Antibodies
- Сортировать:
- Вид таблицей
-
Anti-MSH6 (C-terminal) antibody produced in rabbit
MDL number: MFCD09039195 NACRES: NA.41
Кат. номер M2820-200UL M2820-25UL General descriptionMutS Homolog 6 (MSH6) is localized on human chromosome 2p16.3. MSH6 is a 160 kDa protein with nuclear localization sequence and a N-terminal disordered domain. It is a human homolog of E. coli MutS.Immunogensynthetic peptide corresponding to amino acids 1311-1327 of human MSH6, conjugated to KLH via an N-terminal added cysteine residue. The immunizing peptide differs from the rat and mouse sequences in one amino acid.ApplicationAnti-MSH6 (C-terminal) antibody produced in rabbit has been used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
MSH6 (also known as GTBP) was isolated from HeLa cells by virtue of its ability to restore mismatch repair to nuclear extracts of MSH2-deficient colorectal tumor cell lines. MutS Homolog 6 (MSH6) is part ofDNA repair pathways and play a key role onmutator S protein (hMutSα) shuttling. MSH6 has ATPase activity that is critical in mismatch repair. Germline mutations in MSH6 is associated with hereditary nonpolyposis colon cancer and in endometrial carcinoma.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 160 kDa species reactivity human packaging antibody small pack of 25 µL concentration ~1 µg/L application(s) immunoprecipitation (IP): 2.5-5 µg using HEK 293T cell lysates","indirect immunofluorescence: 10-20 µg/mL using paraformaldehyde-fixed HeLa cells","microarray: suitable","western blot: 0.5-1 µg/mL using HEK 293T cell lysates conjugate unconjugated UniProt accession no. P52701, shipped in dry ice storage temp. 20°C Gene Information human ... MSH6(2956)
Safety InformationWGK Germany 3 Узнать цену -
Anti-MSH6 (N-terminal) antibody produced in rabbit
MDL number: MFCD09039196 NACRES: NA.41
Кат. номер M2445-200UL M2445-25UL General descriptionMutS Homolog 6 (MSH6) is a human homolog of E. coli MutS. It is a 160 kDa with nuclear localization sequence and a N-terminal disordered domain. It is localized on human chromosome 2p16.3.Immunogensynthetic peptide corresponding to amino acids 2-18 of human MSH6, conjugated to KLH via a C-terminal added cysteine residue. The immunizing peptide is conserved in mouse and rat.ApplicationAnti-MSH6 (N-terminal) antibody produced in rabbit has been used in:- immunoblotting
- immunoprecipitation
- immunofluorescence
Biochem/physiol Actions
MutS Homolog 6 (MSH6) is part of DNA repair pathways and plays a key role in mutator S protein (hMutSα) shuttling. MSH6 has ATPase activity that is critical in mismatch repair. Germline mutations in MSH6 is associated with hereditary nonpolyposis colon cancer and in endometrial carcinoma. MSH6 (also known as GTBP) was isolated from HeLa cells by virtue of its ability to restore mismatch repair to nuclear extracts of MSH2-deficient colorectal tumor cell lines.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form IgG fraction of antiserum antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 160 kDa species reactivity human packaging antibody small pack of 25 µL application(s) immunoprecipitation (IP): 5-10 µg using HEK 293T cell lysates","indirect immunofluorescence: 1:100-1:200 using paraformaldehyde-fixed HEK 293T cells","microarray: suitable","western blot: 1:2,000-1:4,000 using HEK 293T cell lysates conjugate unconjugated UniProt accession no. P52701, shipped in dry ice storage temp. 20°C Gene Information human ... MSH6(2956)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MT-ATP6 Antibody, clone 1G7-1G2
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS1995 MABS1995-25UG General descriptionATP synthase subunit a (UniProt: P00846; also known as F-ATPase protein 6) is encoded by the MT-ATP6 (also known as ATP6, ATPASE6, MTATP6) gene (Gene ID: 4508) in human. F-ATPase Protein 6 is an inner mitochondrial membrane protein and is a component of Complex V, which produces ATP from ADP in the presence of proton gradient across the membrane. F-type ATPases have 2 components, CF1 - the catalytic core - and CF0- the membrane proton channel. The CF1 catalytic core contains five subunits: alpha3, beta3, gamma1, delta1, epsilon1 and CF0 has three main subunits known as a, b, and c. Together they form a rotary motor. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Defects in MT-ATP6 gene cause multiple mitochondrial diseases, such as Leber hereditary optic neuropathy (LHON), which is characterized by acute and subacute loss of central vision due to optic nerve dysfunction. Some defects also lead to mitochondrial complex V deficiency that leads to neuropathy, ataxia, and hypertrophic cardiomyopathy.
Specificity
Clone 1G7-1G2 detects ATP synthase subunit a (MT-ATP6) in mitochondria isolated from human cells.ImmunogenEpitope: N-terminus
A synthetic peptide corresponding to the N-terminus of human MT-ATP6.ApplicationWestern Blotting Analysis: 0.5 µg/mL from a representative lot detected MT-ATP6 in mitochondria from human neonatal dermal fibroblasts and mitochondria from human neonatal dermal fibroblasts depleted of mtDNA (Courtesy of Michael F. Marusich, Ph.D., mAbDx, Inc., Eugene, OR USA).
Research Category
Signaling
Anti-MT-ATP6, clone 1G7-1G2, Cat. No. MABS1995, is a mouse monoclonal antibody that detects ATP synthase subunit a and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in Mitochondria from human neonatal dermal fibroblasts and mitochondria from human neonatal dermal fibroblasts depleted of mtDNA.
Western Blotting Analysis: 1 µg/mL of this antibody detected MT-ATP6 in Mitochondria from human neonatal dermal fibroblasts and mitochondria from human neonatal dermal fibroblasts depleted of mtDNA.
Target description
~20 kDa observed; 24.82 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2b in HEPES-Buffered Saline (15 mM HEPES, 150 mM NaCl, pH 7.2) with 0.02% sodium azide.
Protein L
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 1G7-1G2, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2b NCBI accession no. YP_003024031.1, UniProt accession no. P00846,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MT-ND2 Antibody, clone 9E12-1B3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS2047 MABS2047-25UG General descriptionNADH-ubiquinone oxidoreductase chain 2 (UniProt: P03891; also known as EC: 1.6.5.3, NADH dehydrogenase subunit 2, MT-ND2) is encoded by the MT-ND2 (also known as MTND2, NADH2, ND2) gene (Gene ID: 4536) in human. MT-ND2 is a mitochondrial inner membrane protein that forms the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (Coenzyme Q10) that participates in the generation of a proton gradient, which is then used for ATP synthesis. Defects in MT-ND2 gene are known to cause of Leber hereditary optic neuropathy (LHON) that is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes.
Specificity
Clone 9E12-1B3 detects NADH-ubiquinone oxidoreductase chain 2 (MT-ND2) in mitochondria from human cells. It targets an epitope within the N-terminal region.ImmunogenEpitope: N-terminus
Synthetic peptide corresponding to the N-terminus of human MT-ND2.ApplicationWestern Blotting Analysis: 2 µg/mL from a representative lot detected MT-ND2 in mitochondria from human neonatal dermal fibroblasts and mitochondria from human neonatal dermal fibroblasts depleted of mtDNA (Courtesy of Michael F. Marusich, Ph.D., mAbDx, Inc., Eugene, OR USA).
Research Category
Signaling
Anti-MT-ND2, clone 9E12-1B3, Cat. No. MABS2047, is a mouse monoclonal antibody that detects NADH-ubiquinone oxidoreductase chain 2 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in mitochondria from human neonatal dermal fibroblasts and mitochondria from human neonatal dermal fibroblasts depleted of mtDNA.
Western Blotting Analysis: 1 ug/mL of this antibody detected MT-ND2 in 10 µg of human neonatal dermal fibroblasts and mitochondria from human neonatal dermal fibroblasts depleted of mtDNA.
Target description
~30 kDa observed; 38.96 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Protein L
Purified mouse monoclonal antibody IgG2a in buffer containing HEPES-Buffered Saline (150 mM NaCl, 15 mM HEPES, pH 7.2) with 0.02% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 9E12-1B3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2a NCBI accession no. YP_003024027.1, UniProt accession no. P03891,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MT-ND4 Antibody, clone 9E4-2D8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS1994 MABS1994-25UG General descriptionNADH-ubiquinone oxidoreductase chain 4 (UniProt: P03905; also known as EC: 1.6.5.3, NADH dehydrogenase subunit 4, MT-ND4) is encoded by the MT-ND4 (also known as MTND4, NADH4, ND4) gene (Gene ID: 4538) in human. MT-ND4 is an inner mitochondrial membrane protein that belongs to the complex I subunit 4 family. It is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). The complex couples the oxidation of NADH and the reduction of ubiquinone (Coenzyme Q10), to the generation of a proton gradient, which is then used for ATP synthesis. The complex can be dissociated into two main sub-complexes, corresponding to the "ankle" of the boot, and the "foot" of the boot. The ankle is thought to protrude from the membrane so as to be predominantly in the aqueous phase on the matrix side. It contains the binding site for NAD(H), and the input electron transfer chain. The foot (hydrophobic) is membrane bound and contains a catalytic site at which ubiquinone is reduced. Defects in MT-ND4 gene are known to cause Leber hereditary optic neuropathy (LHON) that is characterized by acute or subacute loss of central vision due to optic nerve dysfunction. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes. Other diseases associated with MT-ND4 gene mutations are age-related macular degeneration, mesial temporal lobe epilepsy, and cystic fibrosis.
Specificity
Clone 9E4-2D8 detects NADH-ubiquinone oxidoreductase chain 4 in mitochodria isolated from human cells.ImmunogenKLH-conjugated linear peptide from the C-terminal region.ApplicationWestern Blotting Analysis: 4 µg/mL from a representative lot detected MT-ND4 in mitochondria from Human Neonatal Dermal Fibroblasts and mitochondria from Human neonatal dermal fibroblasts depleted of mtDNA. (Courtesy of Michael F. Marusich, Ph.D., mAbDx, Inc., Eugene, OR, USA).
Anti-MT-ND4, clone 9E4-2D8, Cat. No. MABS1994,is a mouse monoclonal antibody that detects NADH-ubiquinone oxidoreductase chain 4 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in Mitochondria from human neonatal dermal fibroblasts and mitochondria from human neonatal dermal fibroblasts depleted of mtDNA.
Western Blotting Analysis: 1 µg/mL of this antibody detected MT-ND4 in Mitochondria from human neonatal dermal fibroblasts and did not detect it in mitochondria from human neonatal dermal fibroblasts depleted of mtDNA.
Target description
~37 kDa observed; 51.58 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing HEPES-Buffered Saline (150 mM NaCl, 15 mM HEPES, pH 7.2) with 0.02% sodium azide.Other NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 9E4-2D8, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2a NCBI accession no. YP_003024035.1, UniProt accession no. P03905,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-mtHsp70 Antibody, clone JG1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABS1955-25UL MABS1955-100UL General descriptionHeat shock 70 kDa protein 1A (UniProt: Q61696; also known as Heat shock 70 kDa protein 3, HSP70.3, Hsp68, PBP74, Grp75) is encoded by the Hspa1a (also known as Hsp70-3, Hsp70A1) gene (Gene ID: 193740) in murine species. The 70-kDa heat shock protein (HSP70) is highly conserved, ubiquitous protein that functions as a molecular chaperone and helps in folding of newly synthesized or denatured proteins and in activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Heat shock 70 kDa protein 1A is localized in cytoplasmic mRNP granules containing untranslated mRNAs. It is acetylated at Lysine 77 by NA110 in response to cellular stress and then it is
gradually deacetylated by HDAC4 at later stages. Its acetylation enhances its chaperone activity and determines whether it will function as a chaperone for protein refolding or degradation by controlling its binding to co-chaperones HOPX and STUB1. The acetylated form and the non-acetylated form are shown to bind to HOPX and STUB1, respectively. It contains four ATP-binding regions and its N-terminal nucleotide binding domain (NBD; ATPase domain) is responsible for binding and hydrolyzing ATP. Its substrate binding domain (SBD) is localized to the C-terminal region. When ADP is bound in the NBD, a conformational change enhances the affinity of the SBD for client proteins. (Ref.: Green, JM et al. (1995). Hybridoma 14(4); 347-354).
Specificity
Clone JG1 specifically detects Heat shock 70 kDa protein 1A (MtHSP70).ImmunogenA linear peptide corresponding to 19 amino acids from the C-terminal region of murine mtHSP70 and conjugated to amino acids 582-599 of Tetnus toxoid at its N-terminal.
Epitope: C-terminusApplicationWestern Blotting Analysis: 1:500 dilution from a representative lot detected mtHsp70 in HeLa and U2OS cell lysates.
Immunocytochemistry Analysis: A representative lot detected mtHsp70 in Immunocytochemistry applications (Green, J.M., et. al. (1995). Hybridoma. 14(4):347-54; McCormick, A.L., et. al. (2005). J Virol. 79(19):12205-17).
Immunoprecipitation Analysis: A representative lot immunoprecipitated mtHsp70 in Immunoprecipitation applications (Green, J.M., et. al. (1995). Hybridoma. 14(4):347-54).
ELISA Analysis: A representative lot detected mtHsp70 in ELISA applications (Green, J.M., et. al. (1995). Hybridoma. 14(4):347-54).
Western Blotting Analysis: A representative lot detected mtHsp70 in Western Blotting applications (Green, J.M., et. al. (1995). Hybridoma. 14(4):347-54).
Research Category
Signaling
Anti-mtHsp70, clone JG1, Cat. No. MABS1955, is a mouse monoclonal antibody that detects Heat shock 70 kDa protein 1A and has been tested for use in ELISA, Immunocytochemistry, Immunoprecipitation, and Western Blotting.
Quality
Evaluated by Western Blotting in MCF7-10A cell lysate.
Western Blotting Analysis: 1:500 dilution of this antibody detected mtHsp70 in MCF7-10A cell lysate.
Target description
~75 kDa observed; 70.08 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG3 in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone JG1, monoclonal species reactivity mouse, human species reactivity (predicted by homology) hamster (based on 100% sequence homology) packaging antibody small pack of 25 µL application(s) ELISA: suitable","immunocytochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG3 NCBI accession no. NP_034609.2, UniProt accession no. Q61696, Узнать цену -
Anti-MTNR1B
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABT1890 ABT1890-25UG General descriptionMelatonin receptor type 1B (UniProt: P49286; also known as Mel-1B-R, Mel1b receptor) is encoded by the MTNR1B gene (Gene ID: 4544) in human. Mel-1B-R is a member of the G-protein coupled 1 family that is predominantly expressed in retina and to lesser extent in brain tissue. . Mel-1B-R activity is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity. Mel-1B-R mediates the reproductive and circadian actions of melatonin. Melatonin is shown to be involved in body mass regulation in mammals and this effect is suggest to be mediated by a direct action of melatonin on Mel-1B receptors on brown adipocytes. Melatonin is reported to act as a chemopreventive agent and its levels inversely correlate with the risk of developing cancer. In this regard melatonin induces p38-dependent phosphorylation of both p53 and histone H2AX. Activation of the p53-dependent DNA damage response by melatonin is mediated by both Mel-1A and Mel-1B receptors. The absence of either receptor impairs melatonins ability to reduce both cell proliferation and clonogenic potential of cancer cells. A variant in MTNR1B gene is reported to worsen the deleterious effect of melatonin on glucose tolerance in humans. (Ref.: Brydon, L. et al. (2001). Endocrinology. 142(10):4264-4271; Santoro, R., et al. (2013). Carcinogenesis. 34(5):1051-1061).
Specificity
This rabbit polyclonal antibody detects Melatonin receptor type 1B in human.ImmunogenEpitope: N-terminus
KLH-conjugated linear peptide corresponding to 20 amino acids from the N-terminal region of human Melatonin receptor type 1B.ApplicationImmunohistochemistry Analysis: A 1:250 dilution from a representative lot detected MTNR1B in human retina tissue.
Research Category
Cell Structure
Anti-MTNR1B Antibody, Cat. No. ABT1890, is a rabbit polyclonal antibody that detects MTNR1B and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in HepG2 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected MTNR1B in 10 µg of HepG2 cell lysate.
Target description
40.19 kDa calculated.
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_005950.1, UniProt accession no. P49286, shipped in ambient Узнать цену -
Anti-Mucin 5B Antibody, clone MDA-3E1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT899 MABT899-25UL General descriptionMucin 5, subtype B, tracheobronchial (UniProt: E9Q5I3; also known as MUC5B ) is encoded by the Muc5b gene (Gene ID: 74180) in murine species. Mucins are high molecular weight glycoproteins that consist of a mucin core protein and O-linked carbohydrates. Mucins are present on the surface of, and are secreted by, many glandular epithelial cells. They provide a barrier between the luminal membranes of cells in the epithelium and their environment. Mucins consist of a nonglobular protein backbone (apomucin) and many O-linked glycans. The two principal polymeric mucins are reported in the airways. They are Mucin 5ac that is produced at low levels under healthy conditions, but increases during allergic inflammation or parasitic infection, and Mucin 5B that is produced at substantial levels under healthy conditions and modestly increases under conditions of allergic inflammation Mucin 5B is shown to be abnormally expressed in gastric carcinoma. (Ref.: Ren, B et al. (2015). (Biosci Rep. 35(3): e00220).
Specificity
Clone MDA-3E1 detects Mucin 5b in human and murine species, it targets an epitope within 20 amino acids from the N-terminal half.ImmunogenA linear peptide corresponding to 20 amino acids from the N-terminal half of murine Mucin 5 subunit B.ApplicationImmunohistochemistry Analysis: A representative lot detected Muc5b in Immunohistochemistry applications (Ren, B., et. al. (2015). Biosci Rep. 35(3), e00220).
Western Blotting Analysis: A representative lot detected Muc5b in Western Blotting applications (Ren, B., et. al. (2015). Biosci Rep. 35(3); e00220).
Anti-Mucin 5B, clone MDA-3E1 , Cat. No. MABT899, is a mouse monoclonal antibdoy that detects Mucin 5b and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry in human nasal mucosal tissue.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected Muc5b in human nasal mucosal tissue.
Target description
515.44 kDa calculated. The actual molecular weight of the glycosylated protein may be up to 10-fold higher.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone MDA-3E1, monoclonal species reactivity human, mouse packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_083077, UniProt accession no. E9Q5I3, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Mucin-16 (CA-125) Antibody, clone 5E11 MABC1608-25UG
eCl@ss: 32160702 General descriptionMucin-16 (UniProt: Q8WXI7; also known as MUC-16, Ovarian cancer-related tumor marker CA125, CA-125, Ovarian carcinoma antigen CA125) is encoded by the MUC16 (also known as CA125) gene (Gene ID: 94025) in human. Mucin-16 is a heavily O-glycosylated protein that can be liberated into the extracellular space following the phosphorylation of the intracellular C-terminus, which induces proteolytic cleavage and liberation of extracellular domain. I provides protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16 is composed of three domains: a Serine, Threonine-rich N-terminal domain, a repeated domain containing between 12 and 60 partially conserved tandem repeats of 156 amino acids and a C-terminal transmembrane domain with a short cytoplasmic tail. Its expression is up-regulated in ovarian cancer cells and may serve as a marker for ovarian cancer. Mucin-16 is shown to binds to mesothelin (MSLN) and this binding mediates heterotypic cell adhesion, which may contribute to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium.
Specificity
Clone 5E11 detects Mucin-16 in human ovarian cancer tissue. It targets an epitope within 264 amino acids from the C-terminal half.ImmunogenHis-tagged recombinant fragment corresponding to 264 amino acids from the C-terminal half of human Mucin-16.ApplicationAnti-Mucin-16 (CA-125), clone 5E11, Cat. No. MABC1608, is a mouse monoclonal antibody that detects Mucin-16 and it has been tested for use in Immunohistochemistry (Paraffin), Proximity Ligation Assay, and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected Mucin-16 in ovarian serous cystadenocarcinoma tissue (Courtesy of Dr. Leonor David, M.D., Ph.D., IPATIMUP and Medical Faculty of the University of Porto, Portugal).
Proximity Ligation Assay Analysis: A representative lot detected Mucin-16 in Proximity Ligation Assay applications (Ricardo, S., et. al. (2016). Virchows Arch. 468(6):715-22; Ricardo, S., et. al. (2015). Mol Oncol. 9(2):503-12).
Immunohistochemistry Analysis: A representative lot detected Mucin-16 in Immunohistochemistry applications (Marcos-Silva, L., et. al. (2015). Glycobiology. 25(11):1172-82; Ricardo, S., et. al. (2015). Mol Oncol. 9(2):503-12).
Immunohistochemistry Analysis: A representative lot detected Mucin-16 in ovarian serous cystadenocarcinoma tissue (Courtesy of Dr. Leonor David, M.D., Ph.D., IPATIMUP and Medical Faculty of the University of Porto, Portugal).
Western Blotting Analysis: A representative lot detected Mucin-16 in Western Blotting applications (Marcos-Silva, L., et. al. (2015). Glycobiology. 25(11):1172-82).
Research Category
Apoptosis & Cancer
Quality
Evaluated by Immunohistochemistry in human ovarian cancer and human uterine tissues.
Immunohistochemistry (Paraffin) Analysis: A 1:50-250 dilution of this antibody detected Mucin-16 in human ovarian cancer and human uterine tissues.
Target description
1519.17 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other Notesfeature_concentration_valuePlease refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5E11, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","proximity ligation assay: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_078966.2, UniProt accession no. Q8WXI7, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Mucin-9 Antibody, clone 7E10
eCl@ss: 32160702
Кат. номер MABC1109-25UG MABC1109 General descriptionOviduct-specific glycoprotein (UniProt: Q12889; also known as Estrogen-dependent oviduct protein, Mucin-9, Muc-9, Oviductal glycoprotein, Oviductin) is encoded by the OVGP1 (also known as MUC9, OGP) gene (Gene ID: 5016) in human. The mucins are a family of highly glycosylated, secreted proteins with a basic structure consisting of a variable number of tandem repeats. Mucin-9 belongs to the glycosyl hydrolase 18 family that plays a key role in sperm capacitation, fertilization, and development of early embryos. It is secreted from non-ciliated oviductal epithelial cells and its expression is highest at the time of ovulation. Mucin-9 is synthesized with a 21 amino acid signal peptide that is subsequently cleaved off to generate mature protein. Mucin-9 is an estrogen-dependent protein that is secreted into the lumen of the oviduct and associates with the zona pellucida of postovulatory oocytes in oviductal transit, but is absent in ovarian oocytes.
Specificity
Clone 7E10 detects Mucin-9 (Oviductin) in human oviduct sections.ImmunogenA mixture of GST-tagged recombinant fragments corresponding to 81 amino acids from the N-terminal half and 112 amino acids from the C-terminal region of human Mucin-9/Oviductin.ApplicationImmunohistochemistry Analysis: A 1:250 dilution from a representative lot detected Mucin-9 in human placenta tissue.
Western Blotting Analysis: A representative lot detected Mucin-9 in Western Blotting applications (Maines-Bandiera, S., et. al. (2010). Int J Gynecol Cancer. 20(1):16-22).
ELISA Analysis: A representative lot detected Mucin-9 in ELISA applications (Maines-Bandiera, S., et. al. (2010). Int J Gynecol Cancer. 20(1):16-22).
Immunohistochemistry Analysis: A representative lot detected Mucin-9 in Immunohistochemistry applications (Maines-Bandiera, S., et. al. (2010). Int J Gynecol Cancer. 20(1):16-22).
Anti-Mucin-9, clone 7E10, Cat. No. MABC1109, is mouse monoclonal antibody that detects Mucin-9 (Oviductin) and has been tested for use in ELISA, Immunohistochemistry (Paraffin), and Western Blotting.
Research Category
Apoptosis & Cancer
Quality
Evaluated by Immunohistochemistry in human oviduct tissue.
Immunohistochemistry Analysis: A 1:250 dilution of this antibody detected Mucin-9 in human oviduct tissue.
Target description
75.42 kDa calculated.
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 7E10, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) ELISA: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_002548, UniProt accession no. Q12889, shipped in ambient Gene Information human ... OVGP1(5016)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Mucolipin-1 antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер M8072-25UL M8072-200UL General descriptionMonoclonal Anti-Mucolipin-1 (mouse IgG1 isotype) is derived from the hybridoma MLN128 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a recombinant fusion protein corresponding to amino acid 1.Mucolipin-1 is also termed TRP-ML1, MLN1, ML1 mucolipidin. MLN1 shares significant sequence homology with the TRP superfamily of cation channels.
Mucolipin-1 (MCOLN1) is a member of transient receptor potential (TRP) protein family. It is a cation channel present on endosomes and lysosomes.ApplicationMonoclonal Anti-Mucolipin-1 has been used in:- enzyme linked immunosorbent assay (ELISA)
- immunoblotting
- immunocytochemistry.
Biochem/physiol Actions
Mucolipin-1 (MCOLN1) is involved in the regulation of lysosomal trafficking. It aids in the transport of Ca2+ into the cytosol from the lumen, in response to the changing levels of phosphatidylinositol-3, 5-bisphosphate. Mutations in the gene encoding MCOLN1 have been shown to be associated with mucolipidosis type IV.
Mutations in the MCOLN1 gene is implicated in Mucolipidosis type IV (MLIV) is an autosomal recessive, neurodegenerative disorder. Rather, MLIV pathophysiology has been linked to deficiency in membrane trafficking, and organelle dynamics in the late endocytic pathway. Specifically, MLIV cells have been shown to accumulate autophagosomes, due to increased de novo autophagosome formation and due to delayed fusion of autophagosomes with late endosomes/lysosomes.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone MLN128, monoclonal form buffered aqueous solution mol wt antigen ~110 kDa (additional bands may be observed) species reactivity human packaging antibody small pack of 25 µL concentration ~2.0 mg/mL application(s) immunocytochemistry: suitable","indirect ELISA: suitable","western blot: 4-8 µg/mL using membrane fraction of HEK-293T expressing human mucolipin-1 conjugate unconjugated UniProt accession no. Q9GZU1, shipped in dry ice storage temp. 20°C Gene Information human ... MCOLN1(57192)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MUL1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABN1388 ABN1388-25UG General descriptionMitochondrial ubiquitin ligase activator of NFKB 1 (UniProt: Q969V5; also known as E3 SUMO-protein ligase MUL1, E3 ubiquitin-protein ligase MUL1, Growth inhibition and death E3 ligase, Mitochondrial-anchored protein ligase, MAPL, MAPL, Putative NF-kappa-B-activating protein 266, RING finger protein 218) is encoded by the MUL1 (also known as C1orf166, GIDE, MAPL, MULAN, RNF218) gene (GeneID: 79594) in human. MUL1 is a multi-pass membrane protein located on the outer mitochondrial membrane. It plays a role in the control of mitochondrial morphology and also promotes mitochondrial fragmentation and influences mitochondrial localization. MUL1 displays a weak E3 ubiquitin-protein ligase activity. It contains a RING-type zinc finger domain (aa 302-340), which is required for its E3 ligase activity. MUL1 can ubiquitinate Akt1 preferentially at Lys-284 involving Lys-48-linked polyubiquitination and seems to be involved in regulation of Akt signaling by targeting phosphorylated Akt to proteosomal degradation. When over-expressed, MUL1 is reported to inhibit cell growth by activating JNK through MAP3K7/TAK1 and inducing caspase-dependent apoptosis. MUL1 is ubiquitinated by PARK2 during mitophagy, leading to its degradation and enhancement of mitophagy.
Specificity
This rabbit polyclonal antibody detects Mitochondrial ubiquitin ligase activator of NFKB 1 in Human skeletal muscle tissue.ImmunogenKLH-conjugated linenar peptide corresponding to 12 amino acids from the C-terminal region of human Mitochondrial ubiquitin ligase activator of NFKB 1 (MUL1).ApplicationResearch Category
Neuroscience
Immunohistochemistry Analysis: A 1:50-250 dilution of this antibody detected MUL1 in human cerebellum, human skeletal muscle myocytes, and human cerebral cortex.
Anti-MUL1, Cat. No. ABN1388, is a highly specific rabbit polyclonal antibody that targets Mitochondrial ubiquitin ligase activator of NFKB 1 and has been tested in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in human skeletal muscle tissue lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected MUL1 in 10 µg of human skeletal muscle tissue lysate.
Target description
~39 kDa observed; 39.8 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) rhesus macaque (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_078820, UniProt accession no. Q969V5, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MULT1 Antibody, clone 1D6
eCl@ss: 32160702
Кат. номер MABS1906-25UG MABS1906-100UG General descriptionUL16-binding protein-like transcript 1 splicing variant (UniProt: Q330P3; also known as MULT1, MULT-1, ULBP1) is encoded by the Ulbp1 gene in murine species. MULT-1 is a MHC Class I-like molecule that serves as a high affinity ligand for natural Killer Group 2D (NKG2D) receptor. It is a type I transmembrane protein that is synthesized with a signal peptide (aa 1-25), which is subsequently cleaved off to generate the mature form. Its transmembrane domain is localized to amino acids 124 to 146 and its extracellular domain contains an alpha 1 and alpha 2 like domain with two intrachain disulfide bonds. MULT-1 expression is reported to be low or absent in normal adult tissues, however, under conditions of stress and in tumor cells its levels are elevated. Many tumor cells are shown to release soluble NKG2D ligands through proteolytic shedding, alternative splicing, or exosome secretion. In mice MULT-1 is shown to cause NK cell activation and tumor rejection. Mice subjected to cytomegalovirus (MCMV) infection display strong expression of Ulbp1 (Mult1) gene, but surface expression of MULT-1 is nevertheless completely abolished by the virus. Fc receptor fcr-1 is reported to down-regulate MULT-1 levels by interfering with surface MULT-1 and causing its subsequent degradation in lysosomes. This effect of Fcr-1 can be completely abolished by imipramine (Cat. No. I0899), which blocks AP2-mediated clathrin pathway. (Ref.: Lenac, T., et al. (2006). J. Exp. Med. 203(8); 1843 1850; Krmpotic, A., et al. (2005). J. Exp. Med. 201(2): 211-220; Deng, W., et al. (2015). Science. 348(6230); 136-139).
Specificity
Clone 1D6 is a rat monoclonal antibody that detects UL16-binding protein-like transcript 1 splicing variant in mouse.ImmunogenRecombinant fragment corresponding to 186 amino acids from the extracellular domain of murine UL16-binding protein-like transcript 1 splicing variant (MULT-1).
Epitope: extracellular domainApplicationAnti-MULT1, clone 1D6, Cat. No. MABS1906, is a rat monoclonal antibody that detects UL16-binding protein-like transcript 1 splicing variant and has been tested for use in ELISA, Flow Cytometry, and Immunocytochemistry.
Research Category
Signaling
Immunocytochemistry Analysis: A representative lot detected MULT1 in Immunocytochemistry applications (Lenac, T., et. al. (2006). J Exp Med. 203(8):1843-50; Krmpotic, A., et. al. (2005). J Exp Med. 201(2):211-20).
Flow Cytometry Analysis: A representative lot detected MULT1 in Flow Cytometry applications (Lenac, T., et. al. (2006). J Exp Med. 203(8):1843-50; Krmpotic, A., et. al. (2005). J Exp Med. 201(2):211-20).
ELISA Analysis: A representative lot detected MULT1 in ELISA applications (Sheppard, S., et. al. (2017). Nat Commun. 8:13930; Krmpotic, A., et. al. (2005). J Exp Med. 201(2):211-20).
Quality
Evaluated by Flow Cytometry in Splenocytes from BALB/c mouse.
Flow Cytometry Analysis: 1 µg of this antibody detected MULT1 in one million splenocytes from BALB/c mouse.
Target description
27.59 kDa calculated.
Physical form
Purified rat monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 1D6, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) ELISA: suitable","flow cytometry: suitable","immunocytochemistry: suitable isotype IgG2a UniProt accession no. Q330P3,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MuLV TM Antibody, clone 42-114
eCl@ss: 32160702
Кат. номер MABF2074-25UL MABF2074-200UL General descriptionThe murine leukemia virus (MuLV) is a gammaretrovirus that has a positive, single-stranded sense RNA, which replicates via reverse transcription. The envelope of the virus is shown to be covered with glycoprotein spikes. Three major genes produced by the murine leukemia virus are gag, pol, and env. The gag gene codes for the group-specific antigen that is responsible for the production of the viral matrix capsid and nucleoproteins. The pol gene encodes reverse transcriptase, a protease, and an integrase. The reverse transcriptase is used to make complementary DNA by reverse transcribing its own RNA into DNA. The reverse transcriptase in MuLV is able to act as a monomer as opposed to a dimer. The integrase integrates the synthesized viral DNA into the host cell s DNA. The env gene codes for a glycosylated protein that is processed into the two viral envelope proteins, gp70 and p15(E), which aid the virus in selecting and attacking host cells. The gp70 protein has the receptor binding activity of the virus. Retrovirus membrane fusion is catalyzed by the Env, surface (SU) and transmembrane (TM) proteins. The SU protein is involved in receptor binding, while the TM protein contains the necessary elements for membrane fusion. Clone 42-114 is TM-specific and does not recognize G541R mutants. (Ref. Schneider, WM., et al. (2008). Virology. 371(1); 165-174).
Specificity
Clone 42-114 detects murine leukemia virus in infected cells.ImmunogenAKR K36 and AKR SL3 leukemia virus.ApplicationImmunoprecipitation Analysis: A representative lot immunoprecipitated MuLV TM (Pinter, A., et. al. (1982). Virology. 116(2):499-516).
Western Blotting Analysis: A representative lot detected MuLV TM in Western Blotting applications (Schneider, W.M., et. al. (2008). Virology. 371(1):165-74).
Anti-MuLV TM, clone 42-114, Cat. No. MABF2074, is a mouse monoclonal antibody that detects Murine leukemia virus (MuLV) transmembrane protein and has been tested for use in Immunoprecipitation and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in HEK293 cells infected with murine leukemia virus (MuLVs).
Western Blotting Analysis: A 1:250 dilution of this antibody detected MuLV TM in HEK293 cells infected with murine leukemia virus (MuLVs).
Target description
~15 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified by ion-exchange chromatography
Purified mouse monoclonal antibody IGM in PBS with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 42-114, monoclonal species reactivity virus, mouse packaging antibody small pack of 25 μL application(s) immunoprecipitation (IP): suitable, western blot: suitable isotype IgMκ
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Murine Coronavirus MHV-JHM nucleocapsid Antibody, clone 1-16-1
Кат. номер MABF2751-25UL MABF2751-100UL General descriptionNucleoprotein (UniProt: C0KYZ4; also known as Nucleocapsid protein, NC, Protein N) is encoded by the N gene(Gene ID: 1489757) in Murine coronavirus (MHV-JHM.IA). The murine coronavirus mouse hepatitis virus (MHV), a member of the Coronaviridae family, is an enveloped virus with a single-stranded, positive-sense RNA genome. The MHV-JHM strain is shown to be highly neurovirulent and can spread in the brain in mCEACAM1a independent manner. MHV-JHM infection in susceptible weanling mice is reported to result in an encephalomyelitis when neurons, astrocytes, and oligodendrocytes are infected. MHV infection of the murine central nervous system has also been used as a model for the study of chronic demyelinating diseases. The nucleocapsid protein (N) is a basic RNA binding protein that is highly conserved among MHV strains and plays a major role in the extent of neurovirulence. It also plays structural roles by both complexing with genome RNA to form the viral capsid and interacting with the viral membrane protein (M) during virion assembly. It has three conserved regions (I, II, and III) that are separated by two hypervariable regions. It is reported to associate with microtubules, suggesting a possible role for N in trafficking and axonal transport in neurons (Ref.: Cowley, TJ., et al. (2010). J. Virol. 84(4); 1752 1763; Miura, TA., et al. (2008). J. Virol. 82(2); 755-763).
Specificity
Clone 1-16-1 is a mouse monoclonal antibody that detects nucleoprotein of Murine coronavirus (MHV-JHM.IA).ImmunogenRobb/Lampert strain of MHV-JHM (live whole virus).ApplicationAnti-Murine Coronavirus MHV-JHM nucleocapsid, clone 1-16-1, Cat. No. MABF2751, mouse monoclonal antibody, detects Murine Coronavirus MHV-JHM nucleocapsid and is tested in Immunofluorescence, Immunohistochemistry, Immunoprecipitation & Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in Mouse delayed brain tumor (DBT) cell lysates.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Murine Coronavirus MHV-JHM nucleocapsid in Mouse delayed brain tumor (DBT) cell lysates.
Tested Applications
Western Blotting Analysis: A representative lot detected Murine Coronavirus MHV-JHM nucleocapsid in Western Blotting applications (Leibowitz, J.L., et al. (1987). Adv Exp Med Biol. 218; 321-31).
Immunofluorescence Analysis: A representative lot detected Murine Coronavirus MHV-JHM nucleocapsid in Immunofluorescence applications (Nanda, S.K., et al. (2001). J Virol. 75(7):3352-62).
Immunohistochemistry Applications: A representative lot detected Murine Coronavirus MHV-JHM nucleocapsid in Immunohistochemistry applications (Miura, T.A., et al. (2008). J Virol. 82(2):755-63; Navas, S., et al. (2001). J Virol. 75(5):2452-7).
Immunoprecipitation Analysis: A representative lot detected Murine Coronavirus MHV-JHM nucleocapsid in Immunoprecipitation applications (Nanda, S.K., et al. (2004). Arch Virol. 149(1):93-111).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 1-16-1, monoclonal mol wt calculated mol wt 49.73 kDa","observed mol wt ~50 kDa purified by using protein G species reactivity SARS coronavirus packaging antibody small pack of 100 µL application(s) immunofluorescence: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG1 epitope sequence Unknown conjugate unconjugated Protein ID accession no. YP_209238, UniProt accession no. C0KYZ4, shipped in 2-8°C Gene Information vaccinia virus ... N(1489757)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Muscle Satellite Cells Antibody, clone SM C-2.6
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT857 MABT857-25UG General descriptionSkeletal muscle satellite cells are quiescent mononucleated myogenic cells that reside between the sarcolemma and basement membrane of terminally-differentiated muscle fibers. They serve as a reserve population of cells with stem-like properties. The number of satellite cells are shown to be highest in postnatal muscle, but declines with age. In their quiescent stage, satellite cells are rounded and mononucleated, and do not express relevant amounts of myogenic proteins. Also, in their quiescent state they are shown to be c-kit-, Sca-1-, CD34+, and CD45-. Satellite cells can proliferate in response to injury and regenerate muscle and produce more satellite cells. Hence, they have been considered to be the only myogenic source for the maintenance of skeletal muscle. When muscle regeneration is initiated, satellite cells changes from their quiescent state to an active stage and begin to proliferative. They can proliferate and then either fuse with each other to form myotubes, which mature into myofibers, or they can fuse with damaged segments of muscle fibers. (Ref.: Fukuda, S et al. (2004). Exp. Cell Res. 296(2); 245-255; Morgan JE and Partridge, TA (2003). Int. J. Biochem. Cell Biol. 35(8); 1151 1156).
Specificity
Clone SM C-2.6 detects quiescent satellite cells from adult mouse muscle.ImmunogenC2/4 myogenic cells.ApplicationResearch Category
Cell Structure
Anti-Muscle Satellite Cells, clone SM C/2.6, Cat. No. MABT857, is a mouse monoclonal antibody that detects muscle satellite cells and has been tested for use in Flow Cytometry, Immunofluorescence, Immunohistochemistry, and Fluorescence Activated Cell Sorting (FACS).
Fluorescence Activated Cell Sorting (FACS) Analysis: A representative lot detected Muscle Satellite Cells in Fluorescence Activated Cell Sorting (FACS) applications (Urbani, L., et. al. (2012). PLoS One. 7(11):e49860).
Flow Cytometry Analysis: A representative lot detected Muscle Satellite Cells in Flow Cytometry applications (Ikemoto, M., et. al. (2007). Mol Ther. 15(12):2178-85; Fukada, S., et. al. (2004). Exp Cell Res. 296(2):245-55).
Immunohistochemistry Analysis: A representative lot detected Muscle Satellite Cells in Immunohistochemistry applications (Fukada, S., et. al. (2004). Exp Cell Res. 296(2):245-55; Yao, Y., et. al. (2016). Nat Commun. 7:11415).
Immunofluorescence Analysis: A representative lot detected Muscle Satellite Cells in Immunofluorescence applications (Fukada, S., et. al. (2004). Exp Cell Res. 296(2):245-55).
Quality
Evaluated by Flow Cytometry in C2C12 cells.
Flow Cytometry Analysis: 1 µg of this antibody detected Muscle Satellite Cells in a population of one million C2C12 cells.
Physical form
Format: Purified
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone SM/C-2.6, monoclonal species reactivity mouse packaging antibody small pack of 25 μg application(s) flow cytometry: suitable, immunofluorescence: suitable, immunohistochemistry: suitable isotype IgG1κ
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MUSTN1
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABD115 ABD115-25UG General descriptionMusculoskeletal embryonic nuclear protein 1 (UniProt: Q8IVN3; also known a MUSTN1) is encoded by the MUSTN1 gene (Gene ID: 389125) in human. MUSTN1 is a small protein of the MUSTANG family that is found predominantly in the musculoskeletal system. It plays a role in the development and regeneration of the musculoskeletal system. It localizes to the nucleus and specifically, spatially in mesenchymal cells of the developing limbs and in the fracture callus in periosteal osteoprogenitor cells, proliferating chondrocytes, and young active osteoblasts. MUSTN1 sequence is highly homologous in vertebrates and contains a nuclear localization sequence without any other significant motifs. MUSTN1 is highly expressed during embryogenesis and is essential for chondrocyte proliferation and differentiation. (Ref.: Gersch, RP and Hadjiargyrou, M (2009). Bone 45(2); 330-338).
Specificity
This rabbit polyclonal antibody detects Musculoskeletal embryonic nuclear protein 1 (MUSTN1) in human and mouse. It targets an epitope within 12 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 12 amino acids from the C-terminal region of human Musculoskeletal embryonic nuclear protein 1.
Epitope: C-terminusApplicationResearch Category
Cell Structure
Western Blotting Analysis: 2 µg/mL from a representative lot detected MUSTN1 in human heart tissue lysate.
Immunohistochemistry Analysis: A 1:250-1,000 dilution from a representative lot detected MUSTN1 in human skeletal muscle, mouse embryo, and mouse embryonic lung tissues.
Western Blotting Analysis: 2 µg/mL from a representative lot detected MUSTN1 in human heart tissue lysate.
Immunohistochemistry Analysis: A 1:250-1,000 dilution from a representative lot detected MUSTN1 in human skeletal muscle, mouse embryo, and mouse embryonic lung tissues.
Anti-MUSTN1, Cat. No. ABD115, is a rabbit polyclonal antibody that detects human and murine Musculoskeletal embryonic nuclear protein 1 and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in C2C12 cell lysate.
Western Blotting Analysis: 2 µg/mL of this antibody detected MUSTN1 in C2C12 cell lysate.
Target description
~13 kDa observed; 8.91 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine, 0.15 M NaCl, pH7.4 with 0.05% sodium azide.
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine, 0.15 M NaCl, pH7.4 with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human, mouse species reactivity (predicted by homology) rat (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG NCBI accession no. NP_995325.3, UniProt accession no. Q8IVN3, shipped in ambient Gene Information human ... MUSTN1(389125)
Safety InformationFlash Point F does not flash Flash Point C does not flash Узнать цену -
Anti-MYBL2 antibody produced in rabbit
Human Protein Atlas Number: HPA030530 Human Protein Atlas characterization data
Кат. номер HPA030530-100UL HPA030530-25UL Immunogenv-myb avian myeloblastosis viral oncogene homolog-like 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78055,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50-1:200 immunogen sequence NALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSL conjugate unconjugated UniProt accession no. P10244, shipped in wet ice storage temp. 20°C Gene Information human ... MYBL2(4605)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Myc Tag Antibody
eCl@ss: 32160702 NACRES: NA.43
Кат. номер 6-549 6-549-25UG 6-549-100UG General descriptionEpitope tags are useful for the labeling and detection of proteins using immunoblotting, immunoprecipitation and immunostaining techniques. Due to their small size, they are unlikely to affect the tagged protein′s biochemical properties. The Myc epitope tag is widely used to detect expression of recombinant proteins in bacteria, yeast, insect and mammalian cell systems.
Specificity
Other species cross-reactivity not tested.
Recognizes and is specific for human Myc and recombinant proteins containing the Myc epitope tag.ImmunogenSynthetic peptide corresponding to residues 409-420 of human Myc (MEQKLISEEDLN).
Epitope: a.a. 409-420ApplicationResearch Category
Epitope Tags & General Use
Research Sub Category
Epitope Tags
Anti-Myc Tag Antibody is an antibody against Myc Tag for use in IC & WB.
Immunocytochemistry:
This antibody is reported to detect Myc-tagged proteins in transfected cells.
Quality
Evaluated by Western Blot on Myc-PP2A A subunit transfected NIH/3T3 lysates.
Western Blotting:
1:500 dilution of this antibody detected myc-PP2A on 10 µg of Myc-PP2A A subunit transfected NIH/3T3 lysates.
Target description
Predicted molecular weight for human Myc: 49 kDa Obeserved molecular weight may vary.
Physical form
Format: Purified
Protein A chromatography
Purified rabbit in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl with 0.05% sodium azide. Frozen solution.
Storage and Stability
Stable for 1 year at -20ºC from date of receipt.
Analysis Note
Control
Positive control for human Myc: widespread expression including A431 cell lysate, ovarian cancer cell lysate, or breast carcinoma tissue. Myc fusion protein expressed in cells.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NM_002467.3, UniProt accession no. P01106, shipped in dry ice Узнать цену -
Anti-Myc Tag Antibody, clone 4A6
eCl@ss: 32160702
Кат. номер 5-724 5-724-25UG 5-724-100UG General descriptionEpitope tags are useful for the labeling and detection of proteins using immunoblotting, immunoprecipitation and immunostaining techniques. Due to their small size, they are unlikely to affect the tagged proteins biochemical properties.
The Myc epitope tag is widely used to detect expression of recombinant proteins in bacteria, yeast, insect and mammalian cell systems.
Specificity
Recognizes recombinant proteins containing the Myc epitope tag (EQKLISEEDL) in a variety of sequence contexts; also recognizes human Myc.Immunogenpeptide corresponding to amino acids 410-420 (MEQKLISEEDL) of human MycApplicationThis Anti-Myc Tag Antibody, clone 4A6 is validated for use in ChIP, IC, IF, IP, WB for the detection of Myc Tag. This antibody has been cited in more than 25 published papers.
Research Category
Epitope Tags & General Use
Research Sub Category
Epitope Tags
Quality
routinely evaluated by immunoblot on Myc-tagged recombinant protein in sequence contexts not well recognized by anti-Myc Tag, clone 9E10 (Catalogue No. CBL430)
Target description
Predicted MW for human Myc: 49 kDa
Physical form
Protein G Purified
Format: Purified
Protein A Purified immunoglobulin in 0.1M Tris-Glycine, 0.15M NaCl, 0.05 Sodium Azide, pH 7.4.
Storage and Stability
Maintain at 2 to 8°C for 1 year from date of shipment.
Analysis Note
Control
Positive control for human Myc: Widespread expression including A431 cell lysate, ovarian cancer cell lysate, or breast carcinoma tissue. Myc fusion protein expressed in cells.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 4A6, monoclonal species reactivity human packaging antibody small pack of 25 µg Торговая марка Upstate® application(s) ChIP: suitable (ChIP-seq)","immunocytochemistry: suitable","immunofluorescence: suitable","immunoprecipitation (IP): suitable","western blot: suitable isotype IgG NCBI accession no. NM_002467.3, UniProt accession no. P01106, shipped in ambient Узнать цену -
Anti-Myelin Basic Protein
eCl@ss: 32160702
Кат. номер ABN912-25UG ABN912-100UG General descriptionMyelin basic protein (UniProt: also known as MBP) is encoded by the MBP gene in guinea pig. MBP is a homodimeric protein that is found in both the central and the peripheral nervous system. It is one of the most abundant protein component of the myelin membrane in the CNS and plays a role in both the formation and stabilization of this myelin membrane. It is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin. At least 5 charge isomers (C1, C2, C3, C4, and C5) are reported to be produced because of optional post-translational modifications such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. Of these C1 isomer is the most cationic, least modified, and most abundant form and C5 is the least cationic form. C1 and C2 are reported to be unphosphorylated, C3 and C4 are monophosphorylated, and C5 is phosphorylated at two positions. Phosphorylation is achieved with the help of TAOK2, VRK2, MAPK11, MAPK12, MAPK14, and MINK1). MBP can interact with many polyanionic proteins including actin, tubulin, calmodulin, and clathrin, and with negatively charged lipids. (Ref.: Boggs, JM (2006). Cell. Mol. Life Sci. 63(17); 1945-61).
Specificity
This rabbit polyclonal antibody detects myelin basic protein. It targets an epitope within 19 amino acids from the internal region.ImmunogenKLH-conjugated linear peptide corresponding to 19 amino acids from the internal region of Guinea pig myelin basic protein.ApplicationAnti-Myelin Basic Protein Antibody, Cat. No. ABN912, is a highly specific rabbit polyclonal antibody that targets Myelin basic protein and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Neuroscience
Immunohistochemistry Analysis: A 1:1,000 dilution from a representative lot detected Myelin Basic Protein in human cerebral cortex and rat cerebellum tissue sections.
Quality
Evaluated by Western Blotting in human cerebellum tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Myelin Basic Protein in human cerebellum tissue lysate.
Target description
~17 kDa observed; 18.21 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human, rat species reactivity (predicted by homology) guinea pig (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable UniProt accession no. P25188, Узнать цену -
Anti-Myelin Basic protein Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер AB15542 AB15542-25UL
Specificity
Myelin basic protein [MBP]. By Western blot the antibody recognizes a band at ~14-18 kDa on human brain lysate and ~14-18 kDa on recombinant MBP. An additional band at ~65 kDa may be seen depending on sample and antibody concentration used.ImmunogenRecombinant MBP.ApplicationResearch Category
Neuroscience
Research Sub Category
Neuronal & Glial Markers
Neurochemistry & Neurotrophins
Western blot: 1:1,000-1:2,000 using recombinant MBP and 1:5,000-1:10,000 using human brain lysate.
Optimal working dilutions must be determined by end user.
Detect Myelin Basic protein using this Anti-Myelin Basic protein Antibody validated for use in WB.
Quality
Tested
Physical form
Serum
Liquid.
Storage and Stability
Maintain at -20°C in undiluted aliquots for up to 6 months after date of receipt. Avoid repeated freeze/thaw cycles.Other Notesfeature_concentration_valuePlease refer to lot specific datasheet.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL Торговая марка Chemicon® application(s) western blot: suitable NCBI accession no. NM_001025081.1,","NM_001025090.1,","NM_001025092.1,","NM_001025094.1,","NM_001025098.1,","NM_001025100.1,","NM_001025101.1,","NM_002385.2, UniProt accession no. P02686, shipped in dry ice storage temp. 20°C Узнать цену -
Anti-MYH-1 Antibody, clone 6F12H3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT846-25UG MABT846-100UG General descriptionMyosin-1 (UniProt: Q5SX40; also known as Myosin heavy chain 1, Myosin heavy chain 2x, MyHC-2x, Myosin heavy chain, skeletal muscle, adult 1) is encoded by the Myh1 gene (Gene ID: 17879) in murine species. Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular sub-fragments (S1) and 1 rod-shaped sub-fragment (S2). In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and non-muscle cells. These isoforms show expression that is spatially and temporally regulated during development. Myosin-1 contains an N-terminal SH3-like domain (aa 33-82), a myosin motor domain (aa 86-785), and an IQ domain (aa 788-817). It also contains 2 actin binding regions (aa 662-684 and 764-778).
Specificity
Clone 6F12H3 is a rat monoclonal antibody that detects Myosin-1 in mouse and rat muscles. It target an epitope within the coiled coil domain in the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 29 amino acids from the C-terminal half of murine Myosin-1.ApplicationResearch Category
Cell Structure
Anti-MYH-1, clone 6F12H3, Cat. No. MABT846, is a rat monoclonal antibody that detects Myosin-1 and has been tested for use in Immunofluorescence. Immunohistochemistry, and Western Blotting.
Immunohistochemistry Analysis: A 1:25 dilution from a representative lot detected MYH-1 in mouse heart and mouse skeletal muscle tissue.
Immunofluorescence Analysis: A representative lot detected MYH-1 in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected MYH-1 in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunohistochemistry Analysis: A representative lot detected MYH-1 in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MYH-1 in mouse soleus muscle tissue lysates.
Target description
~220 kDa observed; 223.34 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 6F12H3, monoclonal species reactivity rat, mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable isotype IgG1 NCBI accession no. NP_109604, UniProt accession no. Q5SX40,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MYH-2 Antibody, clone 8F72C8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT848-25UG MABT848-100UG General descriptionMyosin-2 (UniProt: Q9UKX2; also known as Myosin heavy chain 2, Myosin heavy chain 2a, MyHC-2a, Myosin heavy chain IIa, MyHC-IIa, Myosin heavy chain, skeletal muscle, adult 2) is encoded by the MYH2 (also known as MYHSA2) gene (Gene ID: 4620) in human. Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular sub-fragments (S1) and 1 rod-shaped sub-fragment (S2). In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and non-muscle cells. These isoforms show expression that is spatially and temporally regulated during development. Myosin-2 contains an N-terminal SH3-like domain (aa 33-82), a myosin motor domain (aa 86-784), and an IQ domain (aa 787-816). It also contains 2 actin binding regions (aa 661-683 and 763-777). Mutations in MYH2 gene are known to cause Proximal myopathy and ophthalmoplegia (MYPOP), a muscular disorder characterized by mild-to-moderate muscle weakness and predominance of type 1 fibers and small or absent type 2A fibers.
Specificity
Clone 8F72C8 is a rat monoclonal antibody that detects Myosin-2 in mouse and rat muscle. It targets an epitope within 29 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 29 amino acids from the C-terminal half of human Myosin-2ApplicationAnti-MYH-2, clone 8F72C8, Cat. No. MABT848, is a rat monoclonal antibody that detects Myosin-2 and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected MYH-2 in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected MYH-2 in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunofluorescence Analysis: A representative lot detected MYH-2 in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunohistochemistry Analysis: A 1:25 dilution from a representative lot detected MYH-2 in mouse heart and mouse skeletal muscle tissues.
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MYH-2 in mouse soleus muscle tissue lysate.
Target description
~220 kDa observed; 223.04 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 8F72C8, monoclonal species reactivity rat species reactivity (predicted by homology) human (based on 100% sequence homology), mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a NCBI accession no. NP_001093582, UniProt accession no. Q9UKX2,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MYH-4 Antibody, clone 2G72F10
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT847-25UG MABT847-100UG General descriptionMyosin-4 (UniProt: Q5SX39; also known as Myosin heavy chain 2b, MyHC-2B, Myosin heavy chain 4) is encoded by the Myh4 gene (Gene ID: 17884) in murine species. Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular sub-fragments (S1) and 1 rod-shaped sub-fragment (S2). In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and non-muscle cells. These isoforms show expression that is spatially and temporally regulated during development. Myosin-4 contains an N-terminal SH3-like domain (aa 33-82), a myosin motor domain (aa 86-782), and an IQ domain (aa 785-814). It also contains 2 actin binding regions (aa 659-681 and 761-775).
Specificity
Clone 2G72F10 is a rat monoclonal antibody that detects Myosin-4 in mouse and rat muscles. It targets an epitope within 29 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 29 amino acids from the C-terminal half of murine Myosin-4.ApplicationResearch Category
Cell Structure
Anti-MYH-4, clone 2G72F10, Cat. No. MABT847, is a rat monoclonal antibody that detects Myosin-4 and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry Analysis: A representative lot detected MYH-4 in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected MYH-4 in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunofluorescence Analysis: A representative lot detected MYH-4 in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunohistochemistry Analysis: A 1:25 dilution from a representative lot detected MYH-4 in mouse heart and mouse skeletal muscle tissues.
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected MYH-4 in mouse soleus muscle tissue lysate.
Target description
~220 kDa observed; 222.86 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified rat monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rat antibody form purified antibody antibody product type primary antibodies clone 2G72F10, monoclonal species reactivity rat, mouse packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_034985, UniProt accession no. Q5SX39,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-MYO18B antibody produced in rabbit
Human Protein Atlas Number: HPA000953 Human Protein Atlas characterization data
Кат. номер HPA000953-100UL HPA000953-25UL ImmunogenMyosin-XVIIIb recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Myosin-XVIIIb is a protein encoded by the MYO18B gene in humans. It is located on chromosome 22q12.1. The gene is may function as a tumor suppressor and its inactivation is involved in lung cancer progression. It is expressed mainly in human cardiac and skeletal muscles and, at lower levels, in testis. It can be used for the treatment of locally advanced malignant pleural mesothelioma (MPM) in humans. Alterations in this gene include both epigenetic and genetic alterations and play an important role in ovarian carcinogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73434,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunofluorescence: 0.25-2 µg/mL immunogen sequence GSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKY conjugate unconjugated UniProt accession no. Q8IUG5, shipped in wet ice storage temp. 20°C Gene Information human ... MYO18B(84700)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Myomesin-2 Antibody, clone 3B9.3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT94-25UG MABT94-100UG General descriptionMyomesin-2 (UniProt: P54296; also known as 165 kDa connectin-associated protein, 165 kDa titin-associated protein, M-protein, Myomesin family member 2) is encoded by the MYOM2 gene (Gene ID: 9172) in human. Myomesin-2 is a major component of the vertebrate myofibrillar M band and is mainly expressed in fast fibers. It binds myosin, titin, and light meromyosin in a dose-dependent manner. Its primary function is to upkeep M-band filament lattice. It has a unique N-terminal domain followed by 12 repeat domains with strong homology to either fibronectin type III or immunoglobulin C2 domains. Myomesin-2 is shown to interact with dysferlin, a protein that aids in repairing the sarcolemma when it is damaged or torn due to muscle strain and assists in myofibril stability.
Specificity
Clone 3B9.3 detects human muscle Myomesin-2. It targets an epitope with in the N-terminal half.ImmunogenGST-tagged recombinant fragment corresponding to 154 amino acids from the N-terminal region of human Myomesin-2.ApplicationResearch Category
Cell Structure
Anti-Myomesin-2, clone 3B9.3, Cat. No. MABT94, is a mouse monoclonal antibody that detects human Myomesin-2 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in human skeletal muscle tissue lysate.
Western Blotting Analysis: 0.05 µg/mL of this antibody detected Myomesin-2 in human skeletal muscle tissue lysate.
Target description
~165 kDa observed; 164.90 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone 3B9.3, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) western blot: suitable isotype IgG2a NCBI accession no. NP_003961, UniProt accession no. P54296, Узнать цену -
Anti-Myosin (Skeletal, Fast) antibody, Mouse monoclonal
MDL number: MFCD00145920 NACRES: NA.41
Кат. номер M1570-25UL M1570-200UL M1570-100UL General descriptionLocalizes an epitope on the myosin heavy chain. Stains the fast (type II) and neonatal isomyosin molecules found in skeletal muscle, but does not stain cardiac muscle, smooth muscle or non-muscle myosin in cultured cells. Does react with human rhabdomyosarcomas.Immunogenrabbit muscle myosin.ApplicationThe level of mysosin (fast) in serum samples from sportsmen with past injury was determined by western blot using monoclonal mouse anti-myosin (skeletal/fast) as the primary antibody at a dilution of 1:90000.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone MY-32, monoclonal form buffered aqueous solution species reactivity chicken, rabbit, feline, mouse, rat, bovine, human, guinea pig packaging antibody small pack of 25 µL concentration ~1.0 mg/mL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 10-20 µg/mL using porcine tongue","microarray: suitable","western blot: 0.5-1.0 µg/mL using total extract of rabbit skeletal muscle isotype IgG1 conjugate unconjugated UniProt accession no. P12882, shipped in dry ice storage temp. 20°C Gene Information human ... MYH1(4619), MYH2(4620)
mouse ... Myh1(17879), Myh2(17882)
rat ... Myh1(287408), Myh2(691644)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-Myosin 7 (MYH7) Antibody, clone 4B51E8
eCl@ss: 32160702 NACRES: NA.41
Кат. номер MABT849-25UG MABT849-100UG General descriptionMyosin-7 (UniProt: Q91Z83; also known as Myosin heavy chain 7, Myosin heavy chain slow isoform, MyHC-slow, Myosin heavy chain, cardiac muscle beta isoform, MyHC-beta) is encoded by the MYH7 gene (Gene ID: 140781) in murine species. Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Myosins form regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle. Myosin-7 is a component of thick filaments of the myofibrils. It contains actin- and ATP-binding sites in its conserved catalytic head domain. Its actin binding region is localized to amino acids 655-677 and 757-771 and the ATP-binding region is localized to amino acids 178-185. Myosin-7 has an N-terminal SH3-like domain (aa 32-81), a myosin motor domain (aa 85-778), and an IQ domain (aa 781-810). Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces one light meromyosin (LMM) and one heavy meromyosin (HMM). HMM can be further cleaved into two globular sub fragments (S1) and 1 rod-shaped sub fragment (S2).
Specificity
Clone 4B51E8 is a rat monoclonal antibody that detects murine Myosin-7. It targets an epitope within 39 amino acids from the C-terminall half.ImmunogenKLH-conjugated linear peptide corresponding to 39 amino acids from the C-terminal region of murine Mysoin-7.ApplicationAnti-Myosin 7 (MYH7), clone 4B51E8, Cat. No. MABT849, is a rat monoclonal antibody that detects Mysoin-7 and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Immunohistochemistry (Paraffin) Analysis: A 1:25 dilution from a representative lot detected Myosin 7 (MYH7) in mouse skeletal muscle tissue.
Immunohistochemistry Analysis: A representative lot detected Myosin 7 (MYH7) in Immunohistochemistry applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Immunofluorescence Analysis: A representative lot detected Myosin 7 (MYH7) in Immunofluorescence applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: A representative lot detected Myosin 7 (MYH7) in Western Blotting applications (Sawano, S., et. al. (2016). PLoS One. 11(11):e0166080).
Western Blotting Analysis: 2 µg/mL from a representative lot detected Myosin 7 (MYH7) in mouse soleus muscle tissue lysate.
Quality
Evaluated by Immunohistochemistry (Paraffin) in mouse heart tissue.
Immunohistochemistry (Paraffin) Analysis: A 1:25 dilution of this antibody detected Myosin 7 (MYH7) in mouse heart tissue.
Target description
222.88 kDa calculated.
Physical form
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from the date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 4B51E8, monoclonal species reactivity mouse species reactivity (predicted by homology) rat (based on 100% sequence homology), human (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG2a UniProt accession no. Q91Z83,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Myosin 7 (MYH7) Antibody, clone BA-D5
eCl@ss: 32160702
Кат. номер MABT838-25UG MABT838-100UG General descriptionMyosin-7 (UniProt: Q9BE39; also known as Myosin heavy chain 7, Myosin heavy chain slow isoform, MyHC-slow, Myosin heavy chain, cardiac muscle beta isoform, MyHC-beta) is encoded by the MYH7 gene (Gene ID: 282714) in bovine species. Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Myosins form regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle. Myosin-7 is a component of thick filaments of the myofibrils. It contains actin- and ATP-binding sites in its conserved catalytic head domain. Its actin binding region is localized to amino acids 655-677 and 757-771 and the ATP-binding region is localized to amino acids 178-185. Myosin-7 has an N-terminal SH3-like domain (aa 32-81), a myosin motor domain (aa 85-778), and an IQ domain (aa 781-810). Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Limited proteolysis of myosin heavy chain produces one light meromyosin (LMM) and one heavy meromyosin (HMM). HMM can be further cleaved into two globular sub fragments (S1) and 1 rod-shaped sub fragment (S2).
Specificity
Clone BA-D5 detects Myosin-7 in multiple mammalian species. It detects both alpha- and beta-slow myosin heavy chain.ImmunogenPurified myosin from bovine atrium.ApplicationResearch Category
Cell Structure
Immunohistochemistry Analysis: A representative lot detected Myosin 7 (MYH7) in Immunohistochemistry applications (Goh, Q., et. al. (2017). Elife. 6. pii: e20007).
Western Blotting Analysis: A representative lot detected Myosin 7 (MYH7) in Western Blotting applications (De Jong, A., et. al. (2017). PLoS One. 12(3):e0174043; Gan, Z., et. al. (2013). J Clin Invest. 123(6):2564-75).
Immunofluorescence Analysis: A representative lot detected Myosin 7 (MYH7) in Immunofluorescence applications (Gan, Z., et. al. (2013). J Clin Invest. 123(6):2564-75; Pannerec, A., et. al. (2016). Aging (Albany NY). 8(4):712-29).
Anti-Myosin 7 (MYH7), clone BA-D5, Cat. No. MABT838, is a mouse monoclonal antibody that detects Myosin-7 and has been tested for use in Immunofluorescence, Immunohistochemistry, and Western Blotting.
Quality
Evaluated by Western Blotting in mouse soleus muscle tissue lysate.
Western Blotting Analysis: 4 µg/mL of this antibody detected Myosin 7 (MYH7) in mouse soleus muscle tissue lysate.
Target description
~220 kDa observed; 223.23 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone BA-D5, monoclonal species reactivity mouse, human packaging antibody small pack of 25 µg application(s) immunofluorescence: suitable","immunohistochemistry: suitable","western blot: suitable isotype IgG2b NCBI accession no. NP_777152, UniProt accession no. Q9BE39,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Myosin IIA, non muscle antibody produced in rabbit
MDL number: MFCD03455610 NACRES: NA.41
Кат. номер M8064-.2ML M8064-25UL General descriptionMyosin heavy chain 9 (MYH9) gene codes for the nonmuscle myosin heavy chain IIA.
Myosin heavy chain 9 is expressed in platelets and the gene encoding it is localized on chromosome 22.Immunogensynthetic peptide corresponding to amino acids 1949-1960 of human nonmuscle myosin IIA.ApplicationAnti-Myosin IIA, non muscle antibody produced in rabbit has been used in:- immunofluorescence
- immunohistochemistry
- fixed cell staining/ immunofluorescence staining
- immunoblot
- immunoprecipitation
Biochem/physiol Actions
Nonmuscle myosin II is involved in cell motility and adhesion, cytokinesis, vesicular transport, intracellular force generation and in morphogenesis during development. Its activity is regulated by light chain and possibly heavy chain phosphorylation and by association with proteins such as Mts1. Mutations in the NMHCA gene are found in several syndromes associated with megakaryocyte/platelet/leukocyte disorders. Mutations in the MYH9 gene causes a spectrum of macrothrombocytopenia disorders with neutrophil inclusions, termed as MYH9 disorders.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% BSA and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~200 kDa species reactivity human, rat, canine packaging antibody small pack of 25 µL application(s) indirect immunofluorescence: 1:100 using cultured rat NRK cells","microarray: suitable","western blot: 1:1,000 using whole cell extracts of cultured dog MDCK kidney cells and cultured human Jurkat cells conjugate unconjugated UniProt accession no. P35579, shipped in dry ice storage temp. 20°C Gene Information human ... MYH9(4627)
rat ... Myh9(25745)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Myosin Light Chain Kinase antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200808-25UL SAB4200808-100UL General descriptionMyosin Light Chain Kinase (MLCK) also known as MYLK is a Ca2+/calmodulin dependent myosin light chain phosphorylating agent. This enzyme plays a major role in the phosphorylation of the regulatory light chains of myosin which are essential for the shortening and tension development of smooth muscle cells resulting in smooth muscle contraction. Myosin light chain kinase are widely expressed in many different tissues and cells of eukaryote species. There are two genes mylk1 and mylk2 encoding the MLCK protein, mylk2 is exclusively expressed in skeletal muscle cells.ImmunogenPurified chicken gizzard myosin light chain kinase.ApplicationMonoclonal Anti-Myosin Light Chain Kinase recognizes the myosin light chain kinase of smooth muscle and from non-muscle cells such as cultured fibroblasts. Reactivity has been observed with myosin light chain kinase from chicken, turkey, bovine, human, mouseand pig origin. The antibody is recommended to use in various immunological techniques, including Immunoblotting (~160kDa), Immunohistochemistry and immunofluorescence.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.Other NotesThis product is for R&D use only, not for drug, household, or other uses.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone K36, monoclonal form buffered aqueous solution mol wt ~160 kDa species reactivity turkey, bovine, pig, mouse, chicken, human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 0.25-0.5 µg/mL using chicken gizzard extract isotype IgG2b UniProt accession no. Q15746, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-N-Cadherin Antibody, clone 13A9
eCl@ss: 32160702
Кат. номер 5-915-25UL 5-915 5-915-100UL General descriptionCadherin-2 (UniProt P19022; also known as CD325, CDw325, N-cadherin, Neural cadherin) is encoded by the CDH2 (also known as CDHN, NCAD) gene (Gene ID 1000) in human. Cadherins constitute a family of calcium-dependent cell-cell adhesion proteins that play important roles in the embryonic development and maintenance of normal tissue architecture. Cadherins are composed of an extracellular domain (a.a. 160-724 of human N-cadherin) with five homologous repeats that mediates adhesion, a single pass transmembrane domain (a.a. 725-745 of human N-cadherin), and a conserved cytoplasmic domain (a.a. 746-906 of human N-cadherin) that interacts with catenins to link cadherins to the actin cytoskeleton. In addition, a known Src substrate p120ctn also modulate the strength of cadherin-dependent adhesion by interacting with cadherins at their intracellular juxtamembrane domain. Cadherins are synthesized as precursor proteins that must be proteolytically cleaved to generate functional, mature proteins. Newly synthesized proN-cadherin (a.a. 1-906) is phosphorylated and proteolytically processed prior to transport to the plasma membrane. In addition, Plakoglobin (gamma-catenin) and beta-catenin associate only with phosphorylated proN-cadherin, whereas p120ctn can associate with both phosphorylated and non-phosphorylated proN-cadherin. The N-terminal signal and propeptide (a.a. 1-25 and 26-159 of of human N-cadherin) region is proteolytically removed and a core N-cadherin-catenin complex is assembled in the endoplasmic reticulum or Golgi compartment prior to localization at the plasma membrane where linkage to the actin cytoskeleton can be established.
Specificity
Clone 13A9 recognizes N-cadherin, but not P-, E-, or M-cadherin (Knudsen, K.A., et al. (1995). J. Cell Biol. 130(1):67-77).ImmunogenEpitope: Cytoplasmic domain.
Bacterially expressed human N-cadherin cytoplasmic domain MBP fusion protein (Knudsen, K.A., et al. (1995). J. Cell Biol. 130(1):67-77).ApplicationResearch Category
Cell Structure
Immunohistochemistry Analysis: A representative lot immunostained the extracellular matrix of the stable plaques and in the fibrous cap region rich in vascular smooth muscle cells (VSMCs) using patients-derived parafn-embedded internal carotid artery tissue sections (Musumeci, G., et al. (2014). Histol. Histopathol. 29(6):707-719).
Immunohistochemistry Analysis: A representative lot detected strong N-cadherin immunoreactivity in parafn-embedded rectal cancer (RC) tissues with positive regional lymph node metastasis (RLNM) status, while only weak N-cadherin immunoreactivity was detected in RC with negative RLNM, and no N-cadherin staining was seen in normal colorectal epithelium (Fan, X.J., et al. (2012). Br. J. Cancer. 106(11):1735-1741).
Immunohistochemistry Analysis: A representative lot detected N-cadherin immunoreactivity in formalin-xed, parafn-embedded hepatocellular carcinoma (HCC) tissue sections. A signicant inverse correlation was found between RUNX3 and N-cadherin expression levels (Tanaka, S., et al. (2012). Int. J. Cancer. 131(11):2537-2546).
Western Blotting Analysis: A representative lot detected an upregulated N-cadherin expression in CCL185 carcinoma cells following transient Epstein-Barr virus (EBV) infection. The EMT-like phenotype remained even after viral loss by culture selection pressure withdrawal (Queen, K.J., et al. (2013). Int. J. Cancer. 132(9):2076-2086).
Western Blotting Analysis: A representative lot detected N-cadherin in Hep3B, Huh7, HLF and SK-Hep1 human hepatocellular carcinoma (HCC) cell lysates (Tanaka, S., et al. (2012). Int. J. Cancer. 131(11):2537-2546).
Western Blotting Analysis: A representative lot detected both the unprocessed (pro-) and processed (mature) forms of N-cadherin in HeLa cell lysate (Wahl, J.K. 3rd., et al. (2003). J. Biol. Chem. 278(19):17269-17276).
Western Blotting Analysis: A representative lot detected N-cadherin in WI-38 human fibroblast lysate, but not in JAr human placental choriocarcinoma cell lysate (Knudsen, K.A., et al. (1995). J. Cell Biol. 130(1):67-77).
Immunocytochemistry Analysis: A representative lot detected N-cadherin immunoreactivity localized primarily at the cell-cell borders by fluorescent immunocytochemistry staining of 1% paraformaldehyde-fixed, methanol-permeabilized HeLa cells (Wahl, J.K. 3rd., et al. (2003). J. Biol. Chem. 278(19):17269-17276).
Immunocytochemistry Analysis: A representative lot detected N-cadherin immunoreactivity colocalized with those of alpha- and beta-catenin by dual fluorescent immunocytochemistry staining of fixed WI-38 human fibroblasts (Knudsen, K.A., et al. (1995). J. Cell Biol. 130(1):67-77).
Immunoprecipitation Analysis: Representative lots co-immunoprecipitated alpha-catenin, beta-catenin, and plakoglobin with N-cadherin from WI-38 human fibroblast and HeLa cell lysates (Wahl, J.K. 3rd., et al. (2003). J. Biol. Chem. 278(19):17269-17276; Knudsen, K.A., et al. (1995). J. Cell Biol. 130(1):67-77).
Detect N-cadherin using this Anti-N-Cadherin Antibody, clone 13A9 validated for use in Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, and Western Blotting.
Research Sub Category
Adhesion (CAMs)
Quality
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:1000-5000 dilution of this hybridoma culture supernatant detected N-cadherin in HeLa cell lysate.
Target description
~140 kDa observed. Target band size appears larger than the calculated molecular weights of 82.03 kDa (mature) and 99.81/97.04 kDa (isoform 1/2 pro-form) due to posttranslational glycosylation and phosphorylation.LinkageReplaces: 04-1126
Physical form
Mouse monoclonal immunoglobulin hybridoma culture supernatant containing 0.05% sodium azide before the addition of glycerol to 30%.
Unpurified
Storage and Stability
Maintain for 2 years at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Analysis Note
Control
HeLa cell lysateLegal InformationUPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры
