Каталог
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
- загружается список...
Antibodies
- Сортировать:
- Вид таблицей
-
Anti-CDH23 antibody produced in rabbit
Human Protein Atlas Number: HPA017232 Human Protein Atlas characterization data
Кат. номер HPA017232-100UL HPA017232-25UL ImmunogenCadherin-23 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CDH23 (cadherin-related 23) encodes a cadherin protein, a component of the stereocilia tip links. It functions as a putative scaffold protein. Mutation in CDH23 causes an autosomal recessive disorder, Usher syndrome type I (USH1), characterized with congenital sensorineural hearing loss, vestibular dysfunction and visual impairment due to early onset retinitis pigmentosa.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71781,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:50-1:200 immunogen sequence YFVVDIVARDLAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLD conjugate unconjugated UniProt accession no. Q9H251, shipped in wet ice storage temp. 20°C Gene Information human ... CDH23(64072)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CEACAM5 (CD66e) Antibody, clone M5A
eCl@ss: 32160702
Кат. номер MABC1123-25UG MABC1123-100UG General descriptionCarcinoembryonic antigen-related cell adhesion molecule 5 (UniProt: P06731; also known as Carcinoembryonic antigen, CEA, Meconium antigen 100, CD66e) is encoded by the CEACAM5 (also known as CEA) gene (Gene ID: 1048) in human. CEA is a cell surface heavily glycosylated homodimeric glycoprotein that plays a role in cell adhesion and in intracellular signaling. CEA molecules can either be transmembrane or GPI-linked and are differentially expressed between species. CEA is restricted to the apical face of intestinal epithelial cells in the adult, but it has more diffuse distribution during embryonic development and in tumors. It functions as a calcium independent adhesion molecule through homophilic and heterophilic interactions with CEACAM-1. CEA participates in diverse physiological processes, including cell adhesion, differentiation, proliferation, and survival, as well as in carcinogenesis and bacterial pathogenesis. CEA molecules from neighboring cells can interact via their respective extracellular N-terminal IgV-like domain and mediate cell-cell adhesion through trans-oligomerization. CEA is synthesized with a signal peptide (aa 1-34) and a propeptide region (aa 686-702) that are cleaved to produce the mature form. It has seven Ig-like domains. Two isoforms of CEA have been reported that are produced by alternative splicing. Clone M5A is a humanized monoclonal antibody that displays high specificity and sub-nanomolar affinity for tumor-associated CEA. (Ref. Yazaki, PJ et al., (2004). Protein Eng. Des Sel. 17(5);481-489.
Specificity
Clone M5A is a humanized monoclonal antibody that detects human Carcinoembryonic antigen-related cell adhesion molecule 5 (CEA). Note: please use anti-human secondary antibody for detedtion.ImmunogenFull length purified human Carcinoembryonic antigen-related cell adhesion molecule 5 (CEA).ApplicationImmunohistochemistry Analysis: A representative lot detected CEACAM5 (CD66e) in Immunohistochemistry applications (Nittka, S., et. al. (2014). PLoS One. 9(9):e106921).
Radioimmunoassay Analysis: A representative lot detected CEACAM5 (CD66e) in Radioimmunoassay applications (Nittka, S., et. al. (2014). PLoS One. 9(9):e106921; Yazaki, P.J., et. al. (2004). Protein Eng Des Sel. 17(5):481-9; Yazaki, P.J., et. al. (2013). Protein Eng Des Sel. 26(3):187-93).
Research Category
Apoptosis & Cancer
Anti-CEACAM5 (CD66e), clone M5A, Cat. No. MABC1123, is a humanized monoclonal antibody that detects Carcinoembryonic antigen-related cell adhesion molecule 5 and has been tested for use in Flow Cytometry, Immunohistochemistry, and Radioimmunoassay.
Quality
Evaluated by Flow Cytometry in HT29 cells.
Flow Cytometry Analysis: 1 µg of this antibody detected CEACAM5 (CD66e) in one million HT29 cells.
Target description
76.80 kDa calculated.
Physical form
Format: Purified
Purified humanized monoclonal antibody in PBS with 0.05% sodium azide. This humanized antibody was produced by transfecting the cDNA into murine myeloma NSO host cells for stable expression.
Protein A purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone M5A, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) flow cytometry: suitable","immunohistochemistry: suitable","radioimmunoassay: suitable NCBI accession no. NP_001278413, UniProt accession no. P06731, Gene Information human ... CEACAM5(1048)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CEACAM7 antibody produced in rabbit
Human Protein Atlas Number: HPA069621 Human Protein Atlas characterization data
Кат. номер HPA069621-100UL HPA069621-25UL Immunogencarcinoembryonic antigen-related cell adhesion molecule 7ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88240,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence RVHANYRIIGYVKNISQENAPGPAHNGRET conjugate unconjugated UniProt accession no. Q14002, shipped in wet ice storage temp. 20°C Gene Information human ... CEACAM7(1087)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CELF4 Antibody, clone N446/80
eCl@ss: 32160702
Кат. номер MABN2418-25UL MABN2418-100UL General descriptionCUGBP Elav-like family member 4 (UniProt: Q9BZC1; also known as CELF-4, Bruno-like protein 4, CUG-BP- and ETR-3-like factor 4, RNA-binding protein BRUNOL-4) is encoded by the CELF4 (also known as BRUNOL4) gene (Gene ID: 56853) in human. CELF-4 is a RNA-binding protein that is implicated in the regulation of pre-mRNA alternative splicing. It is ubiquitous in its distribution, but is strongly expressed in the cerebellum, hippocampus, amygdala, temporal and frontal cortex, and frontal lobes. It mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. It is shown to specifically activate exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. CELF-4 is reported to promote exclusion of both the smooth muscle and non-muscle exons in actinin pre-mRNAs. It binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. The N-terminal region (aa 1-298) is considered to be sufficient for its RNA-binding and MSE-dependent splicing activity. CELF-4 contains contain two N-terminal RNA recognition motif (RRM) domains (aa 54-135 and 152-232) and one C-terminal RRM domain (aa 404-479). Five isoforms of CELF-4 have been described that are produced by alternative splicing.
Specificity
Clone N446/80 specifically detects CUGBP Elav-like family member 4 (CELF4). It targets an epitope with in 86 amino acids from the N-terminal region. It does not react with CELF6.ImmunogenA recombinant fragment corresponding to 86 amino acids from the N-terminal region of human CUGBP Elav-like family member 4 (CELF-4).
Epitope: N-terminusApplicationResearch Category
Neuroscience
Anti-CELF4, clone N446/80, Cat. No. MABN2418, is a highly specific mouse monoclonal antibody that targets CUGBP Elav-like family member 4 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in human hippocampus tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected CELF4 in human hippocampus tissue lysate.
Target description
~46 kDa observed; 51.97 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone N446/80, monoclonal species reactivity mouse, human, rat packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG2a NCBI accession no. NP_001020258.1, UniProt accession no. Q9BZC1, Gene Information human ... CELF4(56853) -
Anti-CEP135
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE1857-25UG ABE1857 General descriptionCentrosomal protein of 135 kDa (UniProt: Q66GS9; also known as Cep135, Centrosomal protein 4) is encoded by the CEP135 (also known as CEP4, KIAA0635) gene (Gene ID: 9662) in human. Cep135 is a centrosomal protein that is involved in centriole biogenesis. Human Cep135 is reported to contain two-stranded coiled-coil domains that are critical for microtubule binding. Cep135 acts as a scaffolding protein during early centriole biogenesis and is required for the targeting of centriole satellite proteins to centrosomes such as of PCM1, SSX2IP and CEP290 and recruitment of WRAP73 to centrioles. It also plays a role in centriole-centriole cohesion during interphase by acting as a platform protein for CEP250 at the centriole. Mutations in CEP135 gene are associated with autosomal recessive primary microcephaly-8, a disease characterized by intellectual disability, markedly reduced brain weight, and small cerebral cortex.
Specificity
This polyclonal antibody detects centrosomal protein of 135 kDa in human cells. It targets an epitope within 492 amino acids from the C-terminal half.ImmunogenHis-tagged recombinant fragment corresponding to 492 amino acids from the C-termnal region of human Cep135.ApplicationAnti-CEP135, Cat. No. ABE1857, is a highly specific rabbit polyclonal antibody that targets Centrosomal protein of 135 kDa and has been tested in Electron Microscopy, Immunocytochemistry, and Western Blotting.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CEP135 in synchronized U2OS cells.
Electron Microscopy Analysis: A representative lot detected CEP135 in Electron Microscopy applications (Kleylein-Sohn, J., et. al. (2007). Dev Cell. 13(2):190-202).
Immunocytochemistry Analysis: A representative lot detected CEP135 in Immunocytochemistry applications (Kleylein-Sohn, J., et. al. (2007). Dev Cell. 13(2):190-202; Guderian, G., et. al. (2010). J Cell Sci. 123(Pt 13):2163-9; Sonnen, K.F., et. al. (2012). Biol Open. 1(10):965-76).
Quality
Evaluated by Western Blotting in U2OS cell lysate.
Western Blotting Analysis: 0.5 µg/mL of this antibody detected CEP135 in 10 µg of U2OS cell lysate.
Target description
~150 kDa observed; 133.49 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form purified antibody antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µg application(s) electron microscopy: suitable","immunocytochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_079285, UniProt accession no. Q66GS9, shipped in ambient Gene Information human ... CEP135(9662)
Safety InformationFlash Point F does not flash Flash Point C does not flash -
Anti-CEP85 antibody produced in rabbit
Human Protein Atlas Number: HPA028252 Human Protein Atlas characterization data
Кат. номер HPA028252-100UL HPA028252-25UL ImmunogenCoiled-coil domain-containing protein 21 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76727,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 μL application(s) immunofluorescence: 0.25-2 μg/mL immunogen sequence SLLEETQAICREKEIQLESLRQREAEFSSAGHSLQDKQSVEETSGEGPEVEMESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQ conjugate unconjugated shipped in wet ice storage temp. −20°C Gene Information human ... CCDC21(64793)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CFDP1 Antibody, clone 15E5.1
eCl@ss: 32160702
Кат. номер MABN396 MABN396-25UL General descriptionCraniofacial development protein 1 (UniProt: Q9UEE9; also known as Bucentaur) is encoded by the CFDP1 (also known as BCNT, CENP-29) gene (Gene ID: 10428) in human. Craniofacial development protein 1 is an evolutionarily conserved member of the Bucentaur (BCNT) family of proteins and displays ubiquitous expression. It contains a BCNT domain of about 80 amino acids in the C-terminal region. Two isoforms of craniofacial development protein 1 are reported that are generated by alternative splicing. It is reported to play a role in embryogenesis and is considered as essential for chromatin/chromosome organization and function. A unique feature of this protein is that it lacks cysteine residues and has an acidic N-terminal region and a lysine/glutamic acid/proline-rich region of 40 amino acids. It also has seven serine phosphorylation sites and Ser250 in the BCNT region is shown to be heavily phosphorylated. (Ref.: Messina, G., et al. (2015). Chromosoma 124(2):153 162; Iwashita, S et al. (2015). Biosci Rep. 35(4): e00228).
Specificity
Clone 15E5.1 detects Craniofacial development protein 1 in human. It targets an epitope within the first 111 amino acids from the N-terminal half.ImmunogenGST-taged recombinant fragment corresponding to the first 111 amino acids from the N-terminal region.ApplicationResearch Category
Neuroscience
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CFDP1 in 10 µg of Jurkat cell lysate.
Anti-CFDP1, clone 15E5.1, Cat. No. MABN396, is a highly specific mouse monoclonal antibody that targets CFDP1 and has been tested for use in Western Blotting.
Quality
Evaluated by Western Blotting in HEK293 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected CFDP1 in 10 µg of HEK293 cell lysate.
Target description
~45 kDa observed; 33.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 15E5.1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) western blot: suitable isotype IgG1 NCBI accession no. NP_006315, UniProt accession no. Q9UEE9, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CFTR antibody produced in rabbit
MDL number: MFCD01321917 Human Protein Atlas Number: HPA021939 Human Protein Atlas characterization data
Кат. номер HPA021939-100UL HPA021939-25UL General descriptionCFTR (Cystic fibrosis transmembrane conductance regulator, ATP-binding cassette sub-family C, member 7) is a membrane-associated, N-linked glycoprotein.ImmunogenCystic fibrosis transmembrane conductance regulator recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CFTR (Cystic fibrosis transmembrane conductance regulator, ATP-binding cassette sub-family C, member 7) is mainly involved in the regulation of Na+ and Cl- transport by acting as a linear, cAMP activated, chloride channel. In addition, it is also associated with different transport signaling pathways. It has been reported that CFTR controls functionality of outwardly rectifying Cl- channels (ORCCs) by facilitating the transport and delivery of potent autacoid agonist and ORCC regulator ATP. It has also been suggested that CFTR can interact with Na+-reabsorptive pathway. CFTR is associated with congenital bilateral absence of the vas deferens (CBAVD) and causes the genital form of cystic fibrosis (CF). The CFTR gene may also responsible for male infertility.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86764,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: 1:1000- 1:2500 immunogen sequence INSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDL conjugate unconjugated UniProt accession no. P13569, shipped in wet ice storage temp. 20°C Gene Information human ... CFTR(1080)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Chikungunya virus Antibody, clone 3E7b
eCl@ss: 32160702
Кат. номер MABF2052-25UL MABF2052-100UL General descriptionChikungunya virus (CHIKV) that causes distinctive polyarthritis or polyarthralgia with clinical features such as fever, maculopapular rash, and myalgia is transmitted by Aedes spp of mosquitoes. Immune compromised individuals may face serious complications, including encephalitis and mortality. CHIKV genome contains a single-stranded positive-sense RNA that encodes four non-structural proteins known as nsP1, nsP2, nsP3, and nsP4 and also five structural proteins that include a capsid protein, three envelope glycoproteins known as (E1, E2, and E3, and a small molecule known as 6K. The mature alphavirus particles express E1 and E2 heterodimers that form 80 trimeric spikes on the surface of the virion. The ectodomain E1 protein consists of three domains known as D1, DII, and DIII. The DIII domain is an immunoglobulin-like domain connected to D1 and DII by a flexible linker. Both E1 and E2 proteins are responsible for virus entry into host cells. The E2 glycoprotein interacts with a cellular receptor, resulting in the virus internalization and the E1 glycoprotein mediates virus fusion to host cell under low pH conditions. Following the fusion of the viral envelope with the endosomal membrane, the viral genomic RNA is released into the cytoplasm and starts replicating. This monoclonal antibody (3E7b) can bind strongly to native CHIKV surface and potently neutralize virus replication (Ref.: Marsinoul, P., et al. (2014). Virology 464-465; 111-117; Lam, S., et al. (2015). mAbs 7(6), 1178-1194).
Specificity
Clone 3E7b detects Chikungunya virus in cells infected with this virus.ImmunogenChikungunya virusApplicationWestern Blotting Analysis: A representative lot detected Chikungunya virus in Western Blotting applications (Lam, S., et. al. (2015). MAbs. 7(6):1178-94).
Immunocytochemistry Analysis: A representative lot detected Chikungunya virus in Immunocytochemistry applications (Lam, S., et. al. (2015). MAbs. 7(6):1178-94).
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Chikungunya virus in BHK cells infected with Chikungunya virus. (Courtesy from an independent lab).
Neutralizing Analysis: A representative lot neutralized Chikungunya virus in Neutralizing applications (Lam, S., et. al. (2015). MAbs. 7(6):1178-94).
ELISA Analysis: A representative lot detected Chikungunya virus in ELISA applications (Lam, S., et. al. (2015). MAbs. 7(6):1178-94).
Anti-Chikungunya virus, clone 3E7b, Cat. No. MABF2052, is a mouse monoclonal antibody that detects E2 protein of Chikungunya virus and has been tested for use in ELISA, Immunocytochemistry, Neutralizing asssay, and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotype Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG1 .
Physical form
Format: Purified
Purified by ion-exchange chromatography
Purified mouse monoclonal antibody IgM in PBS without azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 3E7b, monoclonal species reactivity virus packaging antibody small pack of 25 μL application(s) ELISA: suitable, immunocytochemistry: suitable, neutralization: suitable, western blot: suitable isotype IgMκ -
Anti-Chikungunya virus Antibody, clone 6A11
eCl@ss: 32160702
Кат. номер MABF2051-25UG MABF2051-100UG General descriptionChikungunya virus (CHIKV) that causes distinctive polyarthritis or polyarthralgia with clinical features such as fever, maculopapular rash, and myalgia is transmitted by Aedes spp of mosquitoes. Immune compromised individuals may face serious complications, including encephalitis and mortality. CHIKV genome contains a single-stranded positive-sense RNA that encodes four non-structural proteins known as nsP1, nsP2, nsP3, and nsP4 and also five structural proteins that include a capsid protein, three envelope glycoproteins known as (E1, E2, and E3, and a small molecule known as 6K. The mature alphavirus particles express E1 and E2 heterodimers that form 80 trimeric spikes on the surface of the virion. The ectodomain E1 protein consists of three domains known as D1, DII, and DIII. The DIII domain is an immunoglobulin-like domain connected to D1 and DII by a flexible linker. Both E1 and E2 proteins are responsible for virus entry into host cells. The E2 glycoprotein interacts with a cellular receptor, resulting in the virus internalization and the E1 glycoprotein mediates virus fusion to host cell under low pH conditions. Following the fusion of the viral envelope with the endosomal membrane, the viral genomic RNA is released into the cytoplasm and starts replicating. (Ref.: Marsinoul, P., et al. (2014). Virology 464-465; 111-117; Lam, S., et al. (2015). mAbs 7(6), 1178-1194).
Specificity
Clone 6A11 specifically detects Chikungunya virus in infected cells.ImmunogenCH122508 strain of Chikungunya virus.ApplicationWestern Blotting Analysis: A 1:100 dilution from a representative lot detected Chikungunya virus in BHK cells infected with CHIKV (Courtesy of an outside independent laboratory).
Immunocytochemistry Analysis: A representative lot detected Chikungunya virus in BHK cells infected with CHIKV (Courtesy of an outside independent laboratory).
Anti-Chikungunya virus, clone 6A11, Cat. No. MABF2051 is a mouse monoclonal antibody that detects E1 protein of Chikungunya virus (CHIKV) and has been tested for use in Immunocytochemistry and Western Blotting.
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG2b .
Target description
~9.17 kDa calculated for E1 protein. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100, biological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 6A11, monoclonal species reactivity virus packaging antibody small pack of 25 μg application(s) immunocytochemistry: suitable, western blot: suitable isotype IgG2bκ
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Chitinase-1 (CHIT1)
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABF1168-100UL ABF1168-25UL General descriptionChitotriosidase-1 (UniProt: Q13231; also known as EC: 3.2.1.14, Chitinase-1) is encoded by the CHIT1 gene (Gene ID: 1118) in human. Chitinase-1 is a member of the Chitinase class II subfamily that degrades chitin, chitotriose and chitobiose. It is one of the most abundantly secreted protein and is mainly produced by activated macrophages and epithelial cells. Chitinase -1 can hydrolyze the beta-(1, 4)-linkage between the adjacent N-acetyl glucosamine residues of chitin. It may also participate in the defense against nematodes and other pathogens. Four isoforms of Chitinase-1 have been described that are produced by alternative splicing and isoform 3, which lacks amino acids 344-372, does not possess any enzymatic activity. Chitinase-1 is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved to generate the mature form. Its chitin-binding domain is located in amino acids 417-466 and has three chitooligosaccharide binding regions (aa 7-71; 97-100; and 210-213). Elevated levels of Chitinase-1 are observed in cases of Gauchers disease, bronchial asthma, and atherosclerosis. (Ref.: Kanneganti, M., et al. (2012). J. Epithel. Biol. Pharmacol. 5; 1-9).
Specificity
This rabbit polyclonal antibody detects Chitinase-1 in human serum. It targets an epitope within 15 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal region of human Chitinase-1.
Epitope: C-terminusApplicationImmunohistochemistry Analysis: A 1:250 dilution from a representative lot detected Chitinase-1 (CHIT1) in human spleen and bone marrow tissue sections.
Anti-Chitinase-1 (CHIT1), Cat. No. ABF1168, is a rabbit polyclonal that detects Chitinase-1 in human cells and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in human serum.
Western Blotting Analysis: A 1:500 dilution of this antibody detected Chitinase-1 in human serum.
Target description
~ 52 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Affinity Purified
Purified rabbit polyclonal antibody in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_003456.1, UniProt accession no. Q13231,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Chlamydial HSP60 Antibody, clone A57-B9
eCl@ss: 32160702
Кат. номер MABF2108-25UG MABF2108-100UG General descriptionChlamydia trachomatis is a Gram-negative bacterium that is responsible to sexually transmitted diseases leading to pelvic inflammatory disease, ectopic pregnancy, infertility, and outbreaks of trachoma-associated blindness and lymphogranuloma venereum (LGV). Chlamydia trachomatis consists of eighteen different serological variants (serovars) that include a few subvariants. These are identified based on serological reactivity of the epitopes on their outer membrane. Intracellularly chlamydia replicates within a vacuole. Chlamydia infection is initiated with the expression of a chlamydial early gene product(s), which isolate the inclusion from the endocytic-lysosomal pathway and makes it fusogenic with sphingomyelin-containing exocytic vesicles. This change in vesicular interaction allows the delivery of the vacuole to the peri-Golgi region of the host cell. Antigens from all members of the Chlamydia genus display heat resistance and sensitivity to oxidation by sodium periodate. Clone A57-B9 detects Chlamydial HSP60 (GroEL). It reacts with the short peptide of 6 amino acids from the carboxyl terminal region of HSP60. HSP60 facilitates the correct folding of imported proteins and may prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions.
Specificity
Clone A57-B9 detects Chlamydial HSP60. It targets an epitope with in 144 amino acids in the carboxy terminal of HSP60.ImmunogenRecombinant Chlamydia trachomatis serovar A HSP60 emulsified in complete Freund adjuvant.ApplicationAnti-Chlamydial HSP60, clone A57-B9, Cat. No. MABF2108, is a mouse monoclonal antibody that detects Chlamydial HSP60 and has been tested for use in ELISA, Immunofluorescence, Immunocytochemistry, and Western Blotting.
Immunocytochemistry Analysis: A representative lot detected Chlamydial HSP60 in Immunocytochemistry applications (Yuan, Y., et. al. (1992). Infect Immun. 60(6):2288-96).
Immunofluorescence Analysis: A representative lot detected Chlamydial HSP60 in Immunofluorescence applications (Southern, T., et. al. (2012). Clin Vaccine Immunol. 19(11):1864-9).
ELISA Analysis: A representative lot detected Chlamydial HSP60 in ELISA applications (Morrison, S.G., et. al. (2005). J Immunol. 175(11):7536-42).
Western Blotting Analysis: A representative lot detected chlamydial HSP60 in Western Blotting applications (Hechard, C., et. al. (2004). J Med Microbiol. 53(Pt 9):861-8; LaVerda, D., et. al. (1997). J Clin Microbiol. 35(5):1209-15; Southern, T., et. al. (2012). Clin Vaccine Immunol. 19(11):1864-9; Yuan, Y., et. al. (1992). Infect Immun. 60(6):2288-96).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in lysates from HeLa cells infected with chlamydia trachomatis serovar L2 (LGV 434 L2) .
Western Blotting Analysis: 2 µg/mL of this antibody detected Chlamydial HSP60 in lysates from HeLa cells infected with Chlamydia trachomatis serovar L2 (LGV 434 L2) .
Target description
~60 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone A57-B9, monoclonal species reactivity Chlamydia, bacteria packaging antibody small pack of 25 µg application(s) ELISA: suitable, immunocytochemistry: suitable, immunofluorescence: suitable, western blot: suitable isotype IgG1 -
Anti-Chlamydial LPS Antibody, clone EVI-H1
eCl@ss: 32160702
Кат. номер MABF2107-25UG MABF2107-100UG General descriptionChlamydia trachomatis is a Gram-negative bacterium that is responsible to sexually transmitted diseases leading to pelvic inflammatory disease, ectopic pregnancy, infertility, and outbreaks of trachoma-associated blindness and lymphogranuloma venereum (LGV). Chlamydia trachomatis consists of eighteen different serological variants (serovars) that include a few subvariants. These are identified based on serological reactivity of the epitopes on their outer membrane. Intracellularly chlamydia replicates within a vacuole. Chlamydia infection is initiated with the expression of a chlamydial early gene product(s), which isolate the inclusion from the endocytic-lysosomal pathway and makes it fusogenic with sphingomyelin-containing exocytic vesicles. This change in vesicular interaction allows the delivery of the vacuole to the peri-Golgi region of the host cell. Antigens from all members of the Chlamydia genus display heat resistance and sensitivity to oxidation by sodium periodate. Lipopolysaccharides (LPS) of Chlamydia consists of at least three antigen domains, two of which are shared by the LPS of certain other gram-negative organisms and one that is unique only to chlamydial LPS. It has been reported that the quantitative yields of chlamydial LPS can be achieved when elementary bodies (EBs) are first reduced and alkylated prior to extraction with hot phenol-water. (Ref.: Caldwell, HD., and Hitchcock, PJ. (1984). Infect. Immun. (44(2); 306-314; Scidmore, MA., et al. (1996). Infect. Immun. 64(12); 5366-5372; Turingan, RS et al. (2017). PLoS ONE 12(5): e0178653).
Specificity
Clone EVH-H1 detects lipopolysaccharide from Chlamydia genus.ImmunogenFormalin-killed elementary bodies of the Chlamydia trachomatis L2 serovar.ApplicationImmunofluorescence Analysis: A representative lot detected Chlamydial LPS in Immunofluorescence applications (Su, H., et. al. (2000). Infect Immun. 68(1):192-6; Wolf, K., et. al. (2001). Infect Immun. 69(5):3082-91).
Immunocytochemistry Analysis: A representative lot detected Chlamydial LPS in Immunocytochemistry applications (Wolf, K., et. al. (2001). Infect Immun. 69(5):3082-91).
Electron Microscopy Analysis: A representative lot detected Chlamydial LPS with Trasnsmission Electron Microscopy applications (Wolf, K., et. al. (2001). Infect Immun. 69(5):3082-91).
Anti-Chlamydial LPS, clone EVI-H1, Cat. No. MABF2107, is a mouse monoclonal antibody that detects Chlamydial lipopolysaccharide (LPS) and has been tested for use in Electron Microscopy, Immunocytochemistry, Immunofluorescence, and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in HeLa cells infected with chlamydia trachomatis serovar L2 (LGV 434 L2).
Western Blotting Analysis: 2 µg/mL of this antibody detected Chlamydial LPS in HeLa cells infected with chlamydia trachomatis serovar L2 (LGV 434 L2).
Target description
~15 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified antibody antibody product type primary antibodies clone EVI-H1, monoclonal species reactivity bacteria packaging antibody small pack of 25 μg application(s) electron microscopy: suitable, immunocytochemistry: suitable, immunofluorescence: suitable, western blot: suitable isotype IgG2a
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Chlamydial MOMP Antibody, clone B-D3
eCl@ss: 32160702
Кат. номер MABF2129-25UG MABF2129-100UG General descriptionChlamydia trachomatis is a Gram-negative bacterium that is responsible to sexually transmitted diseases leading to pelvic inflammatory disease, ectopic pregnancy, infertility, and outbreaks of trachoma-associated blindness and lymphogranuloma venereum (LGV). Chlamydia trachomatis consists of eighteen different serological variants (serovars) that include a few subvariants. These are identified based on serological reactivity of the epitopes on their outer membrane. Intracellularly chlamydia replicates within a vacuole. Chlamydia infection is initiated with the expression of a chlamydial early gene product(s), which isolate the inclusion from the endocytic-lysosomal pathway and makes it fusogenic with sphingomyelin-containing exocytic vesicles. This change in vesicular interaction allows the delivery of the vacuole to the peri-Golgi region of the host cell. Antigens from all members of the Chlamydia genus display heat resistance and sensitivity to oxidation by sodium periodate. Clone B-D3 specifically detects surface exposed epitopes on major outer membrane protein (MOMP) from Chlamydia genus. It displays strong reactivity with Chlamydial serovars B, Ba, D, E, and L2 and weak reactivity with L1. MOMP, a cysteine-rich molecule, plays a vital role in maintaining the structural and functional properties of the chlamydial outer membrane. It contains determinants that confer type, subspecies, and species antigenic properties to the protein. It displays high sensitivity to heat and trypsin treatment that destroys MOMP epitopes recognized by this clone. (Ref.: Zhang, YX et al., (1987). J. Immunol. 138(2); 575-581).
Specificity
Clone B-3D detects Chlamydial major outer membrane protein. It displays reactivity to serovars B, Ba, D, E, and L2 and weak reactivity with L1.ImmunogenFormalin killed Chlamydia trachornatis serovar L2 (LGV 434).ApplicationNeutralizing Analysis: A representative lot neutralized Chlamydia and prevented toxicity in murine model (Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Immunoprecipitation Analysis: A representative lot immunoprecipitated Chlamydial MOMP in Immunoprecipitation applications (Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Immunocytochemistry Analysis: A 1:800 dilution from a representative lot detected Chlamydial MOMP in McCoy cells infected with LGV serovar L2 inclusions (Courtesy of Chunfu Yang, Ph.D. and Harlan D. Caldwell, Ph.D., National Institutes of Health, Bethesda, MD USA).
Immunofluorescence Analysis: A representative lot detected Chlamydial MOMP in Immunofluorescence applications (Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Dot Blot Analysis: A representative lot detected Chlamydial MOMP in Dot Blot applications (Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Anti-chlamydial MOMP, clone B-D3, Cat. No. MABF2129, is a mouse monoclonal antibody that detects Chlamydial major outer membrane protein (MOMP) and has been tested for use in Dot Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, and Neutralizing applications.
Research Category
Inflammation & Immunology
Quality
Isotype testing: Identity Confirmation by Isotyping Test.
Isotyping Analysis: The identity of this monoclonal antibody is confirmed by isotyping test to be mouse IgG2b.
Target description
~43 kDa observed.
Physical form
Purified mouse monoclonal antibody IgG2b in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone B-D3, monoclonal species reactivity bacteria, Chlamydia packaging antibody small pack of 25 µg application(s) dot blot: suitable, immunocytochemistry: suitable, immunofluorescence: suitable, immunoprecipitation (IP): suitable, neutralization: suitable isotype IgG2b
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Chlamydial MOMP Antibody, clone L21-10
eCl@ss: 32160702
Кат. номер MABF2166-25UG MABF2166-100UG General descriptionChlamydia trachomatis is a Gram-negative bacterium that is responsible for sexually transmitted diseases leading to pelvic inflammatory disease, ectopic pregnancy, infertility, and outbreaks of trachoma-associated blindness and lymphogranuloma venereum (LGV). Chlamydia trachomatis consists of eighteen different serological variants (serovars) that include a few subvariants. These are identified based on serological reactivity of the epitopes on their outer membrane. Intracellularly chlamydia replicates within a vacuole. Chlamydia infection is initiated with the expression of a chlamydial early gene product(s), which isolate the inclusion from the endocytic-lysosomal pathway and makes it fusogenic with sphingomyelin-containing exocytic vesicles. This change in vesicular interaction allows the delivery of the vacuole to the peri-Golgi region of the host cell. Antigens from all members of the Chlamydia genus display heat resistance and sensitivity to oxidation by sodium periodate. Clone L21-10 specifically detects major outer membrane protein (MOMP) from Chlamydia genus. It displays strong reactivity with Chlamydial serovars D and L3 and weak reactivity with Ba, E, G, L1, and L2. MOMP, a cysteine-rich molecule, plays a vital role in maintaining the structural and functional properties of the chlamydial outer membrane. It contains determinants that confer type, subspecies, and species antigenic properties to the protein. (Ref.: Zhang, YX et al., (1987). J. Immunol. 138(2); 575-581).
Specificity
Clone L21-10 specifically detects outer membrane protein from Chlamydia genus. It displays strong reactivity with serovars D and L3 and weak reactivity with Ba, E, G, L1, and L2.ImmunogenFormalin killed Chlamydia trachomatis (L2/LGV-434).ApplicationImmunoprecipitation Analysis: A representative lot immunoprecipiated Chlamydial MOMP in Immunoprecipitation applications (Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Immunofluorescence Analysis: A representative lot detected Chlamydial MOMP in Immunofluorescence applications (Weber, M.M., et. al. (2017). Cell Rep. 19(7):1406-1417; Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Western Blotting Analysis: A representative lot detected Chlamydial MOMP in Western Blotting applications (Baehr, W., et. al. (1988). Proc Natl Acad Sci USA. 85(11):4000-4; Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Dot Blot Analysis: A representative lot detected Chlamydial MOMP in Dot Blot applications (Zhang, Y.X., et. al. (1987). J Immunol. 138(2):575-81).
Anti-Chlamydial MOMP, clone L21-10, Cat. No. MABF2166, is a mouse monoclonal antibody that detects Chlamydial major outer membrane protein (MOMP) and has been tested for use in Dot Blot, Immunofluorescence, Immunoprecipitation, and Western Blotting.
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in lysates from HeLa cells infected with Chlamydia trachomatis serovar L2 (LGV 434 L2) .
Western Blotting Analysis: 2 µg/mL of this antibody detected chlamydial Chlamydial MOMP in lysates from HeLa cells infected with Chlamydia trachomatis serovar L2 (LGV 434 L2) .
Target description
~43 kDa observed. Uncharacterized bands may be observed in some lysate(s).
Physical form
Format: Purified
Purified mouse monoclonal antibody IgG2a in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone L21-10, monoclonal species reactivity Chlamydia, bacteria packaging antibody small pack of 25 µg application(s) dot blot: suitable, immunofluorescence: suitable, immunoprecipitation (IP): suitable, western blot: suitable isotype IgG2a -
Anti-CHMP3
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS1668 ABS1668-25UL General descriptionCharged multivesicular body protein 3 (UniProt: Q9Y3E7; also known as Chromatin-modifying protein 3, CHMP3, Neuroendocrine differentiation factor, Vacuolar protein sorting-associated protein 24, hVps24) is encoded by the CHMP3 (also known as CGI149, NEDF, VPS24, CGI-149) gene (Gene ID: 51652) in human. CHMP3 is a component of the endosomal sorting required for transport complex III (ESCRT-III), which is involved in multi-vesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. It is widely expressed and its expression is reported in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. The acidic C-terminus and the basic N-terminus of CHMP3 are thought to render the protein in a closed, soluble and inactive conformation through an auto-inhibitory intramolecular interaction. The open and active conformation, which enables membrane binding and oligomerization, is achieved by interaction with other cellular binding partners, probably including other ESCRT components. CHMP3 is shown to heteromerize with CHMP2A to form helical tubular structures that expose membrane-interacting sites on the outside. It can also interact with CHMP4A, however, the interaction requires the release of CHMP4A auto-inhibition.
Specificity
This rabbit polyclonal antibody detects Charged multivesicular body protein 3 in human cells.ImmunogenA full-length human recombinant charged multivesicular body protein 3 (CHMP3).
Epitope: unknownApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected human recombinant charged multivesicular body protein 3 (CHMP3).
Western Blotting Analysis: A representative lot detected CHMP3 in Western Blotting applications (Morita, E., et. al. (2010). Proc Natl Acad Sci USA. 107(29):12889-94).
Research Category
Signaling
Anti-CHMP3, Cat. No. ABS1668, is a rabbit polyclonal antibody that detects Charged multivesicular body protein 3 and has been tested for use in Immunocytochemistry and Western Blotting.
Quality
Evaluated by Immunocytochemistry in HeLa cells.
Immunocytochemistry Analysis: A 1:100 dilution of this antibody detected CHMP3 in HeLa cells.
Target description
~32 kDa observed; 25.07 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Unpurified
Rabbit polyclonal antiserum with 0.05% sodium azide.
Storage and Stability
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form serum antibody product type primary antibodies clone polyclonal species reactivity human packaging antibody small pack of 25 µL application(s) immunocytochemistry: suitable","western blot: suitable isotype IgG NCBI accession no. NP_057163, UniProt accession no. Q9Y3E7,
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Cholecystokinin (26-33) (CCK-8) antibody produced in rabbit
MDL number: MFCD00162230 NACRES: NA.41
Кат. номер C2581-.2ML C2581-25UL C2581-.5ML General descriptionCholecystokinin (CCK) is a neuropeptide hormone and neurotransmitter widely distributed throughout the gastrointestinal (GI) tract and the central nervous system (CNS). CCK, gastrin, secretin and vasoactive intestinal peptide (VIP) belong to the gastrin/cholcystokinin family. hormone family. CCK has a biologically active C-terminal pentapeptide. CCK exists as a larger precursor hormone, preproCCK (114 amino acids), from which several smaller fragments are derived, sharing a C-terminal tetrapeptide and a sulfated tyrosine residue. Sulfated CCK (26-33) amide (CCK-8) is the major and the most potent CCK form in the brain and periphery. CCK is widely distributed in several brain regions, including the cerebral cortex, hippocampus, amygdala nuclei, and the hypothalamus. In the periphery, CCK is localized mainly in nerve fibers in the myenteric and submucosal ganglia, as well as in endocrine cells of the gastrointestinal tract.
Cholecystokinin (CCK) belongs to gastrointestinal hormone family is a neuropeptide hormone and neurotransmitter usually present in gastrointestinal (GI) tract and the central nervous system (CNS). CCK functions include enzyme secretion from pancreas, gall bladder contraction, intestinal motility; CCK will also inhibit gastrin induced acid secretion . Anti-cholecystokinin (26-33) (CCK-8) antibody can be used in radioimmunoassay to determine plasma CCK. This product is also useful for the study of mode of action, differential tissue expression and intracellular and subcellular localization of CCK in CNS and in neuroendocrine cells of digestive system. Anti-CCK-8 reacts specifically with sulfated CCK-8 and shows cross reactivity with unsulfated CCK-8 and caerulein.ImmunogenSynthetic sulfated CCK-8 conjugated to KLH.ApplicationAnti-Cholecystokinin (26-33) (CCK-8) has been used in- immunohistochemistry
- double-label immunofluorescence staining
- immunocytochemistry
- dot-blot immunoassay
Anti-cholecystokinin (26-33) (CCK-8) antibody can be used to detect CCK peptide in pancreatic cancer cells by immunocytochemistry. It may also be used for dot blot immunoassay.
Biochem/physiol Actions
Cholecystokinin (CCK) stimulates enzyme secretion from the pancreas, gall bladder contraction, and intestinal motility and it inhibits gastrin-induced acid secretion. CCK may be involved in several physiological and behavioral functions such as satiety, anxiety, memory processes, and analgesia and in disorders such as panic disorder. In the central nervous system (CNS), CCK acts as a neurotransmitter and modulates the action of other neurotransmitters such as dopamine, 5-hydroxytryptamine (5-HT), γ-Aminobutyric acid (GABA) and excitatory amino acids. The multiple biological actions of CCK are mediated by two classes of receptors, the peripheral/brain CCK-A receptors and the brain CCK-B receptors.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form whole antiserum antibody product type primary antibodies clone polyclonal contains 15 mM sodium azide species reactivity human packaging antibody small pack of 25 µL application(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:8,000 using indirect immunoperoxidase staining of human stomach","radioimmunoassay: 1:10,000 using CCK-8, sulfated as standard conjugate unconjugated UniProt accession no. P06307, shipped in dry ice storage temp. 20°C Gene Information human ... CCK(885)
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable -
Anti-Cholera toxin, B Subunit (CTxB) antibody, Mouse monoclonal
Кат. номер SAB4200844-25UL SAB4200844-100UL General descriptionCholera toxin (CTx) also known as choleragen, is an enterotoxin produced by the Gram-negative bacterium Vibrio cholerae that naturally habitat in fresh or saltwater environments. Most of the V. cholerae species do not cause any disease in human, but few including serotypes O1 and O139 can cause cholera pandemic. These cases were described already in the 19th century.1 The V. cholerae virulence factors CtxA and CtxB are located at the CTX phage genome integrated within the bacterial chromosome. Since species virulence may change due to mutations and acquisition of virulence genes, the cholera pandemic has a major public health risk with potential for large numbers of cases and even deaths.1-3
Specificity
Monoclonal Anti-Cholera Toxin-peroxidase antibody specifically recognizes Cholera Toxin and has no cross reactivity with Staphylococcal Enterotoxin A (SEA), Staphylococcal Enterotoxin B (SEB), Pseudomonas Exotoxin A or Staphylococcal Alpha-Toxin (-Hemolysin).Immunogenrecombinant Cholera toxin beta (C-terminal His-tag) protein.ApplicationThe antibody may be used in various immunochemical techniques including Immunoblotting, Immunofluorescence and ELISA. Detection of the CTxB band by Immunoblotting is specifically inhibited by the immunogen.
Biochem/physiol Actions
CTx is composed of two subunits, the toxic CTxA (~27 kDa) and non-toxic CTxB (~12 kDa) assembled with the stoichiometry AB5.4 The B-subunit specifically binds to monosialogangliosides GM1 receptors, located in the membrane of intestinal epithelial cells.5 The A1 fragment of the A-subunit is translocated through the membrane of the host cell, where it catalyses the ADP-ribosylation of the Gsa regulatory component of the adenylate cyclase complex. The resulting increased level of cyclic AMP promotes a wide variety of actions, including the secretion of chloride ions in the case of intestinal epithelial cells.6-7 Antibodies specific for cholera toxin may be used in studies of structural and functional aspects of toxin-membrane interactions and for the detection of CTxB when used for example as an adjuvant when injected mucosally together with the desired antigen.8-10
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыantibody form purified from hybridoma cell culture antibody product type primary antibodies clone CTxB-24, monoclonal description Research area: Microbiome species reactivity Vibrio cholerae packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 1-2 µg/mL using His-tagged recombinant Cholera Toxin B subunit isotype IgG1 UniProt accession no. P01556, shipped in dry ice storage temp. 20°C Gene Information Vibrio cholerae ... VC1456(2613962)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Chondroitin Sulfate antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200696-100UL SAB4200696-25UL General descriptionMonoclonal anti-chondroitin sulfate antibody, (mouse IgM isotype) is derived from the hybridoma CS56 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with Ventral membranes of chicken gizzard fibroblasts. This antibody recognizes chondroitin sulfate containing proteoglycans (CSPG) in bovine mammary gland epithelial (BMGE) cells and also in human, chicken and mouse fibroblasts or tissues.
Chondroitin sulfate proteoglycan 4 (CSPG4) or nerve/glial antigen 2 (NG2) is encoded by the gene mapped to human chromosome 15q24.2-15q24.3. It is a growth-inhibitory chondroitin sulfate proteoglycan (CSPG) produced after spinal cord injury. It has a single glycosaminoglycan (GAG) chain. The protein belongs to the transmembrane chondroitin sulfate proteoglycans family.ImmunogenVentral membranes of chicken gizzard fibroblasts
Biochem/physiol Actions
Chondroitin sulfate proteoglycan 4 (CSPG4) or nerve/glial antigen 2 (NG2) stimulates the activation of integrins in dorsal root ganglion neurons. It also has a role in stimulating inflammatory cytokine expression in microglia. CSPG4 plays a vital role in brain repair. Overexpression of the gene leads to developmental delay in patients with trisomy of 15q24-qter. CSPG4 serves as a potential prognostic biomarker and therapeutic target in malignant cancer.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
for continuous use, store at 2–8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation. Working dilution samples should be discarded if not used within 12 hours.Other NotesIn order to obtain best results in different techniques and preparations we recommend determining optimal working concentration by titration test.Legal InformationExtrAvidin is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse antibody form purified from hybridoma cell culture, purified immunoglobulin antibody product type primary antibodies clone CS-56, monoclonal form buffered aqueous solution species reactivity chicken, human, bovine, mouse packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunofluorescence: 2.5-5 µg/mL using bovine BMGE cells, immunohistochemistry: 2.5-5 µg/mL using heat-retrieved formalin-fixed, paraffin-embedded human colon cancer sections and Biotin/ExtrAvidin ®-Peroxidase staining system. isotype IgM shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 -
Anti-CHRNA2 Antibody, clone 5B2.1
eCl@ss: 32160702
Кат. номер MABN2249-25UG MABN2249-100UG General descriptionNeuronal acetylcholine receptor subunit alpha-2 (UniProt: Q15822; also known as Cholinergic Receptor Nicotinic Alpha 2 Subunit, Acetylcholine Nicotinic Receptor Alpha 2) is encoded by the CHRNA2 gene (Gene ID: 1135) in human. Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels formed by a pentameric arrangement of alpha and beta subunits to create distinct muscle and neuronal receptors. In neuronal AChR alpha-2 subunit can be combined to beta-2 or beta-4 to give rise to functional receptors. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Cholinergic Receptor Nicotinic Alpha 2 Subunit is a multi-pass membrane protein that is produced with a signal peptide (aa 1-26), which is subsequently cleaved off. It has an extracellular domain (aa 27-264), a cytoplasmic domain (aa 353-502), and four helical transmembrane domains (aa 265-289; 297-315; 331-352; 503-521). Mutations in CHRNA2 gene are known to cause epilepsy characterized by nocturnal seizures associated with fear sensation, tongue movements, and nocturnal wandering.
Specificity
Clone 5B2.1 detects human Neuronal acetylcholine receptor subunit alpha-2 (CHRNA2). It targets an epitope within 52 amino acids from the N-terminal region extracellular domain.ImmunogenGST/His-tagged recombinant fragment corresponding to 52 amino acids from the N-terminal region of human Neuronal acetylcholine receptor subunit alpha-2 (CHRNA2).
Epitope: extracellular domainApplicationImmunohistochemistry Analysis: A 1:50 dilution from a representative lot detected CHRNA2 in human pancreas, tonsil, and skeletal muscle tissue sections.
Research Category
Neuroscience
Anti-CHRNA2, clone 5B2.1 Antibody, Cat. No. MABN2249, is a highly specific mouse monoclonal antibody that targets Neuronal acetylcholine receptor subunit alpha-2 (CHRNA2) and has been tested for use in Immunohistochemistry (Paraffin) and Western Blotting.
Quality
Evaluated by Western Blotting in CHRNA2 recombinant protein lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected human recombinant Neuronal acetylcholine receptor subunit alpha-2 (CHRNA2).
Target description
59.77 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone 5B2.1, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable isotype IgG1 NCBI accession no. NP_000733, UniProt accession no. Q15822, -
Anti-Claudin-5 Antibody
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABT45-25UG ABT45 General descriptionClaudin-5, a transmembrane protein deleted in velo-cardio-facial syndrome (TMVCF), seems to be involved in endothelial tight junctions. Claudin-5 has been exclusively found in the cell-cell borders of endothelial cells. Lower claudin-5 levels in sinusoidal endothelial cells could lead to their dysfunction during liver injuries. Levels of claudin-5 in tumor vessels could be a potential marker for hepatocellular carcinoma prognosis. The loss of claudin-5 function has been linked to carcinogenesis.
Specificity
This antibody recognizes Claudin-5 at the cytoplasmic domain.ImmunogenEpitope: Cytoplasmic Domain
KLH-conjugated linear peptide corresponding to human Claudin-5 at the cytoplasmic domain.ApplicationResearch Category
Cell Structure
Anti-Claudin-5 Antibody detects level of Claudin-5 & has been published & validated for use in WB, IH(P).
Research Sub Category
Adhesion (CAMs)
Immunohistochemistry Analysis: A 1:800 dilution from a representative lot detected Clausin-5 in prostate tissue.
Quality
Evaluated by Western Blot in human lung tissue lysate.
Western Blot Analysis: 0.1 µg/mL of this antibody detected Claudin-5 in 10 µg of human lung tissue lysate.
Target description
~17 kDa observed.
Molecular weights at ~17 kDa and 62 kDa may be observed depending on phosphorylation and glycosylation effects (Ishizaki, T., et al. (2003). Experimental Cell Research. 290:275–288).
Physical form
Purified rabbit polyclonal in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Affinity purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.
Analysis Note
Control
Human lung tissue lysateOther NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity mouse, rat, horse, human species reactivity (predicted by homology) equine (based on 100% sequence homology), ox (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin)","western blot: suitable NCBI accession no. NP_003268, UniProt accession no. O00501, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CLEC18A Antibody, clone 3A9E6
Кат. номер MABS2260-25UL MABS2260-100UL General descriptionC-type lectin domain family 18 member A (UniProt: A5D8T8; also known as Mannose receptor-like protein 2, CLEC18A) is encoded by the (also known as MRLP2) gene (Gene ID: 348174) in human. CLEC18A is synthesized with a signal peptide (aa 1-26), which is subsequently cleaved off to generate the mature form (aa 27-446). Its expression is observed in all cells and in peripheral blood cells. It is mainly localized in the endoplasmic reticulum, Golgi apparatus, and endosome. Although it is expressed in normal hepatocytes, it is absent in hepatocellular carcinoma. It binds polysaccharides in a Ca2+-independent manner and shows preferential binding to fucoidal, b-glucans and galactans. It also serves as a co-receptor for TLR3 and contributes to the differential immune responses to poly(I:C) and H5N1 influenza A virus infection. Its levels are shown to be up-regulated upon differentiation of monocytes into macrophages and dendritic cells. Significantly higher levels of CLEC18A are observed subjects with hepatitis C infection and this increased level is associated with increased cryoglobulin levels, which may be related to the occurrence of mixed cryobulinemia (MC) syndrome. (Ref.: Huang, YL., et al. (2021). Nat. Commun. 4;229; Liao, TL., et al. (2018). Sci. Rep. 8; Article 17287; Huang, YL., et al. (2015). J. Biol. Chem. 290(35); 21252-21263).
Specificity
Clone 3A9E6 is a mouse monoclonal antibody that detects human C-type lectin domain family 18 member A (CLEC18A).ImmunogenPurified recombinant human C-type lectin domain family 18 member A (CLEC18A) Fc fusion protein.ApplicationAnti-CLEC18A, clone 3A9E6, Cat. No. MABS2260, is a mouse monoclonal antibody that detects C-type lectin domain family 18 member A (CLEC18A) and is tested in ELISA, Flow Cytometry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in U937 cell lysate.
Western Blotting Analysis: A 1:500 dilution of this antibody detected CLEC18A in U937 cell lysate.
Tested Applications
Immunohistochemistry (Paraffin) Analysis: A representative lot detected CLEC18A in Immunohistochemistry applications (Huang, Y.L., et al. (2015). J Biol Chem. 290(35):21252-63).
ELISA Analysis: A representative lot detected CLEC18A in ELISA applications (Liao T.L. et al. (2018). Sci Rep. 8(1):17287).
Western Blotting Analysis: A representative lot detected CLEC18A in Western Blotting applications (Huang, Y.L., et al. (2015). J Biol Chem. 290(35):21252-63; Huang, Y.L, et al. (2021). Commun Biol. 4(1):229).
Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected CLEC18A in human kidney tissue sections.
Flow Cytometry Analysis: A representative lot detected CLEC18A in Immunohistochemistry applications (Huang, Y.L., et al. (2015). J Biol Chem. 290(35):21252-63; Liao T.L. et al. (2018). Sci Rep. 8(1):17287).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Storage and Stability
Recommend storage at +2°C to +8°C. For long term storage antibodies can be kept at -20°C. Avoid repeated freeze-thaws.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified antibody antibody product type primary antibodies clone 3A9E6, monoclonal mol wt calculated mol wt 49.6 kDa","observed mol wt ~54 kDa purified by using protein G species reactivity human packaging antibody small pack of 100 µL application(s) ELISA: suitable","flow cytometry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG1 epitope sequence Unknown conjugate unconjugated Protein ID accession no. NP_001129686, UniProt accession no. A5D8T8, shipped in 2-8°C Gene Information human ... CLEC18A(348174)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CLN6 Antibody, clone N400/24
eCl@ss: 32160702
Кат. номер MABN2548-25UG MABN2548-100UG General descriptionCeroid-lipofuscinosis neuronal protein 6 (UniProt: Q9NWW5; also known as CLN6) is encoded by the CLN6 gene (Gene ID: 54982) in human. CLN6 is a multi-pass membrane protein that is localized to endoplasmic reticulum and contributes to lysosomal function and viability of neurons. It has no homology with known proteins or functional domains, however it is highly conserved across mammalian species. Mutations in CLN6 gene have been linked to ceroid lipofuscinosis, neuronal 6 and 4A that are characterized by intracellular accumulation of autofluorescent liposomal material, seizures, dementia, visual loss, and/or cerebral atrophy. Two isoforms of CLN6 have been described that are produced by alternative splicing.
Specificity
Clone N400/24 specifically detects human Ceroid-lipofuscinosis neuronal protein 6. It does not cross-react with other CLN proteins.ImmunogenRecombinant fragments corresponding to 54, 47, and 30 amino acids from non-helical regions from the N-terminal, internal, and C-terminal regions of human Ceroid-lipofuscinosis neuronal protein 6 (CLN6).ApplicationResearch Category
Neuroscience
Anti-CLN6, clone N400/24, Cat. No. MABN2548, is a highly specific mouse monoclonal antibody that targets CLN6 and has been tested for use in Immunohistochemistry (Paraffin).
Quality
Evaluated by Immunohistochemistry (Paraffin) in human stomach tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:50 dilution of this antibody detected CLN6 in human stomach tissue sections.
Target description
35.92 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG2b in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone N400/24, monoclonal species reactivity human packaging antibody small pack of 25 µg application(s) immunohistochemistry: suitable (paraffin) isotype IgG2b NCBI accession no. NP_060352.1, UniProt accession no. Q9NWW5, -
Anti-CLOCK
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABE2598 ABE2598-25UL General descriptionCircadian locomoter output cycles protein kaput (UniProt: O08785; also known as mCLOCK; EC: 2.3.1.48) is encoded by the Clock gene (Gene ID: 12753) in murine species. CLOCK acts as a transcriptional activator that forms a core component of the circadian clock. CLOCK contains 2 PAS domains (aa 107-177 Pas1 domain; aa 262-332 Pas2 domain) and has a nuclear localization signaling sequence (aa 32-47). The major components of circadian clock include CRY proteins, CLOCK or NPAS2, ARNTL/BMAL1 or ARNTL2/BMAL2, CSNK1D and/or CSNK1E, TIMELESS and the PER proteins. Transcription and translation of core clock components play a critical role in rhythm generation, whereas delays imposed by post-translational modifications are important for determining the period (tau) of the rhythms. CLOCK forms a heterodimer with ARNTL/BMAL1 and this heterodimer is required for E-box-dependent transactivation and for CLOCK nuclear translocation and degradation. It is also essential for phosphorylation of both CLOCK and ARNTL/BMAL1. CLOCK has an intrinsic acetyltransferase activity, which enables circadian chromatin remodeling by acetylating histones and non-histone proteins, including ARNTL/BMAL1. CLOCK or NPAS2 and ARNTL/BMAL1 or ARNTL2/BMAL2 are reported to form the positive limb of the feedback loop, and as a heterodimer activate the transcription of core clock genes and clock-controlled genes. PER1/2/3 and CRY1/2 act as transcriptional repressors and form the negative limb of the feedback loop and inhibit transcription activation. CLOCK is expressed equally in brain, eye, testes, ovaries, liver, heart, lung, and kidney. In the brain, expression is abundant in the suprachiasmatic nuclei, pyriform cortex, and in the hippocampus.
Specificity
This guinea pig polyclonal antibody detects Circadian locomoter output cycles protein kaput (CLOCK) in human and murine cells. It targets an epitope within 39 amino acids from the internal region.ImmunogenEpitope: unknown
KLH-conjugated linear peptide corresponding to 39 amino acids from the internal region of murine Circadian locomoter output cycles protein kaput (CLOCK).ApplicationImmunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Circadian CLOCK in A431, HUVEC, and NIH/3T3 cells.
Chromatin Immunoprecipitation (ChIP) Analysis: A representative lot detected CLOCK in beta-TC6 cells (Perelis, M., et. al. (2015). Science. 350(6261):aac4250).
ChIP-seq Analysis: A representative lot detected CLOCK in beta-TC6 cells (Perelis, M., et. al. (2015). Science. 350(6261):aac4250).
Anti-CLOCK, Cat. No. ABE2598, is a highly specific guinea pig polyclonal antibody that targets Circadian locomoter output cycles protein kaput and has been tested in Chromatin Immunoprecipitation (ChIP). ChIP-seq, and Immunocytochemistry.
Research Category
Epigenetics & Nuclear Function
Quality
Evaluated by Immunocytochemistry in HeLa cells.
Immunocytochemistry Analysis: A 1:100 dilution of this antibody detected CLOCK in HeLa cells.
Target description
96.39 kda calculated.
Physical form
Purified guinea pig polyclonal antibody in PBS with 0.05% sodium azide.
Affinity Purified
Format: Purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source guinea pig antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal species reactivity human, mouse packaging antibody small pack of 25 µL application(s) ChIP: suitable (ChIP-seq)","immunocytochemistry: suitable isotype IgG NCBI accession no. NP_031741, UniProt accession no. O08785,
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CLSTN1 antibody produced in rabbit
Human Protein Atlas Number: HPA012412 Human Protein Atlas characterization data
Кат. номер HPA012412-100UL HPA012412-25UL ImmunogenCalsyntenin-1 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CLSTN1 (Calsyntenin 1) is a type I single-pass transmembrane cargo-docking protein expressed by the neurons. It consists of an amino acid rich region at the N-terminal extracellular end. It is highly involved in the removal of aberrant kinesin-1 (KLC) from periphery. Its small WD motif directly binds to the light chain subunit of KLC to guide KLC mediated axonal transport of membrane-bounded organelles. It also provides neuronal transport guidance to the amyloid-β precursor protein (APP).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72247,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SHEPFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNS conjugate unconjugated UniProt accession no. O94985, shipped in wet ice storage temp. 20°C Gene Information human ... CLSTN1(22883)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CNOT4 antibody produced in rabbit
Human Protein Atlas Number: HPA005737 Human Protein Atlas characterization data
Кат. номер HPA005737-100UL HPA005737-25UL ImmunogenCCR4-NOT transcription complex subunit 4 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CCR4-NOT transcription complex, subunit 4 is a protein encoded by the CNOT4 gene in humans. It is referred as NOT4, NOT4H and CLONE243. It is a global regulator of RNA polymerase II transcription. It is a component of the CCR4-NOT complex and contains a RING finger motif of the C(4)C(4) type. It functions as a ubiquitin-protein ligase (E3). It is a novel positive regulator of the JAK/STAT pathway in drosophila as well as in humans.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86909,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRF UniProt accession no. O95628, shipped in wet ice storage temp. 20°C Gene Information human ... CNOT4(4850)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CNTF antibody produced in rabbit
Human Protein Atlas Number: HPA019654 Human Protein Atlas characterization data
Кат. номер HPA019654-100UL HPA019654-25UL General descriptionCNTF (Ciliary neurotrophic factor) is a neural cytokine belonging to the hematopoietic cytokine subfamily. It is predominantly expressed in the anterior nuclei of the thalamus.ImmunogenCiliary neurotrophic factor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CNTF (Ciliary neurotrophic factor) is crucial for the survival of ciliary ganglion neurons. The signaling cascade initiated by CNTF is mediated by heteromeric receptor complex composed of CNTF receptor α, leukemia inhibitory factor receptor β and glycoprotein gp130. The binding of CNTF to the receptor complex results in the activation of pathways involving Jak and STAT family of DNA-binding transcription factors. The effective therapeutic use of CTNF has been studied in retinitis pigmentosa, Parkinson′s disease, Huntington′s disease and other neurodegenerative disorders.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74514,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNK conjugate unconjugated UniProt accession no. Q96JP5, shipped in wet ice storage temp. 20°C Gene Information human ... ZFP91(1270)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Coagulation factor VIIa
eCl@ss: 32160702 NACRES: NA.41
Кат. номер ABS2183 ABS2183-25UG General descriptionCoagulation factor VII (UniProt: P08709; also known as EC: 3.4.21.21, Proconvertin, Serum prothrombin conversion accelerator, SPCA) is encoded by the F7 gene (Gene ID: 2155) in human. Coagulation factor VII is a member of the peptidase S1 family that initiates the extrinsic pathway of blood coagulation. It is serine protease that is synthesized with a signal peptide (aa 1-20) and a propeptide (aa 21-60) and circulates in the blood in a zymogen form. The mature form is a heterodimer of a light and a heavy chain. It is a vitamin K-dependent protease that binds to calcium following enzymatic carboxylation of some glutamate residues. Factor VII is converted to Factor VIIa by the action of Factor Xa, Factor XIIa, Factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, Factor VIIa converts factor X to factor Xa by cleavage of Arg-|-Ile bond. Factor VIIa also converts factor IX to factor IXa in the presence of tissue factor and calcium. Factor VII deficiency resulting from mutations in F7 gene can lead to hemorrhagic complications.
Specificity
This rabbit polyclonal antibody detects coagulation factor VIIa in human.ImmunogenFull-length human recombinant Coagulation factor VIIa.ApplicationAnti-Coagulation factor VIIa Antibody, Cat. No. ABS2183, is a rabbit polyclonal antibody that detects Coagulation factor VIIa and has been tested for use in Immunocytochemistry, Immunofluorescence, and Western Blotting.
Immunofluorescence Analysis: A representative lot detected Coagulation factor VIIa in endothelial cell cultures incubated with rFVIIa (6 mg/mL) for 2 h at 37C.
Immunocytochemistry Analysis: A representative lot detected Coagulation factor VIIa in umbilical cord veins.
Quality
Evaluated by Western Blotting in human placental tissue lysate.
Western Blotting Analysis: 1 µg/mL of this antibody detected Coagulation factor VIIa in 10 µg of human placental tissue lysate.
Target description
~57 kDa observed; 51.59 kDa calculated. Uncharacterized bands may be observed in some lysate(s).Other NotesConcentration: Please refer to lot specific datasheet.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity human species reactivity (predicted by homology) primate (based on 100% sequence homology) packaging antibody small pack of 25 µg application(s) immunocytochemistry: suitable","immunofluorescence: suitable","western blot: suitable isotype IgG NCBI accession no. NP_000122, UniProt accession no. P08709,
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Collagen, Type X antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200800-25UL SAB4200800-100UL General descriptionThe extracellular matrix (ECM) found in the extracellular environment of all tissues and organs, provides the physical microenvironment for cells and a substrate for cell anchorage. It serves as a tissue scaffold and is a dynamic structure whose organization and composition modulate various cellular processes including cell proliferation, attachment, migration, differentiation and survival. The composition of the extracellular framework of all vertebrates is dominated by a Collagen protein family, each member with unique features suited for its function and location.
Type X collagen,also known as Collagen alpha-1(X) chain (COL10A1), is a product of hypertrophic chondrocytes. It shares a similar domain structure with type VIII collagen. In addition, both collagen types represent major components of hexagonal lattice structure, in which the collagen molecules link together by interactions involving the non-triple-helical end regions. Despite these similarities, a distinct tissue distribution has been found for these two molecules: type VIII collagen is distributed in various tissues, whereas type X is restricted to normal fetal hypertrophic cartilage in the growth zones of long bones, vertebrae and ribs and in adult (> 21 yr) thyroid cartilage. It is also found in bone fracture callus, osteoarthritic cartilage and chondrogenic neoplasms, and may be involved in cartilage mineralization. Type X collagen is non-fibrillar, but forms fine pericellular filaments in association with cartilage collagen. It interacts with matrix proteins, such as connexin V, chondrocalcein, collagen II and proteoglycans, as well as with Ca2+ . Mutations in this gene are associated with schmid metaphyseal chondroplasia (MCDS).
The development of antibodies against collagens has provided a powerful method for examining the distribution of these connective tissue proteins and for investigation of epithelial-mesenchymal interactions, tumorigenesis and basement membrane biology in ontogeny and epithelial differentiation.8 Antibodies that react specifically with collagen type X are useful for the study of specific differential tissue expression and the localization of collagen type X.ImmunogenPorcine collagen type XApplicationMonoclonal Anti-Collagen, Type X specifically recognizes native and denatured collagen type X. It does not recognize collagen types I, II, III, V, IX and XI. Reactivity has been observed with human, deer and porcine collagen type X. The antibody is recommended to use in various immunological techniques, including Immunoblotting (∼ 60 kDa in denatured-reduced preparation), Immunofluorescence and Immunohistochemistry.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.Other NotesThis product is for R&D use only, not for drug, household, or other uses.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone COL-10, monoclonal form buffered aqueous solution mol wt ~60 kDa species reactivity deer, porcine, human packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: suitable","immunofluorescence: 5-10 µg/mL using human osteosarcoma SaOS-2 cells","immunohistochemistry: suitable isotype IgM UniProt accession no. Q03692, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Complement C3a/C3a (desArg) Antibody, clone K13/16
eCl@ss: 32160702
Кат. номер MABF1978 MABF1978-25UL General descriptionComplement C3 (UniProt: P01024; also known as C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1) is encoded by the C3 (also known as CPAMD1) gene (Gene ID: 718) in human. C3 is a secreted protein that plays a key role in the activation of the complement system. It s processing by C3 convertase is the central reaction in both classical and alternative complement pathways. C3 has an anaphylatoxon-like domain (aa 693-728) and a NTR (Netrin) domain (aa 1518-1661). IC3 precursor is first processed by the removal of four Arginine residues, forming two chains, beta and alpha, linked by a disulfide bond. C3 convertase activates C3 by cleaving the alpha chain, releasing C3a anaphylatoxin and generating C3b. C3a appears to be important in many inflammatory respons-es and the C3b fragment covalently binds to the cell or bacterial surface and plays a role in opsonisation. C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, it acts as a chemoattractant for neutrophils. Defects in C3 gene can cause complement component 3 deficiency that leads to recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Defects in C3 gene also cause age-related macular degeneration and hemolytic uremic syndrome that can lead to hemolytic anemia and renal failure
Specificity
Clone K13/16 recognizes complement C3a in human tissues. It targets an epitope that is present on human C3, C3a, and C3a-desArg.ImmunogenA full length native C3a fragment purified from human serum that was activated at 37°C for 1 hour by treatment with 10 mg/mL zymosan.ApplicationImmunohistochemistry Analysis: A 1:50 dilution from a representative lot detected Complement C3a/C3a (desArg) in human liver and human tonsil tissue.
Agonist or Inhibitor Analysis: Administration of C3a induces a transient influx of Ca2+ release in a dose dependent manner (fluo-3 staining on human PMNs). In this regard, it functions as an agonist for the C3a receptor (Elsner, J., et. al. (1994). Blood. 83(11):3324-31).
Neutralizing Analysis: A representative lot detected Complement C3a/C3a (desArg) in Neutralizing applications (Elsner, J., et. al. (1994). Blood. 83(11):3324-31).
Flow Cytometry Analysis: A representative lot detected Complement C3a/C3a (desArg) in Flow Cytometry applications (Elsner, J., et. al. (1994). Blood. 83(11):3324-31).
Anti-Complement C3a/C3a (desArg), clone K13/16, Cat. No. MABF1978, is a mouse monoclonal antibody that detects Complement C3a and has been tested for use in Flow Cytometry, Immunohistochemistry (Paraffin), Neutralization, and Agonist and Inhibition studies.
Research Category
Inflammation & Immunology
Quality
Evaluated by Immunohistochemistry in human kidney tissue.
Immunohistochemistry Analysis: A 1:50 dilution of this antibody detected Complement C3a/C3a (desArg) in human kidney tissue sections.
Target description
187.15 kDa calculated.
Physical form
Purified mouse monoclonal antibody IgG1 in buffer containing 0.1 M Tris-Glycine (pH 7.4), 150 mM NaCl with 0.05% sodium azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source mouse antibody form purified antibody antibody product type primary antibodies clone K13/16, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) flow cytometry: suitable","immunohistochemistry: suitable (paraffin)","neutralization: suitable isotype IgG1 NCBI accession no. NP_000055, UniProt accession no. P01024, shipped in ambient
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Complement receptor C5aR (CD88) Antibody, clone S5/1
eCl@ss: 32160702
Кат. номер MABF1980-25UL MABF1980-100UL General descriptionC5a anaphylatoxin chemotactic receptor 1 (UniProt: P21730; also known as C5a anaphylatoxin chemotactic receptor, C5a-R, C5aR, CD88) is encoded by the C5AR1 (also known as C5AR, C5R1) gene (Gene ID: 728) in human. C5aR is a multi-pass membrane protein that serves as a receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. It exists as a homodimer, but can also form higher-order oligomers. C5a interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region, which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, and intracellular calcium release and superoxide anion production. Chemotaxis inhibitory protein of Staphylococcus aureus (CHIPS), a 121-residue protein, is reported to bind to the N-terminus of the C5aR (aa 1-35) with nanomolar affinity and inhibits C5a-mediated responses in human leukocytes. Sulfation at Tyrosine 14 is shown to be important for CHIPS binding. Upon C5a binding, C5aR) undergoes rapid phosphorylation on the six serine residues present in the C-terminal region followed by desensitization and internalization. The key residues involved in this process are Serine 334 and Serine 338. Phosphorylated C5aR is shown to co-localize with beta-arrestin 1 and 2 in cytoplasmic vesicles. Although C5aR activation is able to promote a loose association with beta-arrestins, but phosphorylation of either Serine 334)/338 or Serine 327)/338 is reported to be essential for the formation of a persistent complex. (Ref.: Ippel, JH., et al., (2009). J. Biol. Chem. 284(18); 12363 12372; Braun, L., et al. (2003). J. Biol. Chem. 278(6); 4277-4285).
Specificity
Clone S5/1 specifically detects C5a anaphylatoxin chemotactic receptor 1 (C5aR). It targets an epitope within the first 31 amino acids from the N-terminal region.ImmunogenBSA-conjugated linear peptide corresponding to the first 31 amino acids from the N-terminal region of human C5a anaphylatoxin chemotactic receptor 1.
Epitope: N-terminusApplicationAnti-Complementreceptor C5aR (CD88), clone S5/1, Cat. No. MABF1980 is a mouse monoclonal antibody that detects C5a anaphylatoxin chemotactic receptor 1 and has been tested for use in ELISA, Flow Cytometry, Immunoprecipitation, Inhibition/Activity assays, andn Western Blotting.
ELISA Analysis: A representative lot detected Complementreceptor C5aR (CD88) in ELISA applications (Pollok-Kopp, B., et. al. (2007). J Biol Chem. 282(7):4345-53).
Inhibits Activity/Function Analysis: A representative lot detected Complementreceptor C5aR (CD88) in Inhibits Activity applications (Oppermann, M., et. al. (1993). J Immunol. 151(7):3785-94).
Flow Cytometry Analysis: A representative lot detected Complementreceptor C5aR (CD88) in Flow Cytometry applications (Oppermann, M., et. al. (1993). J Immunol. 151(7):3785-94; Pollok-Kopp, B., et. al. (2007). J Biol Chem. 282(7):4345-53).
Immunoprecipitation Analysis: A representative lot detected Complementreceptor C5aR (CD88) in Immunoprecipitation applications (Pollok-Kopp, B., et. al. (2007). J Biol Chem. 282(7):4345-53).
Research Category
Inflammation & Immunology
Quality
Evaluated by Western Blotting in two BSA-conjugated C5aR peptides (aa 1-31 and 327-344) phosphorylated at Serine 332, 334, and 338.
Western Blotting Analysis: A 1:20,000 dilution of this antibody detected Complementreceptor C5aR (CD88) in two BSA-conjugated C5aR peptides (aa 1-31 and 327-344) phosphorylated at Serine 332, 334, and 338
Target description
~100-110 kDa observed; 39.34 kDa calculated. Uncharacterized bands may be observed in some lysate(s).
Physical form
Purified mouse monoclonal antibody IgG2a in PBS without azide.
Format: Purified
Protein G purified
Storage and Stability
Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Other NotesConcentration: Please refer to lot specific datasheet.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified immunoglobulin antibody product type primary antibodies clone S5/1, monoclonal species reactivity human packaging antibody small pack of 25 µL application(s) ELISA: suitable","activity assay: suitable","flow cytometry: suitable","immunoprecipitation (IP): suitable","inhibition assay: suitable","western blot: suitable isotype IgG2a NCBI accession no. NP_001727.1, UniProt accession no. P21730, -
Anti-Complement Receptor C5aR Antibody, clone 20/70
eCl@ss: 32160702
Кат. номер MABF1976 MABF1976-25UG General descriptionC5a anaphylatoxin chemotactic receptor 1 (UniProt: P30993; also known as C5a anaphylatoxin chemotactic receptor, C5a-R, C5aR, CD88) is encoded by the C5ar1 (also known as C5ar, C5r1) gene (Gene ID: 12273) in murine species. C5aR is a multi-pass membrane protein of the G-protein coupled receptor 1 family that serves as a receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. C5aR is a homodimer, but can also form higher-order oligomers. C5aR becomes phosphorylated on serine residues in response to C5a binding that results in internalization of the receptor and short-term desensitization to C5a. The phosphorylated receptor is known to Interact with arrestin beta 1 and 2 (ARRB1 and 2) and this interaction is associated with internalization of C5aR. Sulfation is also reported to play a critical role in the association of C5aR with C5a, but it does not alter the ability of the receptor to transduce a signal and mobilize calcium in response to a small peptide agonist.
Specificity
Clone 20/70 detects complement 5a receptor in murine species. It targets an epitope with in the extracellular domain.ImmunogenRat basophilic leukemia RBL-2H3 cells stably expressing murine C5aR.ApplicationAnti-Complement Receptor C5aR, clone 20/70, Cat. No. MABF1976, is a rat monoclonal antibody that detects Complement 5a receptor (C5aR) and has been tested for use in Flow Cytometry, Activity Assay, Inhibition of Activity/Function, Immunocytochemistry, and Neutralizing.
Neutralizing Analysis: A representative lot neutralized Complement receptor C5aR (Godau, J., et. al. (2004). J Immunol. 173(5):3437-45).
Immunocytochemistry Analysis: A representative lot detected Complement receptor C5aR in Immunocytochemistry applications (Soruri, A., et. al. (2003). Immunol Lett. 88(1):47-52).
Inhibits Activity/Function Analysis: A representative lot inhibited Complement receptor C5aR in Activity/Function applications (Godau, J., et. al. (2004). J Immunol. 173(5):3437-45; Soruri, A., et. al. (2003).
Flow Cytometry Analysis: A representative lot detected Complement receptor C5aR in Flow Cytometry applications (Shushakova, N., et. al. (2002). J Clin Invest. 110(12):1823-30).
Activity Assay Analysis: A representative lot detected Complement receptor C5aR in Activity Assay applications (Shushakova, N., et. al. (2002). J Clin Invest. 110(12):1823-30).
Quality
Evaluated by Flow Cytometry in BALB/c mouse bone marrow cells.
Flow Cytometry Analysis: 1 µg of this antibody detected Complement receptor C5aR in 1 million BALB/c mouse bone marrow cells.
Target description
39.02 kDa calculated.
Physical form
Format: PurifiedOther NotesConcentration: Please refer to lot specific datasheet.ПараметрыQuality Level 100 biological source rat antibody form purified immunoglobulin antibody product type primary antibodies clone 20/70, monoclonal species reactivity mouse packaging antibody small pack of 25 µg application(s) activity assay: suitable","flow cytometry: suitable","immunocytochemistry: suitable","neutralization: suitable isotype IgG2b NCBI accession no. NP_031603.2, UniProt accession no. P30993,
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Connexin 43 Antibody, CT, cytosolic
eCl@ss: 32160702
Кат. номер AB1728-25UG AB1728 General descriptionMouse Connexin 43 is a 382 amino acid gap junction protein with a predicted M.W. of ~43 kDa. It is prominently expressed in heart (see reviews: Kumar & Giula 1996; White et al. 1995; Evans 1994; Beyer et al. 1990).
Connexin 43 (GJA1) is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. GJA1 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. GJA1 is targeted by several protein kinases that regulate myocardial cell cell coupling. A related intronless GJA1 pseudogene, GJA1P, has been mapped to chromosome 5. Mouse Connexin 43 is a 382 amino acid gap junction protein with a predicted M.W. of ~43 kDa. It is prominently expressed in heart (Kumar, N. and Giula, N., 1996, Cell 84: 381-388).
Specificity
Recognizes mouse Connexin 43.
Mouse C×43 immunogenic peptide sequence is specific for C×43 and no significant homology is seen with other connexins. The mouse C×43 peptide sequence is 100% homologous with rat and human C×43 (Beyer, E. et al., 1985, JCB 105: 2621).ImmunogenEpitope: C-term/cytosolic
Anti-Connexin 43 is made against a 23 amino acid C-terminal peptide sequence within the cytoplasmic domain of mouse C×43 (Beyer, E. and Steinberg, T. ,1991, JBC 266: 7971).ApplicationResearch Category
Cell Structure
Anti-Connexin 43 Antibody, C-terminus, cytosolic is an antibody against Connexin 43 for use in ELISA, IF, IH, IP & WB.
Immunoprecipitation:
2-10 µg of a previous lot was used in immunoprecipitation.
ELISA:
A previous lot of this antibody was used at 1:10,000-100,000 dilution using 50 - 100 ng Cx43 control peptide (Catalog number AG636) per well.
Optimal working dilutions must be determined by end user.
Research Sub Category
Adhesion (CAMs)
Quality
Routinely evaluated by Western Blot on Huvec lysates.
Western Blot Analysis: 1:500 dilution of this lot detected CONNEXIN 43 on 10 µg of Huvec lysates.
Target description
43 kDa
Physical form
ImmunoAffinity Purified
Purified rabbit polyclonal in buffer containing 0.02 M phosphate buffer, 0.25 M NaCl, with 0.1% sodium azide as a preservative.
Storage and Stability
Stable for up to 1 year at 2-8°C in undiluted aliquots from date of receipt.
Analysis Note
Control
Positive Control: Heart tissue, mouse brain tissue lysate.Other NotesConcentration: Please refer to the Certificate of Analysis for the lot-specific concentration.Legal InformationCHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal purified by affinity chromatography species reactivity mouse, rat, human packaging antibody small pack of 25 µg Торговая марка Chemicon® application(s) ELISA: suitable","immunofluorescence: suitable","immunohistochemistry: suitable","immunoprecipitation (IP): suitable","western blot: suitable NCBI accession no. NP_000156, UniProt accession no. P17302, shipped in ambient Gene Information human ... GJA1(2697)
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Connexin 43 antibody, Mouse monoclonal
NACRES: NA.41
Кат. номер SAB4200819-25UL SAB4200819-100UL General descriptionMonoclonal Anti-Connexin 43 (mouse IgM isotype) is derived from the hybridoma CXN-6 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide from the C-terminal region of Connexin 43 protein, conjugated to KLH. Connexin 43 protein (Cx43), also known as Gap junction α-1 protein or Gap junction 43 kDa heart protein. It has four transmembrane domains (TMs). The N and C-terminal cytoplasmic tails orient in plasma membrane. It also has two extracellular loop (EL) domains and a cytoplasmic loop (CL). Six connexin subunits form a connexon or hemichannel in the plasma membrane and a head-to-head docking between two hemichannels result in the formation of a gap junction channel. Cx43 is expressed in heart and brain. It is expressed in cell types including the melanocytes, keratinocytes, endothelial and basal cells. Cx43 has been mapped to human chromosome 6q22.31.
Specificity
Monoclonal Anti-Connexin 43 specifically recognizes Connexin 43 from human1,2, mouse2, rat3, porcine4, chicken5 and feline6 origin.ImmunogenSynthetic peptide corresponding to human connexin-43 C-terminal region, conjugated to KLHApplicationThe antibody may be used in various immunochemical techniques including Immunoblot (~43 kDa), Immunohistochemistry and Immunofluorescence.
Biochem/physiol Actions
Connexin 43 (Cx43) functions as a neuroprotector and is most prominently expressed in astrocytes and microglial cells in the brain. It plays a key role in intercellular communication. Cx43 mediates synchronized contraction of the heart. It modulates of the cell migration and cell adhesion processes. Altered connexin 43 expression is implicated in hypertrophic cardiomyopathy. It is less expressed in human tumors. It is a potential target for treating skin disorders. Its downregulation favours wound healing.
Physical form
Supplied as a solution in 0.01 M phosphate buffered saline pH 7.4, containing 15 mM sodium azide as a preservative.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone CXN-6, monoclonal mol wt ~43 kDa species reactivity feline, human, chicken, mouse, rat, porcine packaging antibody small pack of 25 µL concentration ~1 mg/mL application(s) immunoblotting: 0.5-1 µg/mL, immunofluorescence: 10-20 µg/mL isotype IgM shipped in dry ice storage temp. 20°C Gene Information Porcine ... GJA1(100518636)
chicken ... GJA1(395278)
feline ... GJA1(101100211)
human ... GJA1(2697)
mouse ... GJA1(14609)
rat ... GJA1(24392)
Safety InformationWGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable -
Anti-Connexin-43 antibody produced in rabbit
MDL number: MFCD00803532 NACRES: NA.41
Кат. номер C6219-.2ML C6219-100UL C6219-25UL General descriptionThe 43 kDa connexin protein (connexin 43, Cx43) is a phosphoprotein that is expressed in most tissues, even though the pattern of expression may differ in various cell types (e.g., in the brain, it is found in astrocytes, ependyma and leptomeninges, but not in neurons, oligodendrocytes and pinealocytes; or in the liver, it is present in Ito cells, but not in hepatocytes). Gap junction protein levels change in response to disruption of tissue architecture. For instance, an increased expression of Cx43 was found in early stages of atherosclerosis.
Anti-Connexin 43 is developed in rabbit using a synthetic peptide conjugated to KLH with glutaraldehyde as immunogen. The peptide corresponds to a C-terminal segment of the cytoplasmic domain of human and rat connexin 43, amino acid residues, with an N-terminal added lysine. Affinity isolated antigen specific antibody is obtained by immunospecific purification which removes essentially all rabbit serum proteins, including immunoglobulins, which do not specifically bind to connexin 43.
Gap junctions are specialized cell membrane domains consisting of aggregations of intercellular channels that directly connect the cytoplasm of adjacent cells. Gap junctions coordinate cellular and organ function in tissues and are involved in metabolic cooperation between cells, electrical coupling, synchronization of cellular physiological activities, growth control, and developmental regulation. The gap junction channels allow intercellular exchange of ions, nucleotides and small molecules between adjacent cells. Unlike other membrane channels, intercellular channels span two opposed plasma membranes and require the contribution of hemi-channels, called connexons, from both participating cells. These channels are permeable to molecules as large as 1 kDa, and they have been reported in most mammalian cell types. Two connexons interact in the extracellular space to form the complete intercellular channel. Each connexon is composed of six similar or identical proteins, which have been termed connexins. Connexins (Cx) are a multi-gene family of highly related proteins with molecular weights ranging from 26 to 70 kDa. At least a dozen distinct connexin genes have been identified in mammals, many expressed in a diverse tissue and cell specific pattern. Two distinct lineages have been identified in mammals, one termed class I or group, in which Cx26, Cx30, Cx31, Cx31.1 and Cx32 fall, and the other termed class II or group, represented by Cx33, Cx37, Cx40, Cx43 and Cx46.
Connexin-43 (Cx-43), a 43kDa protein, is a member of the connexin protein family that forms a gap junction. It is expressed by a variety of cell types, such as astrocytes, cardiac and smooth muscle, endothelium, ependyma, fibroblasts, keratinocytes, lens and corneal epithelium. In addition, the protein is also found in leptomeninges, leucocytes, Leydig cells, macrophages, myoepithelial cells of mammary gland, osteocytes, ovarian granulosa, pancreatic -cells, preimplantation blastocyst, sertoli cells, thyroid follicular cells and trophoblast giant cells.
Specificity
Anti-Connexin 43 reacts specifically with connexin 43. By immunoblotting, the antibody detects a single band or 2-3 bands at 43 kDa region. Staining of connexin 43 band(s) by immunoblotting is specifically inhibited with the connexin 43 peptide. Reactivity has been observed with human, bovine, rat, mouse, hamster and chicken connexin 43.ImmunogenSynthetic peptide corresponding to the C-terminal segment of the cytoplasmic domain (amino acids with N-terminally added lysine) of human/rat connexin-43.ApplicationAnti-Connexin-43 may be used in immunoblotting, immunocytochemistry and immunohistochemistry (frozen and formalin-fixed, paraffin-embedded tissues). Polyclonal antibodies reacting specifically with Cx43 may be applied in diverse cellular and molecular approaches to the study of gap junctions and their properties.
A minimum working dilution of 1:8,000 is determined by immunoblotting using a whole extract from mouse brain.
A minimum working dilution of 1:400 is determined by indirect immunofluorescent staining of acetone-fixed cultured baby hamster kidney (BHK).
A minimum working dilution of 1:2,000 is determined by indirect immunofluorescent staining of rat heart. (Negative on rat liver sections)
A minimum working dilution of 1:2,000 is determined by indirect immunoperoxidase staining of trypsin-digested,formalin-fixed, paraffin-embedded human or animal tissue.
Biochem/physiol Actions
Connexin-43 (Cx-43) might play a vital role in neuronal migration as it resides in radial glial fibers which are closely associated with migrating neurons. It is also involved in transmembrane NAD+ transport. Connexin-43, which is an element of gap junction, facilitates cell-cell communication. Cx-43 is known to induce Ca2+i burst phenomenon in uterine artery endothelial cells (UAECs). Elevated expression of Cx-43 has been observed during early stages of human coronary atherosclerosis. Reduction or alteration in the levels or types of connexin expressed in various cell types correlates with tumor progression and metastasis. However, glioma cells transfected with the oncogene neu (c-erb-B2) exhibit a major reduction in intercellular communication with no decrease in overall expression of Cx43. Different states of rat Cx43 phosphorylation are found during development and lactation. Connexin 43 mutations occur in children whose hearts failed to develop asymmetry and lethal heart malformations occur on knocking out this gene in mice. Polyclonal antibodies reacting specifically with Cx438-11 may be applied in diverse cellular and molecular approaches to the study of gap junctions and their properties, and to correlate their expression pattern in a variety of cell types and tissues with physiological functions or pathological conditions.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% bovine serum albumin and 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For extended storage freeze in working aliquots. Repeated freezing and thawing is not recommended. Storage in "frost-free" freezers is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры