at the C-terminus.ImmunogenKLH-conjugated linear peptide corresponding to the C-terminus of human NFκB.
Epitope: C-terminusApplicationResearch Sub Category
Transcription Factors
Use Anti-NFκB p65 Antibody, CT (Rabbit Polyclonal Antibody) validated in WB, IP to detect NFκB p65 also known as transcription factor p65.
Western Blot (SNAP i.d.) Analysis: 5 µg/mL from a representative lot detected NFB on 10 µg of A431 cell lysate.
Immunoprecipitation Analysis: 10 µg from a representative lot immunoprecipitated NFB from A431 RIPA lysate.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blot in A431 cell lysate.
Western Blot Analysis: 0.5 µg/mL of this antibody detected NFB in 10 µg of A431 cell lysate.
Target description
~65 kDa observed.
Four isoforms produced by alternative splicing have been described: Isoform 1 (p65) at 60.2 kDa, Isoform 2 (p65 delta 2) at 58.8 kDa, Isoform 3 (p65 delta) at 59.1 kDa, and Isoform 4 at 59.9 kDaLinkageReplaces: 06-418
Physical form
Purified rabbit polyclonal in buffer containing 0.1 M Tris-Glycine (pH 7.4, 150 mM NaCl) with 0.05% sodium azide.
Format: Purified
Protein A purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
A431 cell lysateOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, rat, human packaging antibody small pack of 25 µg application(s) immunoprecipitation (IP): suitable","western blot: suitable NCBI accession no. NP_068810, UniProt accession no. Q04206, shipped in ambient storage temp. 2-8°C Узнать цену -
Anti-NG2 Chondroitin Sulfate Proteoglycan Antibody, clone 132.38
eCl@ss: 32160702
Кат. номер MAB5384-I-25UG MAB5384-I-100UG General descriptionChondroitin sulfate proteoglycan 4 (UniProt: Q00657; also known as Chondroitin sulfate proteoglycan NG2, HSN tumor-specific antigen) is encoded by the Cspg4 (also known as Ng2) gene (Gene ID: 81651) in rat. Chondroitin sulfate proteoglycan NG2 is a single-pass type I membrane protein that plays a role in cell proliferation and migration and stimulates endothelial cells motility during microvascular morphogenesis. It is present in neural cells and in extraneural tissues, especially in the developing mesenchyme. Its level of expression is highest on immature, proliferating cells and decreases when these cells begin to differentiate. It is found on the surfaces of an unusual class of glial cells within the developing and mature central nervous system that have the properties of oligodendrocyte precursor cells. It is a major chondroitin sulfate proteoglycan that is produced after spinal cord injury and is expressed by macrophages and oligodendrocyte progenitors. It is also reported to inhibit neurite outgrowth and growth cone collapse during axon regeneration. NG2 chondroitin sulfate proteoglycan is synthesized with a signal peptide (aa 1-29), which is subsequently cleaved off in the mature form. (Ref.: Jones, LL et al. (2002). J. Neurosci. 22(7):2792-2803).
Specificity
Clone 132.38 is a mouse monoclonal antibody that detects Chondroitin sulfate proteoglycan 4 in rat brain tissue.ImmunogenHEK293 cells expressing a truncated integral membrane form of NG2 consisting of amino acids 1592-2222.ApplicationAnti-NG2 Chondroitin Sulfate Proteoglycan, clone 132.38, Cat. No. MAB5384-I, is a highly specific mouse monoclonal antibody that targets Chondrin Sulfate Protoglycan 4 and has been tested for use in Immunofluorescence and Western Blotting.
Western Blotting Analysis: 1 µg/mL from a representative lot detected NG2 Chondroitin Sulfate Proteoglycan in Rat E16 brain tissuel lysate.
Immunofluorescence Analysis: A 1:50 dilution from a representative lot detected NG2 Chondroitin Sulfate Proteoglycan in rat brain frozen sections, post-fixed in ethanol.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in NIH/3T3 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected NG2 Chondroitin Sulfate Proteoglycan in NIH/3T3 cell lysate.
Target description
~260 kDa observed. Uncharacterized bands may be observed in some lysate(s).LinkageReplaces: MAB5384 and 05-710
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG1 in buffer containing PBS, pH 7.2, containing 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 132.38, monoclonal species reactivity mouse, rat packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_112284, UniProt accession no. Q00657, Узнать цену -
Anti-Nicotinamide N-methyltransferase
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1788 ABE1788-25UG General descriptionNicotinamide N-methyltransferase (UniProt: P40261; also known as EC: 2.1.1.1) is encoded by the NNMT gene (Gene ID: 4837) in human. Nicotinamide N-methyltransferase is a monomeric, cytoplasmic enzyme that belong to the class I -like SAM-binding methyltransferase superfamily. It catalyzes the N-methylation of nicotinamide and other pyridines with S-Adenosyl-L-methionine (SAM)) serving as the methyl donor. It has two SAM binding sites (aa 63-64 and 142-143). Its catalytic activity is important for biotransformation of many drugs and xenobiotic compounds. Nicotinamide N-methyltransferase is predominantly expressed in the liver. A lower level of expression is seen in the kidney, lung, skeletal muscle, placenta, and heart and it is not detected in the brain or pancreas. Nicotinamide N-methyltransferase inhibition is shown to increases adipose SAM and NAD(+) levels and upregulate ornithine decarboxylase and spermidine-spermine N(1)-acetyltransferase activity and expression. (Ref.: Kraus, D et al. (2014). Nature. 508 (7495); 258-62).
Specificity
This rabbit polyclonal antibody detects human Nicotinamide N-methyltransferase. It targets an epitope within 15 amino acids from the internal region.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids from the internal region of human Nicotinamide N-methyltransferase.ApplicationAnti-Nicotinamide N-methyltransferase Antibody, Cat. No. ABE1788, is a highly specific rabbit polyclonal antibody that targets human Nicotinamide N-methyltransferase and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Western Blotting Analysis: 1 µg/mL from a representative lot detected Nicotinamide N-methyltransferase in 10 µg of human kidney lysate and HEK293 cell lysate.
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Nicotinamide N-methyltransferase in human liver, human kidney, and human pancreas tissues.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HepG2 cell lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Nicotinamide N-methyltransferase in 10 µg of HepG2 cell lysate.
Target description
~30 kDa observed; 29.57 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_006160.1, UniProt accession no. P40261, shipped in ambient
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Nicotinic Acetylchone Receptor alpha 1 Antibody, clone 7C8.2
eCl@ss: 32160702
Кат. номер MABN1618 MABN1618-25UG General descriptionAcetylcholine receptor subunit alpha (UniProt: P02708; AChR nicotinic alpha 1) is encoded by the CHRNA1 (also known as ACHRA, CHNRA) gene (Gene ID: 1134) in human. Nicotinic Acetylcholine Receptor is a member of the ligan-gated ion channel family. It is a multi-pass membrane protein on the post-synaptic cell membrane. Nicotinic Ach receptor is a pentamer of two alpha chains and one each of the beta, delta, and gamma (in immature muscle) or epsilon (in mature muscle) chains. Two isoforms of this receptor have been described that are produced by alternative splicing. Isoform 1 is only expressed in skeletal muscle and isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus. It contains an extracellular domain (aa 21-255), four helical domains (aa 256-280; 288-306; 322-341; and 454-472) and a cytoplasmic domain (aa 342-453). After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in CHRNA1 gene are linked to Myasthenic syndrome, which is characterized by muscle weakness affecting the axial and limb muscles, and the ocular muscles that lead to ptosis and opthalmoplegia. The alpha subunit is the main focus for antibody binding in myasthenia gravis.
Specificity
Clone 7C8.2 detects nicotinic acetylcholine receptor alpha in human and rat. It targets an epitope within 97 amino acids from the C-terminal half.ImmunogenGST/His-tagged recombinant fragment corresponding to 97 amino acids from the C-terminal half of human nicotinic acetylcholine receptor alpha.ApplicationResearch Category
Neuroscience
Anti-Nicotinic Acetylchone Receptor alpha 1, clone 7C8.2, Cat. No. MABN1618, is a highly specific mouse monoclonal antibody that targets CHRNA1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Western Blotting Analysis: 0.5 µg/mL from a representative lot detected Nicotinic Acetylchone Receptor alpha 1 in 10 µg of SW480 cell lysate.
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Nicotinic Acetylchone Receptor alpha 1 in human colon cancer tissue sections.
Quality
Evaluated by Western Blotting in L6 cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected Nicotinic Acetylchone Receptor alpha 1 in 10 µg of L6 cell lysate.
Target description
~55 kD observed; 54.55 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 7C8.2, monoclonal species reactivity human, rat packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_001034612, UniProt accession no. P02708, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Nidogen 1 Antibody, clone ELM1
eCl@ss: 32160702
Кат. номер MAB1946-I-25UL MAB1946-I General descriptionNidogen-1 (UniProt: P10493; also known as NID-1, Entactin) is encoded by the Nid1 (also known as Ent) gene (Gene ID: 18073) ins murine species. Nidogen-1 is a highly conserved sulfated monomeric glycoprotein that is widely distributed in basement membranes and tightly associates with laminin. It is post-translationally N- and O-glycosylated. It is synthesized with a 28 aa signal peptide that is subsequently cleaved to produce the mature form. Nidogen -1 contains six EGF-like domains, four LDL-receptor class B repeats, one NIDO domain, one nidogen G2 barrel domain, and one thyroglobulin type 1 domain. Nidogen-1 shares about 50% homology with Nidigen-2 and shares similar adhesive properties. There is also a high degree of homology between murine and human Nidogen-1. Nidogen is expressed during embryonic and fetal development exclusively in fully developed basement membranes of the ectoderm and is not expressed in the developing endodermal basement membrane or in membranes disrupted during mesoderm formation.
Specificity
Clone ELM1 is a rat monoclonal antibody that detects Nidogen-1 in murine species.ImmunogenPurified protein from basement membranes of mouse Engelbreth-Holm-Swarm (EHS) tumor.ApplicationWestern Blotting Analysis: A representative lot detected Nidogen-1 in Western Blotting applications (Arends, F., et. al. (2015). PLoS One. 10(2):e0118090).
Immunocytochemistry Analysis: A representative lot detected Nidogen-1 in Immunocytochemistry applications (Kick, K., et. al. (2016). Arterioscler Thromb Vasc Biol. 36(12):2346-2357).
Immunohistochemistry Analysis: A representative lot detected Nidogen-1 in Immunohistochemistry applications (Chang, Y.T., et. al. (2016). J Clin Invest. 126(2):721-31).
Anti-Nidogen 1, clone ELM1, Cat. No. MAB1946-I, is a rat monoclonal antibodythat detects Nidogen-1 and has been tested for use in Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Quality
Evaluated by Immunohistochemistry in mouse kidney.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected Nidogen-1 in mouse kidney tissue.
Target description
136.54 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone ELM1, monoclonal species reactivity mouse packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_035047, UniProt accession no. P10493, Узнать цену -
Anti-nitrated Hsp90 Antibody, clone 44.23
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABN788 MABN788-25UG General descriptionHeat shock protein HSP 90-beta (UniProt: P34058; also known as Heat shock 84 kDa, HSP 84, HSP84) is encoded by the Hsp90ab1 (also known as Hsp84, Hspcb) gene (Gene ID: 301252) in rat. HSP90 is a ubiquitous chaperone protein with multiple functions in the cell. It promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. HSP90 undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, such as transcription factors, hormone receptors, and protein kinases, thereby causing their activation. HSP90 is abundant protein in the cell and may account for up to 2% of the total cytosolic protein. HSP90 is considered to be absolutely essential for cell survival. Its anti-apoptotic activity involves the inhibition of Apaf-1 oligomerization and caspase activation. Apart from its chaperone activity, HSP90 also plays a role in the regulation of the transcription machinery. HSP90 and its co-chaperones modulate transcription by altering the steady-state levels of certain transcription factors in response to various physiological cues and also modulate the activity of certain epigenetic modifiers, such as histone deacetylases or DNA methyl transferases. HSP90 can also participate in the eviction of histones from the promoter region of certain genes and thereby turn on gene expression. Nitration of HSP90 results in decreased chaperone activity and intracellular release of the nitrated HSP90 is shown to induce induces death of PC12 cells. (Ref.: Ye, Y et al (2007). J. Biol. Chem. 282(9); 6324-6337).
Specificity
Clone 44.23 detects nitrated HSP90 in rat, but not HSP90. It specifically targets nitrotyrosine 56.ImmunogenPurified, nitrated HSP90 from rat liver.ApplicationWestern Blotting Analysis: A representative lot detected nitrated HSP90 in Western Blotting applications (Ye, Y., et. al. (2007). J Biol Chem. 282(9):6324-37).
ELISA Analysis: A representative lot detected nitrated HSP90 in ELISA applications (Ye, Y., et. al. (2007). J Biol Chem. 282(9):6324-37).
Dot Blot Analysis: A representative lot detected nitrated HSP90 in Dot Blot applications (Franco, M.C., et. al. (2013). Proc Natl Acad Sci U S A. 110(12):E1102-11).
Immunohistochemistry Analysis: A representative lot detected nitrated HSP90 in Immunohistochemistry applications (Franco, M.C., et. al. (2013). Proc Natl Acad Sci U S A. 110(12):E1102-11).
Anti-Nitrated Hsp90, clone 44.23, Cat. No. MABN788, is a highly specific mouse monoclonal antibody that targets nitrated HSP90 and has been tested in Dot Blot, ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in PC12 cells treated with pyroxynitrite.
Western Blotting Analysis: 0.25 µg/mL of this antibody detected nitrated HSP90 in PC12 cells treated with pyroxynitrite.
Target description
90 kDa observed; 83.28 kda calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 44.23, monoclonal species reactivity rat packaging antibody small pack of 25 µg application(s) ELISA: suitable","dot blot: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 UniProt accession no. P34058, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Nitrotyrosine antibody produced in rabbit
MDL number: MFCD01322409 NACRES: NA.41
Кат. номер N0409-25UL N0409-.2ML General descriptionPeroxinitrite (ONOO-), a potent oxidant linked to cellular oxidative damage, is an important member of the family of reactive oxygen and nitrogen species, rapidly generated in vivo from nitric oxide and superoxide anion. Nitrotyrosine is a product of tyrosine nitration, that is facilitated by reactive nitrogen species.
Specificity
Anti-Nitrotyrosine recognizes nitrated proteins and 3-nitro-L-tyrosine. It does not cross-react with L-tyrosine, ρ-nitro-L-phenylalanine, 3-amino-L-tyrosine, 3-chloro-L-tyrosine and phospho-L-tyrosine BSA conjugates.
Reacts with peroxynitrite-nitrated proteins and 3-nitro-L-tyrosine. Does not crossreact with L-tyrosine, p-nitro-L-phenylalanine, 3-amino-L-tyrosine, 3-chloro-L-tyrosine, and phospho-L-tyrosine. Binding of the antibody is blocked by 3-nitrotyrosine.Immunogennitrated KLH (Keyhole Limpet Hemocyanin).ApplicationAnti-Nitrotyrosine antibody produced in rabbit has been used in:- immunoblotting
- enzyme-linked immunosorbent assay (ELISA)
- immunohistochemistry
- immunofluorescence immunocytochemistry
- confocal microscopy
- immunofluorescent staining
Biochem/physiol Actions
Peroxynitrite has been shown to promote the nitration of tyrosine residues in proteins, and oxidation of redox metal centers, DNA, lipids and cysteine and methionine residues in proteins, suggesting that it plays a major role in oxidative cellular damage. Peroxynitrite has been implicated in the pathogenesis of several inflammatory, infectious and degenerative human disease, including neurological conditions such as Alzheimer′s disease, amyotrophic lateral sclerosis (ALS), in the pathogenesis of asthma, atherosclerosis and a variety of conditions precipitated by endothelial injury.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% bovine serum albumin and 15 mM sodium azide.
Preparation Note
Purified by affinity chromatography on a column of 3-nitro-L-tyrosine.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution species reactivity wide range packaging antibody small pack of 25 μL application(s) immunohistochemistry (frozen sections): 1:1000 using methacarn-fixed, frozen sections of human Alzheimer′s Disease brain, indirect ELISA: 1:1,000 using nitrated-BSA, indirect immunofluorescence: 1:1,000 using A549 cells metabolically labeled with 3-nitrotyrosine, microarray: suitable, western blot: 1:1,000 using nitrated-BSA conjugate unconjugated shipped in dry ice storage temp. −20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NKG2D (CD314) Antibody, clone 1D11
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABF1032 MABF1032-25UL General descriptionNKG2-D type II integral membrane protein (UniProt: P26718; also known as Killer cell lectin-like receptor subfamily K member 1, NK cell receptor D, NKG2-D-activating NK receptor, CD314) is encoded by the KLRK1 (also known as D12S2489E, NKG2D) gene (Gene ID: 100528032) in human. NK cell receptor D is a homodimeric, disulfide-linked, single-pass type II membrane protein that can also form heterohexamers along with four subunits of HCST/DAP10. NK cell receptor D contains a cytoplasmic domain (aa 1-51), a transmembrane helical domain (aa 52-72), and an extracellular domain (aa 73-216). It functions as an activating and co-stimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. It provides both stimulatory and co-stimulatory innate immune responses on activated killer (NK) cells, leading to their cytotoxic activity. Also acts as a co-stimulatory receptor for T-cell receptor (TCR) in CD8+ T-cell-mediated adaptive immune responses by amplifying T-cell activation. NK cell receptor D is expressed in natural killer (NK) cells, CD8+ alpha-beta and gamma-delta T-cells. Its expression in NK cells is upregulated by interleukin 15 (IL15).
Specificity
Clone 1D11 detects NKG2-D type II integral membrane protein in human cells.ImmunogenWhole NKL cells (aggressive cell line derived from human natural killer cell leukemia).ApplicationFluorescence Activated Cell Sorting (FACS): A representative lot detected NKG2D (CD314) in Fluorescence Activated Cell Sorting applications (Groh, V., et. al. (2003). Proc Natl Acad Sci U S A. 100(16):9452-7).
Flow Cytometry Analysis: A 1:500 dilution from a representative lot detected NKG2D (CD314) in CD3-/CD56+ T cells (Courtesy of Alejandro Lopez-Soto, Ph.D., Tumor Immunology Group, Universidad de Oviedo, IUOPA Spain).
Inhibits Activity/Function: A representative lot of Anti-NKG2D (CD314), clone 1D11, reduced the percentage of degranulating NK cells in freshly isolated PBMCs when co-incubated with K562 cells (Courtesy of Alejandro Lopez-Soto, Ph.D., Tumor Immunology Group, Universidad de Oviedo, IUOPA Spain).
Immunohistochemistry Analysis: A representative lot detected NKG2D (CD314) in Immunohistochemistry applications (Groh, V., et. al. (2003). Proc Natl Acad Sci U S A. 100(16):9452-7).
Inhibition Analysis: A representative lot inhibited NKG2D activated cytolytic responses of gamma delta T cells and NK cells against transfectants and epithelial tumor cells expressing MICA. (Bauer, S., et. al. (1999). Science. 285(5428):727-9).
Stimulates ECM Adhesion: A representative lot of Anti-NKG2D (CD314), clone 1D11 stimulated ECM Adhesion (Abeyweera, T.P., et. al. (2011). J Cell Biol. 192(4):675-90).
Flow Cytometry Analysis: A representative lot detected NKG2D (CD314) in Flow Cytometry applications (Wu, J., et. al. (2002). J Immunol. 169(3):1236-40; Bauer, S., et. al. (1999). Science. 285(5428):727-9; Wu, J., et. al. (1999). Science. 285(5428):730-2; Roberts, A.I., et. al. (2001). J Immunol. 167(10):5527-30).
Immunoprecipitation Analysis: A representative lot detected NKG2D (CD314) in Immunoprecipitation applications (Bauer, S., et. al. (1999). Science. 285(5428):727-9).
Anti-NKG2D (CD314), clone 1D11, Cat. No. MABF1032, is a mouse monoclonal antibody that detects human NKG2-D type II integral membrane protein and has been tested for use in Flow Cytometry, Fluorescence Activated Cell Sorting (FACS), Immunohistochemistry, Immunoprecipitation, ECM Adhesion and Inhibit
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG1 .
Target description
25.27 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1D11, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable isotype IgG1 NCBI accession no. NP_001186734, UniProt accession no. P26718, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NKp46 (CD335) Antibody, clone 461-G1
eCl@ss: 32160702
Кат. номер MABF2059-25UG MABF2059-100UG General descriptionNatural cytotoxicity triggering receptor 1 (UniProt: O76036; also known as Lymphocyte antigen 94 homolog, NK cell-activating receptor, Natural killer cell p46-related protein, NK-p46, NKp46, hNKp46, CD335) is encoded by the NCR1 (also known as LY94) gene (Gene ID: 9437) in human. NK-p46 is a single-pass type I membrane protein that belongs to the natural cytotoxicity receptor (NCR) family and serves as a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis and elimination of virus-infected cells. It is considered as a primary activating receptor mediating NK cell antiviral function. It is involved in the functional recognition of viral HA and hemagglutinin-neuraminidases. NKp46 is shown to be predominantly expressed in the nasal lavage of patients infected with respiratory viruses, but not in normal healthy subjects. Following the initiation of an NK-target cell interaction, NKp46 is reported to cluster at the cell membrane, specifically at the immune synapse where it mediates cytoskeletal rearrangement and cellular polarization. Human NK-p46 is synthesized with a signal peptide of 21 amino acids, which is subsequently cleaved off. The mature form has an extracellular domain (aa 22-258), a helical domain (aa 259-279), and a cytoplasmic domain (aa 280-304). It also has two Ig-like domains (aa 34-118 and 129-211) termed as D1 and D2. Five different isoforms of NKp46 have been described that are produced by alternative splicing. (Ref.: Shemer-Avni, Y., et al., (2017). Front. Immunol. 8 (Article 161); 1-10).
Specificity
Clone 461-G1 specifically recognizes whole human NKp46 and NKp46-D1, but does not recognize NKp46-D2. It targets an epitope with in the first 100 amino acids from the extracellular domain.ImmunogenHuman IgG1 Fc-fused to a recombinant fragment corresponding to the first 100 amino acids from the extracellular domain of human NKp46.ApplicationFlow Cytometry Analysis: 4 µg/mL from a representative lot detected NKp46 (CD335) in NK92 cells transfected with human NKp46 (Courtesy of Angel Porgador, Ph.D., Faculty of Health Sciences, Ben Gurion university of the Negev, Israel).
ELISA Analysis: A representative lot detected NKp46 (CD335) in ELISA applications (Yossef, R., et. al. (2015). PLoS One. 10(2):e0118936).
Anti-NKp46 (CD335), clone 461-G1, Cat. No. MABF2059, is a mouse monoclonal antibody that detects Natural cytotoxicity triggering receptor 1 and has been tested for use in ELISA and Flow Cytometry.
Research Category
Inflammation & Immunology
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG1.
Target description
34.48 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 461-G1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","flow cytometry: suitable isotype IgG1 NCBI accession no. NP_001138929, UniProt accession no. O76036,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NKp46 (CD335) Antibody, clone WEN23
eCl@ss: 32160702
Кат. номер MABF1970 MABF1970-25UL General descriptionNatural cytotoxicity triggering receptor 1 (UniProt: Q9Z0H5; also known as Activating receptor 1, rAR-1, Lymphocyte antigen 94 homolog, NK receptor KILR-1, NKACTR, Natural killer cell p46-related protein, NK-p46, NKp46, CD335) is encoded by the Ncr1 (also known as Ar1, Kilr1, Ly94) gene (Gene ID: 117547) in rat. NK-p46 is a single-pass type I membrane protein that belongs to the natural cytotoxicity receptor (NCR) family and serves as a NK-p46 is an activating NK cell receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. NK-p46 also regulates graft-versus-host disease and allergic response. Following the initiation of an NK-target cell interaction, NK-p46 is reported to cluster at the cell membrane, specifically at the immune synapse where it mediates cytoskeletal rearrangement and cellular polarization. NK-p46 has an extracellular domain (aa 17-258), a helical domain (aa 259-279), and a cytoplasmic domain (aa 280-325). It also has two Ig-like domains (aa 42-100 and 137-192). It is synthesized with a signal peptide of 16 amino acids, which is subsequently cleaved off. NK-p46 is expressed by all natural killer (NK) cells, but not by T cells, B cells, granulocytes, monocytes, dendritic cells, or macrophages. It is weakly expressed in spleen, heart, and lung tissue. The main NK cell population of the lymph node expresses low levels of NK-p46 in resting cells, however, its expression is elevated by the presence of interleukin-2. (Ref.: Hadad, U et al. (2015). Front. Immunol 60 (Article 495); 1-11).
Specificity
Clone WEN23 detects natural cytotoxicity receptor 1 (NCR1, NK-p46) in rat. It targets an epitope in the ectodomain regioin.ImmunogenRecombinant rat NKp46 ectodomain coupled to the Fc portion of mouse IgG2b.ApplicationAnti-NKp46 (CD335), clone WEN23, Cat. No. MABF1970 is a mouse monoclonal antibody that detects Natural cytotoxicity triggering receptor 1 and has been tested for use in Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Affects Function and Western Blotting.
Western Blotting Analysis: A representative lot detected NKp46 (CD335) in Western Blotting applications (Westgaard, I.H., et. al. (2004). J Leukoc Biol. 76(6):1200-6).
Affects Function Analysis: A representative lot of anti-NKp46 (CD335) affected funtion of NKp46 (CD335). (Westgaard, I.H., et. al. (2004). J Leukoc Biol. 76(6):1200-6).
Immunoprecipitation Analysis: A representative lot detected NKp46 (CD335) in Immunoprecipitation applications (Westgaard, I.H., et. al. (2004). J Leukoc Biol. 76(6):1200-6).
Flow Cytometry Analysis: A representative lot detected NKp46 (CD335) in Flow Cytometry applications (Westgaard, I.H., et. al. (2004). J Leukoc Biol. 76(6):1200-6).
Immunohistochemistry Analysis: A representative lot detected NKp46 (CD335) in Immunohistochemistry applications (Smelt, M.J., et. al. (2014). Cell Transplant. 23(11):1381-94).
Research Category
Inflammation & Immunology
Quality
Evaluated by Flow Cytometry in HEK293 cells transfected with rat NKp46.
Flow Cytometry Analysis: 1 µg of this antibody detected NKp46 (CD335) in HEK293 cells transfected with rat NKp46.
Target description
37.18 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in PBS without azide.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone WEN23, monoclonal purified by affinity chromatography species reactivity rat packaging antibody small pack of 25 µL application(s) flow cytometry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_476547.1, UniProt accession no. Q9Z0H5,
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NKR-P1B (CD161b) Antibody, clone Stok27
eCl@ss: 32160702
Кат. номер MABF1971 MABF1971-25UL General descriptionKiller cell lectin-like receptor subfamily B member 1B allele B (UniProt: Q5NKN4; also known as CD161 antigen-like family member B, Immunoreceptor NKR-P1C, Natural killer cell surface protein NKR-P1B allele WAG/PVG/BS, Natural killer lymphocyte receptor P1B, CD161b) is encoded by the Klrb1b (also known as Nkrp1b, Nkrp1c) gene (Gene ID: 678513) in rat. NKR-P1B is a single-pass type II membrane protein that is expressed in a subset of natural killer cells. It consists of a cytoplasmic domain (aa 1-45), a helical domain (aa 46-66), and an extracellular domain (aa 67-223). In contrast to NKR-P1C, which functions as an activating receptor, NKR-P1B inhibits NK cell activation. NKR-P1b serves as a receptor for CLEC2D/OCIL and ligand binding contributes to inhibition of cytotoxic natural killer cells. It may also mediate MHC class I-independent missing-self recognition of allografts, tumor cells, and virus-infected cells. The inhibitory NKR-P1B receptor identifies rat splenic NK cells that are low in Ly49 receptors, but are enriched in CD94/NKG2 receptors. (Ref.: Inngjerdingen, M et al. (2012). J. Immunol. 188(6); 2499-2508; Carlyle, JR et al. (1999). J. Immunol. 162(10); 5917-5923).
Specificity
Clone Stok27 is a rat monoclonal antibody that detects Killer cell lectin-like receptor subfamily B member 1B allele B (NKR-P1B) in rat. It targets an epitope within the extracellular domain.ImmunogenIL-2-activated NK cells from PVG.1N (RT1n) rats.ApplicationAnti-NKR-P1B (CD161b), clone Stok27, Cat. No. MABF1971, is a rat monoclonal antibody that detects NKR-P1B and has been tested for use in Flow Cytometry and Immunoprecipitation.
Immunoprecipitation Analysis: A representative lot detected NKR-P1B (CD161b) in Immunoprecipitation applications (Kveberg, L., et. al. (2006). J Immunol. 176(7):4133-40).
Flow Cytometry Analysis: A representative lot detected NKR-P1B (CD161b) in Flow Cytometry applications (Kveberg, L., et. al. (2006). J Immunol. 176(7):4133-40; Smelt, M.J., et. al. (2014). Cell Transplant. 23(11):1381-94).
Quality
Evaluated by Flow Cytometry in Rnk16 (Rat NK) cells stably transfected with Stok27 (NKR-1B) antigen.
Flow Cytometry Analysis: 1 µg of this antibody detected NKR-P1B (CD161b) in Rnk16 (Rat NK) cells stably transfected with Stok27 (NKR-1B) antigen.
Target description
24.88 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source rat antibody form purified antibody antibody product type primary antibodies clone Stok27, monoclonal species reactivity rat packaging antibody small pack of 25 µL application(s) flow cytometry: suitable","immunoprecipitation (IP): suitable isotype IgG2a NCBI accession no. NP_001035279.1, UniProt accession no. Q5NKN4,
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-NKR-P1G Antibody, clone ADA3
eCl@ss: 32160702
Кат. номер MABF1986 MABF1986-25UL General descriptionKiller cell lectin-like receptor subfamily B member 1 (UniProt: Q0ZUP0; also known as Immunoreceptor NKR-P1E, Killer cell lectin-like receptor subfamily B member 1G, Natural killer cell surface protein NKR-P1G, Natural killer lectin-like receptor 1E) is encoded by the Klrb1 (also known as Klrb1d, Klrb1g, Klrb6, Nkrp1e, Nkrp1g) gene (Gene ID: 689817) in rat. NKR-P1G is a single-pass type II membrane protein with a cytoplasmic domain (aa 1-42), a helical domain (aa 43-63), and an extracellular domain (aa 64-214). NKR-P1G is expressed by subsets of lymphocytes with highest prevalence in gut and liver mucosa. The number of NKR-P1G+ cells are shown to increase with age and its expression level is modulated by cytokines, with an increase induced by inflammatory cytokines. It is shown to be mainly expressed by Ly49s3+ cells. It is reported to inhibit cytotoxicity and calcium responses in IL-2-activated NK cells. NKR-P1G is a potent inhibitory receptor for a panel of Clr ligands. The intracellular domain of NKR-P1G contains an immunoreceptor tyrosine-based inhibitory motif that is phosphorylated by Src-kinases upon activation. This allows recruitment of phosphotyrosine phosphatases, which in turn negatively regulates the signaling cascades that is essential for cytotoxicity and cytokine production. (Ref.: Kveberg, L et al (2015). Eur J Immunol. 45(2); 501-512).
Specificity
Clone ADA3 is an Armenian hamster monoclonal antibody that detects Killer cell lectin-like receptor subfamily B member 1 (NKR-P1G) in rat. It targets an epitope within the extracellular domain.ImmunogenChinese hamster ovary (CHO) cells stably transfected with FLAG-tagged extracellular portion of NKR-P1G.
Epitope: extracellular domainApplicationAnti-NKR-P1G, clone ADA3, Cat. No. MABF1986 is an Armenian hamster monoclonal antibody that detects NKG-P1G and has beent tested for use in Flow Cytometry and Immunoprecipitation.
Immunoprecipitation Analysis: A representative lot detected NKR-PIG in Immunoprecipitation applications (Kveberg, L., et. al. (2015). Eur J Immunol. 45(2):501-12).
Flow Cytometry Analysis: A representative lot detected NKR-PIG in Flow Cytometry applications (Kveberg, L., et. al. (2015). Eur J Immunol. 45(2):501-12).
Research Category
Inflammation & Immunology
Quality
Evaluated by Flow Cytometry in Ltk (mouse fibroblast) cells stably transfected with FLAG-tagged rat NKR-P1G.
Flow Cytometry Analysis: 1 µg of this antibody detected NKR-P1G in Ltk (mouse fibroblast) cells stably transfected with FLAG-tagged rat NKR-P1G.
Target description
23.96 kDa calculated.
Physical form
Purified Armenian hamster monoclonal antibody IgG in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source hamster (Armenian) Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone ADA3, monoclonal species reactivity rat packaging antibody small pack of 25 µL application(s) flow cytometry: suitable","immunoprecipitation (IP): suitable isotype IgG NCBI accession no. NP_001078874.1, UniProt accession no. Q0ZUP0,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Nkx2.1 Antibody, clone 8G7-G3-1
eCl@ss: 32160702 NACRES: NA.41
SpecificityКат. номер MAB5460-25UL MAB5460 MAB5460-100UL
Nkx2.1 (Thyroid Transcription Factor-1, TTF-1).ImmunogenRecombinant rat Nkx2.1.ApplicationThis Anti-Nkx2.1 Antibody is validated for use in WB, IH(P) for the detection of Nkx2.1.
Western blot. The antibody reacts with a 40 kDa band in immunoblots of nuclear extracts or whole cell lysates from the Nkx2.1 positive cell lines MLE15, H441-4, H345 and rat type II pmeumocyte cells.
Immunohistochemistry. The antibody can be used on formalin-fixed paraffin embedded tissue. Heat induced epitope retrieval is recommended.
Optimal working dilutions must be determined by end user.
Quality
TestedOther Notesfeature_concentration_valuePlease refer to lot specific datasheet.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыQuality Level 100 biological source mouse antibody form ascites fluid antibody product type primary antibodies clone 8G7-G3-1, monoclonal species reactivity human packaging antibody small pack of 25 µL Торговая марка Chemicon® application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NM_001079668.1,","NM_003317.3, UniProt accession no. P43699, shipped in dry ice storage temp. 20°C Gene Information human ... NKX2-1(7080)
Safety InformationWGK Germany WGK 2 Узнать цену -
Anti-NMDAR1 Splice Variant C1 Antibody AB5046P
eCl@ss: 32160702 NACRES: NA.41
Specificity
Specific for the NMDAR1 C1 splice variant. AB5046P recognizes the C1 splice insert present in NR1 variants, 1a, 1b, 3a and 3b. {Gorter et al, (1997), "The Role of Alternative Splicing of the NMDAR1 Receptor Subunit in Synaptic Plasticity" Chapter 4, pg 99, in The Ionotropic Glutamate Receptors , Monaghan, D.T. and Weinhold, R.J. (eds), Humana Press, New Jersey) By Western blot the antibody recognizes a protein with molecular weight of 100 kDa.ImmunogenPeptide corresponding to the C-terminus of the rat NMDAR1 C1 splice variant.ApplicationResearch Category
Neuroscience
Western blot: 1:1,000 using ECL on rat brain lysate.
Immunohistochemistry: 1:1,000.
Optimal working dilutions must be determined by the end user.
Anti-NMDAR1 Splice Variant C1 Antibody is an antibody against NMDAR1 Splice Variant C1 for use in WB.
Research Sub Category
Neurotransmitters & Receptors
Physical form
Affinity purified immunoglobulin. Lyophilized from ammonium bicarbonate (5 mM) so some residual salt may also be present. Reconstitute with 50 μL of PBS. Contains no preservatives.
Storage and Stability
Maintain at -20°C in undiluted aliquots for up to 6 months. Avoid repeated freeze/thaw cycles.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) western blot: suitable NCBI accession no. NM_000832.5,","NM_007327.2,","NM_021569.2, UniProt accession no. Q05586, shipped in dry ice
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-NMDAR1 Splice Variant C2 Antibody AB5050P
eCl@ss: 32160702 NACRES: NA.41
Specificity
Specific for the NMDAR1 containing the C2′ splice variant insert. The antibody does not recognize the NMDAR1 subunits of the NMDA receptor that do not contain the C2′ insert. By Western blot the antibody recognizes a protein with molecular weight of 120 kDa. Also labels a single higher molecular weight band that may be a posttranslationally modified form of the protein.ImmunogenPeptide corresponding to the C-terminus of the rat NMDAR1 C2′ splice variant.ApplicationWestern blot: 1:2000 using ECL
Immunohistochemistry: 1:1000
Optimal working dilutions must be determined by the end user.
Detect NMDAR1 Splice Variant C2 using this Anti-NMDAR1 Splice Variant C2 Antibody validated for use in IH & WB.
Research Category
Neuroscience
Research Sub Category
Neurotransmitters & Receptors
Physical form
Affinity purified immunoglobulin. Lyophilized from ammonium bicarbonate (5 mM) so some residual salt may also be present. Reconstitute with 50 μL of PBS. Contains no preservatives.
Storage and Stability
Maintain at -20°C in undiluted aliquots for up to 6 months. Avoid repeated freeze/thaw cycles.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity mouse, rat packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) immunohistochemistry: suitable","western blot: suitable NCBI accession no. NM_000832.5,","NM_007327.2,","NM_021569.2, UniProt accession no. Q05586, shipped in dry ice
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-NMDAR1 Splice Variant C2 Antibody AB5048P
SpecificityeCl@ss: 32160702 NACRES: NA.41
Specific for the NMDAR1 C2 splice variants. Recognizes NMDAR-1a, 1b, 2a, and 2b NR1 splice variants. {Gorter et al, (1997), "The Role of Alternative Splicing of the NMDAR1 Receptor Subunit in Synaptic Plasticity" Chapter 4, pg 99, in The Ionotropic Glutamate Receptors , Monaghan, D.T. and Weinhold, R.J. (eds), Humana Press, New Jersey) By Western blot the antibody recognizes a protein with molecular weight of 120 kDa.ImmunogenPeptide corresponding to the C-terminus of the rat NMDAR1 C2 splice variant.ApplicationThis Anti-NMDAR1 Splice Variant C2 Antibody is validated for use in IH, WB for the detection of NMDAR1 Splice Variant C2.
Western blot: 1:1000 using ECL
Immunohistochemistry: 1:1,000
Optimal working dilutions must be determined by the end user.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, GermanyПараметрыbiological source rabbit Quality Level 100 antibody form affinity purified immunoglobulin antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity rat, mouse packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) immunohistochemistry: suitable","western blot: suitable NCBI accession no. NM_000832.5,","NM_007327.2,","NM_021569.2, UniProt accession no. Q05586, shipped in dry ice
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-NMDAR2B Antibody, clone 11D1
eCl@ss: 32160702
Кат. номер MABN2475-25UG MABN2475-100UG General descriptionGlutamate receptor ionotropic, NMDA2B (UniProt: Q13224; also known GluN2B, Glutamate [NMDA] receptor subunit epsilon-2, N-methyl D-aspartate receptor subtype 2B, NMDAR2B, NR2B, N-methyl-D-aspartate receptor subunit 3, NR3, hNR3) is encoded by the GRIN2B (also known as NMDAR2B) gene (Gene ID: 2904) in human. NMDA receptor complexes are ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. They are involved in long-term potentiation and neuronal plasticity and regulate the number of nerve cells during development. However, over-stimulation NMDA receptors can lead to neuronal degeneration. NMDAR2B is a heterotetrameric, multi-pass membrane protein that is synthesized with a signal peptide (aa 1-26), which is subsequently cleaved off in the mature form. The heterotetrameric channel is composed of two zeta subunits and two epsilon subunits, but can also form channels that contain at least one zeta subunit and at least one epsilon subunit. Activation of NMDA 2B channel requires binding of glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by magnesium ions. NMDA 2B is reported to be phosphorylated at Ser1303 by DAPK1 that enhances its channel activity allowing injurious Ca2+ influx that results in neuronal death. Mutations in NMDAR2B have been linked to early infantile epileptic encephalopathy that is characterized by refractory seizures and neurodevelopmental impairment. Some mutations are also known to cause mental retardation with or without seizures.
Specificity
Clone 11D1 is a mouse monoclonal antibody that specifically detects NMDAR2B.ImmunogenFull length purified human Glutamate receptor ionotropic, NMDA 2B (NMDAR2B).ApplicationWestern Blotting Analysis: A representative lot detected NMDAR2B in Western Blotting applications (Lu, W., et. al. (2017). Science. 355(6331)).
Western Blotting Analysis: 4 µg/mL from a representative lot detected NMDAR2B in mouse brain tissue lysate.
Research Category
Neuroscience
Anti-NMDAR2B, clone 11D1, Cat. No. MABN2475, is a highly specific mouse monoclonal antibody that targets Glutamate receptor ionotropic, NMDA 2B and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in rat brain tissue lysate.
Western Blotting Analysis: 4 µg/mL of this antibody detected NMDAR2B in rat brain tissue lysate.
Target description
166 kDa observed; 166.37 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 11D1, monoclonal species reactivity human, mouse, rat packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_000825, UniProt accession no. Q13224, Узнать цену -
Anti-nonphospho-GSK3 (Ser9) Antibody, beta specific Antibody, clone 12B2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABN2443 MABN2443-25UL General descriptionGlycogen synthase kinase-3 beta (UniProt: P49841; also known as EC: 2.7.11.26, GSK-3 beta, Serine/threonine-protein kinase GSK3B) is encoded by the GSK3B gene (Gene ID: 2932) in human. GSK-3 is a multifunctional serine/threonine kinase, is a key regulator of numerous signaling pathways during embryogenesis and in metabolic control. Two isoforms of GSK-3 are reported in mammals: a 51 kDa GSK-3 alpha and a 47 kDa GSK-3 beta. The GSK-3 alpha contains a glycine-rich extension at its N-terminal. GSK-3 is constitutively active in cells and is regulated through inhibition of its activity. GSK-3 shows a preference for target proteins that are pre-phosphorylated at a `priming residue located C-terminal to the site of GSK-3 phosphorylation. Priming phosphorylation, although not absolutely required, enhances the efficiency of phosphorylation of most GSK-3 substrates. Phosphorylation of a threonine residue in the activation loop (T-loop) is considered to be essential for its activity. The T-loop of GSK-3 beta is phosphorylated at Tyr216, which play a role in forcing open the substrate-binding site of the enzyme. A primary mechanism of GSK-3 beta activity regulation is phosphorylation of N-terminal serine residues (Serine 9). Phosphorylation at this site is inhibitory to GSK-3 beta kinase activity because the phosphorylated N-terminus acts as a competitive inhibitor for primed substrates. GSK-3 beta is constitutively active in resting cells and treatment of cells with an agent, such as insulin, causes GSK-3 inactivation through a PI 3-kinase (PI 3-K)-dependent mechanism.
Specificity
Clone 12B2 detects GSK-3 beta in human, murine, and rat cells.ImmunogenKLH-conjugated three linear peptides from the N-terminal region of human GSK-3 beta.
Epitope: N-terminusApplicationAnti-nonphospho-GSK3 (Ser9), beta specific, clone 12B2, Cat. No. MABN2443, is a highly specific mouse monoclonal antibody that targets Glycogen synthase kinase-3 beta and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, and Western Blotting.
Research Category
Neuroscience
Western Blotting Analysis: A 1:500 dilution from a representative lot detected nonphospho-GSK3 (Ser9) in human and mouse brain tissue lysates.
ELISA Analysis: A representative lot detected nonphospho-GSK3 (Ser9) in ELISA applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Western Blotting Analysis: A representative lot detected nonphospho-GSK3 (Ser9) in Western Blotting applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected nonphospho-GSK3 (Ser9) in human cerebral cortex tissue.
Immunocytochemistry Analysis: A representative lot detected nonphospho-GSK3 (Ser9) in Western Blotting applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Immunoprecipitation Analysis: A representative lot detected nonphospho-GSK3 (Ser9) in Western Blotting applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Immunohistochemistry Analysis: A representative lot detected nonphospho-GSK3 (Ser9) in Western Blotting applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Quality
Evaluated by Western Blotting in rat brain tissue lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected nonphospho-GSK3 (Ser9) in rat brain tissue lysate.
Target description
~45 kDa observed. 46.74 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG1 in PBS without preservatives.
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 12B2, monoclonal species reactivity rat, human, mouse packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_002084.2, UniProt accession no. P49841, shipped in ambient Gene Information human ... GSK3B(2932)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-nonphospho-Ser9/21 GSK3/ Antibody, clone 15C2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABN2465 MABN2465-25UL General descriptionGlycogen synthase kinase-3 beta/alpha (UniProts: P49841 and P49840; also known as EC: 2.7.11.26 and 2.7.11.26, GSK-3 beta/alpha, Serine/threonine-protein kinase GSK3B/alpha) is encoded by the GSK3B/GSK3A gene (Gene ID: 2932/2931) in human. GSK-3 is a multifunctional serine/threonine kinase, is a key regulator of numerous signaling pathways during embryogenesis and in metabolic control. Two isoforms of GSK-3 are reported in mammals: a 51 kDa GSK-3 alpha and a 47 kDa GSK-3 beta. The GSK-3 alpha contains a glycine-rich extension at its N-terminal. GSK-3 is constitutively active in cells and is regulated through inhibition of its activity. GSK-3 shows a preference for target proteins that are pre-phosphorylated at a `priming residue located C-terminal to the site of GSK-3 phosphorylation. Priming phosphorylation, although not absolutely required, enhances the efficiency of phosphorylation of most GSK-3 substrates. Phosphorylation of a threonine residue in the activation loop (T-loop) is considered to be essential for its activity. The T-loop of GSK-3 alpha is phosphorylated at Tyr279 and GSK-3 beta at Tyr216, which play a role in forcing open the substrate-binding site of the enzyme. A primary mechanism of GSK3 activity regulation is phosphorylation of N-terminal serine residues (Serine 9 in GSK3 beta and serine 21 in GSK3 alpha). Phosphorylation of these sites is inhibitory to GSK3 kinase activity because the phosphorylated N-terminus acts as a competitive inhibitor for primed substrates. GSK-3 beta is constitutively active in resting cells and treatment of cells with an agent, such as insulin, causes GSK-3 inactivation through a PI 3-kinase (PI 3-K)-dependent mechanism.
Specificity
Clone 15C2 detects non-phosphorylated forms of both GSK-3 beta and GSK-3 alpha in Human, Mouse, and Rat. It targets an epitope within the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 14 amino acids from the N-terminal region of human GSK-3 beta.
Epitope: N-terminusApplicationWestern Blotting Analysis: A 1:500 dilution from a representative lot detected nonphospho-Ser9/21 GSK3 / in 10 µg of human brain tissue lysate.
Immunohistochemistry Analysis: A 1:50 dilution from a representative lot detected nonphospho-Ser9/21 GSK3 / in human cerebral cortex and rat cerebral cortex tissues.
Immunoprecipitation Analysis: A representative lot detected nonphospho-Ser9/21 GSK3 / in Immunoprecipitation applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Western Blotting Analysis: A representative lot detected nonphospho-Ser9/21 GSK3 / in Western Blotting applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Immunocytochemistry Analysis: A representative lot detected nonphospho-Ser9/21 GSK3 / in Immunocytochemistry applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Immunohistochemistry Analysis: A representative lot detected nonphospho-Ser9/21 GSK3 / in Immunohistochemistry applications (Grabinski, T., et. al. (2016). Front Mol Neurosci. 9:123).
Research Category
Neuroscience
Anti-nonphospho-Ser9/21 GSK3 beta/alpha, clone 15C2, Cat. No. MABN2465, is a highly specific mouse monoclonal antibody that targets nonphospho Ser9/21 GSK3 beta/alpha and has been testedfor use in Immunocytochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation and Western Blotting.
Quality
Evaluated by Western Blotting in rat brain tissue lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected nonphospho-Ser9/21 GSK3 beta/alpha in 10 µg of rat brain tissue lysate.
Target description
46.74/50.98 kDa calculated for GSK3 beta and alpha, respectively. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 15C2, monoclonal species reactivity human, mouse, rat packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","immunohistochemistry: suitable (paraffin)","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_002084, UniProt accession no. P49841, shipped in ambient Gene Information human ... GSK3B(2932)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-Norovirus (MNV-1) Antibody, clone 4F9.4
eCl@ss: 32160702
Кат. номер MABF2096-25UG MABF2096-100UG General descriptionNorovirus is a member of the Caliciviridae family and is responsible for gastroenteritis outbreaks. Murine norovirus (MNV-1) that is about 28 to 35 nm in diameter, shares many biochemical and genetic features with human noroviruses. An analysis of the MNV-1 genome shows three open reading frames (ORF) that are characteristic of noroviruses and vesiviruses. ORF1 is reported to encode a predicted 187 kDa polyprotein that contains the 2C helicase, 3C protease, and 3D polymerase motifs. ORF2 encodes a 59 kDa capsid protein that can self-assemble into virus-like particles when expressed in a baculovirus expression system. ORF3 is reported to encode a putative 22 kDa basic protein. The norovirus capsid protein contains a highly conserved shell (S) and protruding (P) domain and the P domain is shown to contain binding sites for receptors and neutralizing antibodies. The S domain is shown to be highly conserved and the capsid sequence diversity is limited to the P domain. MNV-1 infection is reported to modulate the MAPK pathway to activate eIF4E phosphorylation and the activation of p38 and Mnk during MNV-1 infection is considered to be important for its replication. This monoclonal antibody, clone 4F9.4, recognizes the P domain portion of the viral capsid protein and effectively neutralize MNV-1 and WU20 strains. It can also neutralize recombinant viruses V339I and D348E at higher doses. (Ref.: Kolawole, AO et al. (2014). J. Gen. Virol. 95(9); 1958-1968).
Specificity
Clone 4F9.4 specifically targets capsid protein of murine norovirus.ImmunogenInfectious murine norovirus-1ApplicationAnti-Norovirus (MNV-1), clone 4F9.4 Antibody, Cat. No. MABF2096, is a mouse monoclonal antibody that detects Norovirus (MNV-1) and has been tested for use in ELISA, Neutralizing, and Western Blotting.
Neutralizing Analysis: A representative lot neutralized murine norovirus (MNV-1) in Dulbecco s modified Eagles medium (DMEM) (Courtesy of Abimbola Kolawole, Ph.D. and Christiane Wobus, Ph.D., University of Michigan Medical School, Ann Arbor, Michigan USA).
ELISA Analysis: A representative lot detected Norovirus (MNV-1) in ELISA applications (Kolawole, A.O., et. al. (2014). J Gen Virol. 95(Pt 9):1958-68).
Neutralizing Analysis: A representative lot effectively neutralized Norovirus (MNV-1) in Neutralizing applications (Kolawole, A.O., et. al. (2014). J Gen Virol. 95(Pt 9):1958-68).
Western Blotting Analysis: A representative lot detected Norovirus (MNV-1) in Western Blotting applications (Kolawole, A.O., et. al. (2014). J Gen Virol. 95(Pt 9):1958-68).
Research Category
Inflammation & Immunology
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed to be mouse IgA by isotyping testing.
Target description
187.47 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgA in PBS with 0.05% sodium azide.
Purified by size-exclusion chromatography
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 4F9.4, monoclonal species reactivity norovirus (murine), virus packaging antibody small pack of 25 µg application(s) ELISA: suitable","neutralization: suitable","western blot: suitable isotype IgA UniProt accession no. Q2V8W4_9CALI, Узнать цену -
Anti-Norovirus (MNV-1) Antibody, clone 5C4.10
eCl@ss: 32160702
Кат. номер MABF2097-25UG MABF2097-100UG General descriptionNorovirus is a member of the Caliciviridae family and is responsible for gastroenteritis outbreaks. Murine norovirus (MNV-1) that is about 28 to 35 nm in diameter, shares many biochemical and genetic features with human noroviruses. An analysis of the MNV-1 genome shows three open reading frames (ORF) that are characteristic of noroviruses and vesiviruses. ORF1 is reported to encode a predicted 187 kDa polyprotein that contains the 2C helicase, 3C protease, and 3D polymerase motifs. ORF2 encodes a 59 kDa capsid protein that can self-assemble into virus-like particles when expressed in a baculovirus expression system. ORF3 is reported to encode a putative 22 kDa basic protein. The norovirus capsid protein contains a highly conserved shell (S) and protruding (P) domain and the P domain is shown to contain binding sites for receptors and neutralizing antibodies. The S domain is shown to be highly conserved and the capsid sequence diversity is limited to the P domain. MNV-1 infection is reported to modulate the MAPK pathway to activate eIF4E phosphorylation and the activation of p38 and Mnk during MNV-1 infection is considered to be important for its replication. This monoclonal antibody, clone 5C4.10, recognizes the S domain portion of the viral capsid protein and is broadly reactive with pan-noroviruses of murine and human type. (Ref.: Kolawole AO, et al. (2017). mSphere 2: e00334-17; Kolawole, AO et al. (2014). J. Gen. Virol. 95(9); , 1958 1968; Royall, E., et al. (2015). J. Biol. Chem. 290(8); 4748-58; Wobus, CE et al. (2006). J. Virol. 80(11); 5104-5112).
Specificity
Clone 5C4.10 specifically recognizes the S domain portion of capsid protein of murine Norovisrus.ImmunogenInfectious and UV-inactivated murine norovirus-1.ApplicationAnti-Norovirus (MNV-1), clone 5C4.10, Cat. No. MABF2097, is a mouse monoclonal antibody that detects murine Norovirus capsid protein and has been tested for use in ELISA and Western Blotting.
Western Blotting Analysis: A representative lot detected Norovirus (MNV-1) in Western Blotting applications (Kolawole, A.O., et. al. (2014). J Gen Virol. 95(Pt 9):1958-68).
ELISA Analysis: A representative lot detected Norovirus (MNV-1) in ELISA applications (Kolawole, A.O., et. al. (2014). J Gen Virol. 95(Pt 9):1958-68; Kolawole, A.O., et. al. (2017). mSphere. 2(5). pii: e00334-17).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in RAW 264.7 cells infected with Murine norovirus-1.CW3.
Western Blotting Analysis: 1 µg/mL of this antibody detected Norovirus (MNV-1) in RAW 264.7 cells infected with Murine norovirus-1.CW3.
Target description
~57 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5C4.10, monoclonal species reactivity norovirus, virus packaging antibody small pack of 25 μg application(s) ELISA: suitable, western blot: suitable isotype IgG2bκ Узнать цену -
Anti-Notch 1 Antibody, clone mN1A
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MAB5352 MAB5352-25UG MAB5352-100UG General descriptionNotch1 consists of three domains. The extracellular domain containing 36 epidermal growth factor (EGF) repeats and 3 lin-12/Notch repeats (LNR) and functions as a receptor in cell-cell interactions. There is a single transmembrane domain (TM). The intracellular domain contains six cdc10/ankyrin repeats (cdc10) and the newly defined Notch cytokine response (NCR) region, which contains a putative bipartite NLS (nuclear localization signal).
Specificity
Recognizes Notch1, intracellular domain. The antibody has a high affinity for the "activated" intracellular form of Notch1, but a low affinity for the full-length (unprocessed or heterodimeric cell surface) forms. No reactivity with Notch2, 3 or 4.ImmunogenCdc10-NCR region of mouse Notch1 expressed as a GST fusion protein.ApplicationResearch Sub Category
Transcription Factors
Western blot using ECL
Immunohistochemistry
Immunocytochemistry
Immunoprecipitation
Optimal working dilutions must be determined by the end user.
Anti-Notch 1 Antibody, clone mN1A is a high quality Mouse Monoclonal Antibody for the detection of Notch 1 & has been validated in ICC, IHC, IP & WB.
Research Category
Epigenetics & Nuclear Function
Target description
272.5 kDa (also 230 kDa processed form)LinkageReplaces: 04-1046
Physical form
Format: Purified
Purified immunoglobulin. Liquid.
Protein A purified
Storage and Stability
Maintain for 1 year at 2–8°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
In fetal tissues, use spleen, brain stem and lung. In most adult tissues, use lymphoid tissues.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone mN1A, monoclonal species reactivity feline, mouse, rat packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) immunocytochemistry: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 NCBI accession no. NM_017617.3, UniProt accession no. P46531, shipped in ambient storage temp. 2-8°C Gene Information human ... NOTCH1(4851)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NPY1R antibody produced in rabbit
MDL number: MFCD06798473 Human Protein Atlas Number: HPA029903 Human Protein Atlas characterization data
Кат. номер HPA029903-25UL HPA029903-100UL Immunogenneuropeptide Y receptor Y1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78124,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: 0.04-0.4 µg/mL immunogen sequence KRRNNMMDKMRDNKYRSSETKRINI conjugate unconjugated UniProt accession no. P25929, shipped in wet ice storage temp. 20°C Gene Information human ... NPY1R(4886)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NR5A2 (LRH1)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE2867 ABE2867-25UL General descriptionNuclear receptor subfamily 5 group A member 2 (UniProt: O00482; also known as Alpha-1-fetoprotein transcription factor, B1-binding factor, hB1F, CYP7A promoter-binding factor, Hepatocytic transcription factor, Liver receptor homolog 1, LRH-1) is encoded by the NR5A2 (also known as B1F, CPF, FTF) gene (Gene ID: 2494) in human. It is a member of the nuclear receptor superfamily that binds to the sequence element 5-AACGACCGACCTTGAG-3 of the enhancer II of hepatitis B virus genes. It contains a DNA binding region (aa 83-104) and two NR C4-type zinc finger domains (aa 86-106 and 122-146). It is abundantly expressed in pancreas, but at reduced levels in liver, and at very low levels in heart and lung. It s expression has been demonstrated in the Hep-G2 cell line. Four different isoforms of LRH-1 have been described that are generated by alternate splicing. LRH-1 is reported to be involved in the regulation of expression of transcription factors, such as Oct4, HNF1, 3, and 4, which are known to participate in embryonic development. Its presence in high levels in beta-III Tubulin+ and NeuN+ neurons of the mantle zone (MZ) in early neural tube of mice (E10.5 and E12.5) indicate its involvement in neural differentiation. (Ref.: Stergiopoulos, A., and Politis, PK (2016). Nat. Commun. DOI: 10.1038/ncomms12230; Venteclef, N et al. (2008). J. Biol. Chem. 283(7); 3694 3701).
Specificity
This rabbit polyclonal antibody detects Nuclear receptor subfamily 5 group A member 2 (NR5A2) in human and murine cells.ImmunogenHis-tagged full length recombinant human Nuclear receptor subfamily 5 group A member 2, isoform 2.
Epitope: unknownApplicationAnti-NR5A2 (LRH1), Cat. No. ABE2867, is a highly specific rabbit polyclonal antibody that targets Nuclear receptor subfamily 5 group A member 2 and has been tested in Chromatin Immunoprecipitation (ChIP), Immunofluorescence, Immunoprecipitation, and Western Blotting.
Chromatin Immunoprecipitation Analysis: A representative lot detected NR5A2 (LRH1) in Chromatin Immunoprecipitation applications (Kaltezioti, V., et. al. (2010). PLoS Biol. 8(12):e1000565; Venteclef, N., et. al. (2010). Genes Dev. 24(4):381-95; Boulias, K., et. al. (2005). EMBO J. 24(14):2624-33; Chalkiadaki, A., et. al. (2005). Mol Cell Biol. 25(12):5095-105).
Western Blotting Analysis: A representative lot detected NR5A2 (LRH1) in Western Blotting applications (Chalkiadaki, A., et. al. (2005). Mol Cell Biol. 25(12):5095-105; Stergiopoulos, A., et. al. (2016). Nat Commun. 7:12230).
Immunofluorescence Analysis: A representative lot detected NR5A2 (LRH1) in Immunofluorescence YES titration paraffin sections from E10.5 (a), E12.5 (b), E14.5 (c) or E16.5 (d) mouse spinal cord (Stergiopoulos, A., et. al. (2016). Nat Commun. 7:12230).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected NR5A2 (LRH1) in 10 µg of HEK293 cell lysate.
Target description
~68 kDa observed; 61.33 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Unpurified
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form unpurified antibody product type primary antibodies clone polyclonal species reactivity human, mouse packaging antibody small pack of 25 µL application(s) ChIP: suitable (ChIP-seq)","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_995582, UniProt accession no. O00482, Gene Information human ... NR5A2(2494)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NRL (Neural Retina Leucine Zipper)
eCl@ss: 32160702
Кат. номер ABN1712 ABN1712-25UG General descriptionNeural retina-specific leucine zipper protein (UniProt: P54846; also known as NRL) is encoded by the Nrl gene (Gene ID: 18185) in murine species. NRL is a bZIP transcription factor of the MAF family that regulates the expression of several rod-specific genes, including RHO and phosphodiesterase 6B. NRL is reported to be present in the nuclei of developing and mature rods but not cones. It interacts with the homeodomain protein CRX and synergistically regulates rhodopsin expression. It is also reported to interact with FIZ1 and this interaction can repress transactivation. It consists of a minimal transactivation domain (aa 30-93), a basic motif (aa 159-185), and a leucine-zipper (aa 187-208). The minimal transactivation domain (MTD) is conserved across the MAF family and it may activate transcription by recruiting TBP and associated factors at the promoters of target genes. In developing mouse retina, Nrl expression is reported to precede the appearance of known markers for differentiated rods. The transcriptional activity of NRL is modulated by sumoylation on RHO and NR2E3 promoters. (Ref.: Prabodha, K et al. (2001). J. Biol. Chem 276 (39): 36824-30).
Specificity
This rabbit polyclonal antibody recognizes murine neural retina-specific leucine zipper protein. It iargets an epitope within 108 amino acids from the N-terminal half.ImmunogenHis-tagged recombinant protein fragment corresponding to 108 amino acids from the N-terminal half of murine neural retina-specific leucine zipper protein.
Epitope: unknownApplicationImmunofluorescence Analysis: A 1:100-1:1,000 dilution from a representative lot detected NRL (Neural Retina Leucine Zipper) in frozen mouse retina tissue (Courtesy of Dr. Tiansen Li at NIH).
Western Blotting Analysis: A 1:1,000-1:2,000 dilution from a representative lot detected NRL (Neural Retina Leucine Zipper) in mouse retinal tissue lysate (Courtesy of Dr. Tiansen Li at NIH).
Anti-NRL (Neural Retina Leucine Zipper), Cat. No. ABN1712, is a highly specific rabbit polyclonal antibody that targets Neural retina-specific leucine zipper protein and has been tested for use in Immunofluorescence and Western Blotting.
Research Category
Neuroscience
Quality
Evaluated by Western Blotting in mouse retinal tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected NRL (Neural Retina Leucine Zipper) in mouse retinal tissue lysate.
Target description
~31 kDa observed; 26.08 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rabbit polyclonal antibody in PBS with 0.05% sodium azide and 50% glycerol.
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in PBS with 0.05% sodium azide and 50% glycerol.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_032762, UniProt accession no. P54846, shipped in ambient
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-NRP1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABC1469 ABC1469-25UL General descriptionNeuropilin-1 (UniProt: O14786; also known as Vascular endothelial cell growth factor 165 receptor, CD304) is encoded by the NRP1 (also known as NRP, VEGF165R) gene (Gene ID: 8829) in human. Three isoforms of Neuropilin-1 have been reported that are produced by alternative splicing. Isoform 1 of Neuropilin-1 is a homodimer, single-pass type I membrane protein with three calcium-binding sites (aa 195, 209, and 250). It can also form heterodimers with neuropilin-2. This membrane-bound isoform serves as a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform of PGF, The VEGF165 isoform of VEGFA and VEGFB. Its co-expression with VEGFR-2 (KDR) results in increased VEGF165 binding to VEGFR-2 as well as increased chemotaxis. It has an extracellular domain (aa 22-856), a helical domain (aa 857-879), and the cytoplasmic domain (aa 880-923). It is produced with a signal peptide (aa 1-21) that is subsequently cleaved to generate the mature form. The soluble isoform 2 binds VEGF-165 and appears to inhibit its binding to cells. It may also induce apoptosis by sequestering VEGF-165. It may also bind various members of the semaphorin family and its expression has an adverse effect on blood vessel number and integrity. The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly expressed in heart and placenta; moderately in lung, liver, skeletal muscle, kidney and pancreas; and low in adult brain. Isoform 2 is found in liver hepatocytes, kidney distal and proximal tubules.
Specificity
This rabbit polyclonal antibody detects Neuropilin-1 in human cells. It targets an epitope within 313 amino acids from the internal region.ImmunogenHis-tagged recombinant fragment corresponding to 313 amino acids from the internal region of human Neuropilin-1.ApplicationAnti-NRP1, Cat. No. ABC1469, is a rabbit polyclonal antibody that detects human Neuropilin-1 and has been tested for use in Immunohistochemistry (Paraffin), Inhibition Activity/Function, and Western Blotting.
Immunohistochemistry Analysis: A 1:50-250 dilution from a representative lot detected NRP1 in human prostate cancer and human bone marrow tissue.
Western Blotting Analysis: A representative lot detected NRP1 in Western Blotting applications (Pang, H.B., et. al. (2014). Nat Commun. 5:4904).
Inhibits Activity/Function: A representative lot reduced iRGD-induced vascular permeability in tumor tissue and reduced the uptake of nanoparticles. (Pang, H.B., et. al. (2015). Sci Adv. 1(10):e1500821; Sugahara, K.N., et. al. (2010). Science. 328(5981):1031-5).
Quality
Evaluated by Western Blotting with recombinant Neuropilin-1.
Western Blotting Analysis: A 1:2,000 dilution of this antibody detected recombinant Neuropilin-1. recombinant protein.
Target description
~36 kDa observed for recombinant fragment. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_003864, UniProt accession no. O14786, shipped in ambient Gene Information human ... NRP1(8829)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-NSMCE2 antibody produced in rabbit
Human Protein Atlas Number: HPA051614 Human Protein Atlas characterization data
Кат. номер HPA051614-100UL HPA051614-25UL ImmunogenNSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST89647,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK conjugate unconjugated UniProt accession no. Q96MF7, shipped in wet ice storage temp. 20°C Gene Information human ... NSMCE2(286053)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-nSR100 (SRRM4)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN1477 ABN1477-25UG General descriptionSerine/arginine repetitive matrix protein 4 (UniProt: A7MD48; also known as Medulloblastoma antigen MU-MB-2.76, Neural-specific serine/arginine repetitive splicing factor of 100 kDa, Neural-specific SR-related protein of 100 kDa, nSR100) is encoded by the SRRM4 (also known as KIAA1853) gene (Gene ID: 84530) in human. nSR100 is a nuclear protein that is specifically expressed in neuronal cells. It serves as a splicing factor that is specifically required for neural cell differentiation. It acts in conjunction with nPTB/PTBP2 by binding directly to its regulated target transcripts and promote neural-specific exon inclusion in many genes that function in neural cell differentiation. It is shown to regulate the splicing of protrudin gene (Zfyve27) transcripts in neuronal cells and promotes splicing of protrudin pre-mRNA so as to include a microexon (exon L) encoding seven amino acids in a neuron-specific manner. The resulting protein known as Protrudin-L promotes neurite outgrowth during neurogenesis. Depletion of nSR100 in Neuro2A cells is shown to impair neurite outgrowth, whereas its ablation in mouse embryos is reported to prevent differentiation of neuronal progenitors in the cortex and impair development of the central and peripheral nervous systems. (Ref.: Ohnishi, T et al. (2017). Sci. Rep. 7: 41130; Quesnel-Vallires, M et al. (2015). Genes Dev. 29(7); 746-759).
Specificity
This rabbit polyclonal antibody detects Serine/arginine repetitive matrix protein 4 in human and mouse cells. It targets an epitope within 104 amino acids from the C-terminal half.ImmunogenGST/His-tagged recombinant frgment corresponding to 104 amino acids from the C-terminal half of human Serine/arginine repetitive matrix protein 4.ApplicationAnti-nSR100 (SRRM4), Cat. No. ABN1477, is a highly specific rabbit polyclonal antibody that targets Serine/arginine repetitive matrix protein 4 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Immunohistochemistry Analysis: A 1:250 dilution from a representative lot detected nSR100 (SRRM4) in mouse cerebral cortex and human cerebral cortex tissue sections.
Quality
Evaluated by Western Blotting in human cerebellum tissue lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected nSR100 (SRRM4) in 10 µg of human cerebellum tissue lysate.
Target description
~68 kDa observed; 68.56 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_919262, UniProt accession no. A7MD48, shipped in ambient Gene Information human ... SRRM4(84530)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-NUCB2 (C-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер N6789-25UL N6789-200UL General descriptionNucleobindin 2 (NUCB2), also known as DNA binding/EF-hand/acidic protein (NEFA), p54, is encoded by the gene mapped to human chromosome 11p15. It belongs to the nucleobindin family of EF-hand Ca2+ - binding proteins. NUCB2 contains multiple functional domains, including a Leu/Ile rich region, a putative nuclear localization signal, a DNA binding domain, two Ca2+ -binding EF-hand motifs and a leucine zipper region. NUCB2 is widely distributed and is localized to the Golgi apparatus. NUCB2 has been shown to interact with both necdin and ARTS-1, through the EF-hand motif.
Specificity
Anti-NUCB2 (C-terminal) specifically recognizes rat and mouse NUCB2.ApplicationAnti-NUCB2 (C-terminal) antibody produced in rabbit has been used in immunoblotting and immunofluorescence.
Biochem/physiol Actions
Nucleobindin 2 (NUCB2) has been implicated in various functions, including Ca2+ homeostasis, hypothalamic regulation of feeding and tumor necrosis factor (TNF)-receptor-1 (TNFR1)shedding. The NUCB2-ARTS-1 complex is essential for the proteolytic cleavage and release of TNFR1 to the extracellular compartment. NUCB2 has been identified as a novel satiety molecule in the hypothalamus associated with melanocortin signaling in the central nervous system. NUCB2/nesfatin-1 has been shown to induce suppression of food-intake in rats.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze in working aliquots at –20 °C. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog, our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~54 kDa species reactivity rat, mouse packaging antibody small pack of 25 µL concentration ~1.5 mg/mL application(s) indirect immunofluorescence: 10-20 µg/mL using NIH3T3 cells","western blot: 1.5-3.0 µg/mL using rat adrenal extract (S1 fraction) and mouse testis extract (S1 fraction) conjugate unconjugated UniProt accession no. Q9JI85, shipped in dry ice storage temp. 20°C Gene Information rat ... Nucb2(59295)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Nucleolin antibody produced in rabbit
MDL number: MFCD02686475 NACRES: NA.41
Кат. номер N2662-200UL N2662-25UL General descriptionRabbit polyclonal anti-Nucleolin antibody recognizes human, mouse, and rat nucleolin. Detection of the nucleolin band by immunoblotting is specifically inhibited with the immunizing peptide.
Anti-Nucleolin is produced in rabbit using as immunogen a synthetic peptide of human nucleolin with C-terminal added cysteine conjugated to KLH. Nucleolin contains a specific bipartite nuclear localization signal sequence and three different structural domains. The N-terminal domain comprises of highly acidic regions separated by basic sequences and contains multiple phosphorylation sites. The central domain contains four RNA-binding domains (RBD or RRM) and the C-terminal domain (GAR or RGG) is rich in glycine, arginine, and phenylalanine residues. N and C terminal domains are involved in protein-protein interaction whereas the central domain is involved in specific interactions with nucleic acids. Nucleolin is mainly localized in the nucleus and at the cell surface of cultured tumor cells and endothelial cells of angiogenic vessels in vivo.
Nucleolin, also known as C23, is the major nucleolar protein of exponentially growing eukaryotic cells. It is a ubiquitous conserved multi-domain phosphoprotein found in all vertebrate species. Nucleolin is a multifunctional protein involved in most steps of ribosome biogenesis. It has been implicated in chromatin structure, rDNA transcription, rRNA maturation, ribosome assembly, cytokinesis, nucleogenesis, cell proliferation and growth, and nucleo-cytoplasmic transport.Immunogensynthetic peptide corresponding to amino acid residues 2-17 of human nucleolin with C-terminal added cysteine, conjugated to KLH. The corresponding sequence differs by 4 amino acids in rat and mouse nucleolin and by 1 amino acid in the rat homolog protein NRP (nucleolin related protein).ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Rabbit polyclonal anti-Nucleolin antibody is used to tag nucleolin for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques such as immunoblotting (105 kDa), immunoprecipitation, and immunofluorescence. It is used as a probe to determine the presence and roles of nucleolin in ribosome maturation, cytokinesis, nucleogenesis, cell proliferation and growth, and nucleo-cytoplasmic transport in exponentially growing eukaryotic cells.
Biochem/physiol Actions
Nucleolin also exhibits auto degradation, DNA and RNA helicase activities, and DNA-dependent ATPase activity. Nucleolin activities may be regulated by proteolysis, methylation, ADPribosylation and phosphorylation by several kinases, including casein kinase II (CK2), p34cdc2 and protein kinase C. Nucleolin might function as a cell surface receptor for lipoproteins, viruses, extracellular matrix, growth factors and other molecules. It interacts with telomerase, which is critical for the nucleolar localization of telomerase.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 105 kDa species reactivity mouse, human, rat packaging antibody small pack of 25 µL application(s) immunoprecipitation (IP): 1-2 µg using 250 µg RIPA lysate of human HeLa cells","indirect immunofluorescence: 10-20 µg/mL using human HeLa cells","western blot: 0.5-1.0 µg/mL using whole extract of mouse NIH3T3 cells or rat PC12 cells conjugate unconjugated UniProt accession no. P19338, shipped in dry ice storage temp. 20°C Gene Information human ... NCL(4691)
mouse ... Ncl(17975)
rat ... Ncl(25135)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NUDT21
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE2873 ABE2873-25UL General descriptionCleavage and polyadenylation specificity factor subunit 5 (UniProt: O43809; also known as Cleavage and polyadenylation specificity factor 25 kDa subunit, CFIm25, CPSF 25 kDa subunit, Nucleoside diphosphate-linked moiety X motif 21, Nudix motif 21, Pre-mRNA cleavage factor Im 25 kDa subunit) is encoded by the NUDT21 (also known as CFIM25, CPSF25, CPSF5) gene (Gene ID: 11051) in human. CFlm25 is a homodimeric protein that is a component of the cleavage factor Im (CFIm) complex, which plays a key role in pre-mRNA 3-processing. It is involved in association with CPSF6 or CPSF7 in pre-MRNA 3-end poly(A) site cleavage and poly(A) addition. The interaction of CFlm25 with the RNA is one of the earliest steps in the assembly of the 3 end processing complex and facilitates the recruitment of other processing factors. It contains one Nudix hydrolase domain (aa 76-201). The region containing aa 2-147 is considered to be essential for RNA-binding. It can be acetylated by p300/CBP and acetylation results in a reduction in its interaction with Poly(A) polymerase alpha (PAPAO).
Specificity
This rabbit polyclonal antibody detects Cleavage and polyadenylation specificity factor subunit 5 (CFIm25) in human cells.ImmunogenHis-tagged full length recombinant human Cleavage and polyadenylation specificity factor subunit 5 (CFIm25).
Epitope: unknownApplicationAnti-NUDT21, Cat. No. ABE2873, is a highly specific rabbit polyclonal antibody that targets Cleavage and polyadenylation specificity factor subunit 5 and has been tested in Immunoprecipitation and Western Blotting.
Western Blotting Analysis: A representative lot detected NUDT21 in RNase A-treated HeLa whole-cell extract after IP (Katahira, J., et. al. (2013). Nucleic Acid Res. .41(14):7060-72).
Immunoprecipitation Analysis: A representative lot detected NUDT21 in Co-immunoprecipitation with FLAG-tagged CF I cell lysates (Shimazu, T., et. al. (2007). J Biol Chem. 282(7):4470-8).
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Western Blotting in Caco-2 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected NUDT21 in 10 µg of Caco-2 cell lysate.
Target description
~25 kDa observed; 26.23 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Format: Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NP_008937, UniProt accession no. O43809, shipped in ambient Gene Information human ... NUDT21(11051)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-NuMA1 Antibody, clone AD6-1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABE1807 MABE1807-25UG General descriptionNuclear mitotic apparatus protein 1 (UniProt: Q14980; also known as NuMA protein, Nuclear matrix protein-22, NMP-22, SP-H antigen) is encoded by the NUMA1 (also known as NMP22, NUMA) gene (Gene ID: 4926) in human. NMP-22 is a homodimeric nuclear protein that is highly abundant component of the nuclear matrix where it may serve a non-mitotic structural role and occupies the majority if the nuclear volume. It is required for maintenance and establishment of the mitotic spindle poles during symmetric cell divisions, functioning as a tether linking bulk microtubules of the spindle to centrosomes. It is also considered to be essential or proper alignment of the mitotic spindle during asymmetric cell divisions. NMP-22 resides in the nuclear matrix during interphase and then dissociates from condensing chromosomes during early prophase and relocates to the spindle poles via dynein/dynamin association and it remains there until the anaphase onset. As mitosis progresses it re-associates with telophase chromosomes very early during nuclear reformation, before substantial accumulation of lamins on chromosomal surfaces is evident. NMP-22 is phosphorylated in the C-terminal tail during mitosis, most likely by CDK1 and phosphorylation increases its solubility and promotes association with dynein and subsequent translocation to the spindle poles. O-glycosylation during cytokinesis at sites identical or close to phosphorylation sites interferes with the phosphorylation status of NMP-22.
Specificity
Clone AD6-1 detects NuMA1 in human and mouse cells. It targets an epitope within 181 amino acids from the C-terminal region.ImmunogenA recombinant fragment corresponding to 181 amino acids from the C-terminal region of human Nuclear mitotic apparatus protein 1 (NuMA1).ApplicationWestern Blotting Analysis: 0.5 µg/mL from a representative lot detected NUMA1 in 10 µg of NIH/3T3 cell lysate.
Immunocytochemistry Analysis: A 1:50 dilution from a representative lot detected NUMA1 in HepG2 cells.
Immunocytochemistry Analysis: A representative lot detected NUMA1 in Immunocytochemistry applications (Carminati, M., et. al. (2016). Nat Struct Mol Biol. 23(2):155-63; Gallini, S., et. al. (2016). Curr Biol. 26(4):458-69).
Western Blotting Analysis: A representative lot detected NUMA1 in Western Blotting applications (Carminati, M., et. al. (2016). Nat Struct Mol Biol. 23(2):155-63; Gallini, S., et. al. (2016). Curr Biol. 26(4):458-69).
Research Category
Epigenetics & Nuclear Function
Anti-NuMA1, clone AD6-1 Antibody, Cat. No. MABE1807, is a highly specific mouse monoclonal antibody that targets NUMA1 and has been tested in Immunocytochemistry and Western Blotting.
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected NUMA1 in 10 µg of HeLa cell lysate.
Target description
~250 kDa observed; 238.26 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone AD6-1, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_001273490, UniProt accession no. Q14980-1, shipped in ambient Gene Information human ... NUMA1(4926)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
